gvim-9.0.2103-150000.5.57.1<>, e_p9|Jw:7P`U&YW(Rx3kKhWQ)-"NkԨ$Q]?ͩ$ ^-ȫ^ Ap }qKJ-ve>[8 / >8B0`>Q#_ z\v<1T3΄]^>Hd?Td  +8<HLe R0 n  (  x  * P  , ,,(8$9: 0>@BFGH|IXY|Z[\X]^bc>defluvPw4xy,2zPCgvim9.0.2103150000.5.57.1A GUI for ViPackage gvim contains the largest set of features of vim, which is graphical windows and language interpreter, like python, ruby, or perl. You need package vim for the help and other documentation too. If you want less features, you might want to install vim instead.e_h02-armsrv2MzmSUSE Linux Enterprise 15SUSE LLC Vimhttps://www.suse.com/Productivity/Text/Editorshttps://www.vim.org/linuxaarch64/usr/sbin/update-alternatives \ --install /usr/bin/vim vim /usr/bin/gvim 30 \ --slave /usr/bin/vi vi /usr/bin/gvimif [ ! -e /usr/bin/gvim ] ; then /usr/sbin/update-alternatives --remove vim /usr/bin/gvim fiK r)U C.&F,A큤e_e_e_re_re_re_re_re_re_re_re_ve_re_re_re_re_re_re_e_rePae_re_re_re_re_re_re_re_re_re_re_r099b104303bb5f3b37aa4f49c3ca048e1b4949cf3179099a05117c4455b1c453761bba80e57d7bb566bd56c4369c6777d92b54f9b77ef8a1edc3ecc4c397feeb9214a5266181ac8e4bb41475f3e1c4c9d66359d7faedf8c2a15f0cbe591a820196946503aad0bab7ef3fa89e74f9fd44294c1ad24aa6ff7c1ee428fc43b8bad96eec36bce6a7817e62c4b15940ab1b42af19292b7ed37d42e268d2c9131b2db708795d7de0debd3ce4d8d7012d3a468d0008a470abeb5b87a46f01ffb7e3ea0b0685688fa3eabffad030fb2450faff870a4db4fb3179b4bf87b1853cb625b001d203547ea1a77a3202cceda1b017a54628250e2f0443e8d947146387145eaa09051e24f1bdf0a66bc7c3d3bb811c5229dbe789119d4dde535a1b92872090cb8f7f1c006a109948927f594b3915999ed80293e0b592a7706efafedb212411be3ca7620817e07ddab0ae17a5cb7bddeda01a42119c9863aacb48f37f1784b17f225bbc8b1988690ddf5be1c0cd1847d3128da54cfd66787308238e7825ee36988cb498011da6e6641951421a79de2e1c6ed4977d08a82afc14538e957c806d7544a8fc3d48d94761e5e255c76c7ddee31b7ef5c0cde8c919cf92a3a0c08ec58390946dce274e5051e4853cb1bf3483966bb349cd2a9e575af7e773c1ffdcaff749gvimgvimgvimgvimgvimgvimgvimgvimgvimgvim/etc/alternatives/vi/etc/alternatives/vim@@Irootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootvim-9.0.2103-150000.5.57.1.src.rpmapplication()application(gvim.desktop)config(gvim)gvimgvim(aarch-64)gvim-basegvim-enhancedgvim_clientmimehandler(application/x-shellscript)mimehandler(text/english)mimehandler(text/plain)mimehandler(text/x-c)mimehandler(text/x-c++)mimehandler(text/x-c++hdr)mimehandler(text/x-c++src)mimehandler(text/x-chdr)mimehandler(text/x-csrc)mimehandler(text/x-java)mimehandler(text/x-makefile)mimehandler(text/x-moc)mimehandler(text/x-pascal)mimehandler(text/x-tcl)mimehandler(text/x-tex)vivim_client@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@    /bin/sh/bin/shconfig(gvim)gvim_clientld-linux-aarch64.so.1()(64bit)ld-linux-aarch64.so.1(GLIBC_2.17)(64bit)libICE.so.6()(64bit)libSM.so.6()(64bit)libX11.so.6()(64bit)libXt.so.6()(64bit)libacl.so.1()(64bit)libacl.so.1(ACL_1.0)(64bit)libattr.so.1()(64bit)libattr.so.1(ATTR_1.0)(64bit)libc.so.6()(64bit)libc.so.6(GLIBC_2.17)(64bit)libcairo.so.2()(64bit)libdl.so.2()(64bit)libdl.so.2(GLIBC_2.17)(64bit)libgdk-3.so.0()(64bit)libgdk_pixbuf-2.0.so.0()(64bit)libgio-2.0.so.0()(64bit)libglib-2.0.so.0()(64bit)libgobject-2.0.so.0()(64bit)libgpm.so.2()(64bit)libgtk-3.so.0()(64bit)libm.so.6()(64bit)libm.so.6(GLIBC_2.17)(64bit)libpango-1.0.so.0()(64bit)libpangocairo-1.0.so.0()(64bit)libperl.so()(64bit)libpthread.so.0()(64bit)libpthread.so.0(GLIBC_2.17)(64bit)librt.so.1()(64bit)librt.so.1(GLIBC_2.17)(64bit)libtinfo.so.6()(64bit)libtinfo.so.6(NCURSES6_TINFO_5.0.19991023)(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)update-alternativesupdate-alternativesvim-data9.0.2103-150000.5.57.13.0.4-14.6.0-14.0-15.2-19.0.2103-150000.5.57.1gvim8.24.14.1e]@e dܺ@dx@dldZ5dJcd'@ccR@c~ @cM@bb@`4@`.V^)@^@^2\@Zľ@ZlZ@Z%Z1@Z@V͛@V͛@VIV@V@VVŲ@V@V@VT@VV@V@V^VVuFVm]Vd#@VQ@VO @VCV VUU6@U@U@UnU@UUUx&U_@U>$U+UUQTT!TD@TfTr@T T TT|TTxcTk4T[bTBV@zbalogh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comjehan.singh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comlnussel@suse.delnussel@suse.delnussel@suse.deidonmez@suse.comlnussel@suse.deidonmez@suse.comstefan.bruens@rwth-aachen.dekukuk@suse.delnussel@suse.deidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comtchvatal@suse.comidonmez@suse.comnormand@linux.vnet.ibm.comsuse-beta@cboltz.deidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.commpluskal@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comwerner@suse.deidonmez@suse.comidonmez@suse.comidonmez@suse.comtchvatal@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comkukuk@suse.desuse-beta@cboltz.dekukuk@suse.deidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comdimstar@opensuse.orgidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comcrrodriguez@opensuse.orgidonmez@suse.comidonmez@suse.comidonmez@suse.comsuse-beta@cboltz.deidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comopensuse@cboltz.deidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comlars@linux-schulserver.deidonmez@suse.comidonmez@suse.comidonmez@suse.comopensuse@cboltz.de- Updated to version 9.0 with patch level 2103, fixes the following security problems * Fixing bsc#1215940 (CVE-2023-5344) - VUL-0: CVE-2023-5344: vim: Heap-based Buffer Overflow in vim prior to 9.0.1969. * Fixing bsc#1216001 (CVE-2023-5441) - VUL-0: CVE-2023-5441: vim: segfault in exmode when redrawing * Fixing bsc#1216167 (CVE-2023-5535) - VUL-0: CVE-2023-5535: vim: use-after-free from buf_contents_changed() * Fixing bsc#1216696 (CVE-2023-46246) - VUL-0: CVE-2023-46246: vim: Integer Overflow in :history command - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.1894...v9.0.2103- Updated to version 9.0 with patch level 1894, fixes the following security problems * Fixing bsc#1214922 (CVE-2023-4738) - VUL-0: CVE-2023-4738: vim: heap-buffer-overflow in vim_regsub_both * Fixing bsc#1214924 (CVE-2023-4735) - VUL-0: CVE-2023-4735: vim: OOB Write ops.c * Fixing bsc#1214925 (CVE-2023-4734) - VUL-0: CVE-2023-4734: vim: segmentation fault in function f_fullcommand * Fixing bsc#1215004 (CVE-2023-4733) - VUL-0: CVE-2023-4733: vim: use-after-free in function buflist_altfpos * Fixing bsc#1215006 (CVE-2023-4752) - VUL-0: CVE-2023-4752: vim: Heap Use After Free in function ins_compl_get_exp * Fixing bsc#1215033 (CVE-2023-4781) - VUL-0: CVE-2023-4781: vim: heap-buffer-overflow in function vim_regsub_both - drop patches: disable-unreliable-tests.patch ignore-flaky-test-failure.patch vim-8.1.0297-dump3.patch - dropped %check - most of tests didn't work correctly in OBS and maintenance burden of this was getting too big - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.1632...v9.0.1894- Use app icon generated from vimlogo.eps in source tarball; add higher res icons of sizes 128, 256, and 512px as png sources. Our current icons deviate from upstream flatpaks for example. - Updated to version 9.0 with patch level 1632 - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.1443...v9.0.1632- Updated to version 9.0 with patch level 1572, fixes the following security problems * Fixing bsc#1210996 (CVE-2023-2426) - VUL-0: CVE-2023-2426: vim: Use of Out-of-range Pointer Offset in GitHub repository vim/vim prior to 9.0.1499. * Fixing bsc#1211256 (CVE-2023-2609) - VUL-1: CVE-2023-2609: vim: NULL Pointer Dereference prior to 9.0.1531 * Fixing bsc#1211257 (CVE-2023-2610) - VUL-1: CVE-2023-2610: vim: Integer Overflow or Wraparound prior to 9.0.1532 - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.1443...v9.0.1572- Fixing bsc#1211461 - L3: vim "eats" first character from prompt in xterm * Add: reorder-exit-raw-mode.patch * Swaps out_str_t_TE() and cursor_on() during exit to prevent missing characters in xterm prompt on exit.- Fixing bsc#1211144 - [Build 96.1] openQA test fails in zypper_migration - conflict between xxd and vim * Revert the creation standalone xxd packages- Updated to version 9.0 with patch level 1443, fixes the following security problems * Fixing bsc#1209042 (CVE-2023-1264) - VUL-0: CVE-2023-1264: vim: NULL Pointer Dereference vim prior to 9.0.1392 * Fixing bsc#1209187 (CVE-2023-1355) - VUL-0: CVE-2023-1355: vim: NULL Pointer Dereference prior to 9.0.1402. * Fixing bsc#1208828 (CVE-2023-1127) - VUL-1: CVE-2023-1127: vim: divide by zero in scrolldown() - drop vim-8.0-ttytype-test.patch as it changes test_options.vim which we remove during %prep anyway. And this breaks quilt setup. - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.1386...v9.0.1443- Updated to version 9.0 with patch level 1386, fixes the following security problems * Fixing bsc#1207780 - (CVE-2023-0512) VUL-0: CVE-2023-0512: vim: Divide By Zero in GitHub repository vim/vim prior to 9.0.1247 * Fixing bsc#1208957 - (CVE-2023-1175) VUL-0: CVE-2023-1175: vim: Incorrect Calculation of Buffer Size * Fixing bsc#1208959 - (CVE-2023-1170) VUL-0: CVE-2023-1170: vim: Heap-based Buffer Overflow in vim prior to 9.0.1376 * Fixing bsc#1208828 - (CVE-2023-1127) VUL-1: CVE-2023-1127: vim: divide by zero in scrolldown() - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.1234...v9.0.1386- Updated to version 9.0 with patch level 1234, fixes the following security problems * Fixing bsc#1207396 VUL-0: CVE-2023-0433: vim: Heap-based Buffer Overflow in vim prior to 9.0.1225 * Fixing bsc#1207162 VUL-1: CVE-2023-0288: vim: Heap-based Buffer Overflow in GitHub repository vim/vim prior to 9.0.1189. * Fixing bsc#1206868 VUL-1: CVE-2023-0054: vim: Out-of-bounds Write in GitHub repository vim/vim prior to 9.0.1145. * Fixing bsc#1206867 VUL-1: CVE-2023-0051: vim: Heap-based Buffer Overflow in GitHub repository vim/vim prior to 9.0.1144. * Fixing bsc#1206866 VUL-1: CVE-2023-0049: vim: Out-of-bounds Read in GitHub repository vim/vim prior to 9.0.1143. - refreshed vim-7.4-highlight_fstab.patch - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.1040...v9.0.1234- Updated to version 9.0 with patch level 1040, fixes the following security problems * Fixing bsc#1206028 VUL-0: CVE-2022-3491: vim: Heap-based Buffer Overflow prior to 9.0.0742 * Fixing bsc#1206071 VUL-0: CVE-2022-3520: vim: Heap-based Buffer Overflow * Fixing bsc#1206072 VUL-0: CVE-2022-3591: vim: Use After Free * Fixing bsc#1206075 VUL-0: CVE-2022-4292: vim: Use After Free in GitHub repository vim/vim prior to 9.0.0882. * Fixing bsc#1206077 VUL-0: CVE-2022-4293: vim: Floating Point Comparison with Incorrect Operator in GitHub repository vim/vim prior to 9.0.0804. * Fixing bsc#1205797 VUL-0: CVE-2022-4141: vim: heap-buffer-overflow in alloc.c 246:11 * Fixing bsc#1204779 VUL-0: CVE-2022-3705: vim: use after free in function qf_update_buffer of the file quickfix.c - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.814...v9.0.1040- Updated to version 9.0 with patch level 0814, fixes the following problems * Fixing bsc#1192478 VUL-1: CVE-2021-3928: vim: vim is vulnerable to Stack-based Buffer Overflow * Fixing bsc#1203508 VUL-0: CVE-2022-3234: vim: Heap-based Buffer Overflow prior to 9.0.0483. * Fixing bsc#1203509 VUL-1: CVE-2022-3235: vim: Use After Free in GitHub prior to 9.0.0490. * Fixing bsc#1203820 VUL-0: CVE-2022-3324: vim: Stack-based Buffer Overflow in prior to 9.0.0598. * Fixing bsc#1204779 VUL-0: CVE-2022-3705: vim: use after free in function qf_update_buffer of the file quickfix.c * Fixing bsc#1203152 VUL-1: CVE-2022-2982: vim: use after free in qf_fill_buffer() * Fixing bsc#1203796 VUL-1: CVE-2022-3296: vim: stack out of bounds read in ex_finally() in ex_eval.c * Fixing bsc#1203797 VUL-1: CVE-2022-3297: vim: use-after-free in process_next_cpt_value() at insexpand.c * Fixing bsc#1203110 VUL-1: CVE-2022-3099: vim: Use After Free in ex_docmd.c * Fixing bsc#1203194 VUL-1: CVE-2022-3134: vim: use after free in do_tag() * Fixing bsc#1203272 VUL-1: CVE-2022-3153: vim: NULL Pointer Dereference in GitHub repository vim/vim prior to 9.0.0404. * Fixing bsc#1203799 VUL-1: CVE-2022-3278: vim: NULL pointer dereference in eval_next_non_blank() in eval.c * Fixing bsc#1203924 VUL-1: CVE-2022-3352: vim: vim: use after free * Fixing bsc#1203155 VUL-1: CVE-2022-2980: vim: null pointer dereference in do_mouse() * Fixing bsc#1202962 VUL-1: CVE-2022-3037: vim: Use After Free in vim prior to 9.0.0321 - ignore-flaky-test-failure.patch: Ignore failure of flaky tests - disable-unreliable-tests-arch.patch: Removed - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.0313...v9.0.0814- Updated to version 9.0 with patch level 0313, fixes the following problems * Fixing bsc#1200884 Vim: Error on startup * Fixing bsc#1200902 VUL-0: CVE-2022-2183: vim: Out-of-bounds Read through get_lisp_indent() Mon 13:32 * Fixing bsc#1200903 VUL-0: CVE-2022-2182: vim: Heap-based Buffer Overflow through parse_cmd_address() Tue 08:37 * Fixing bsc#1200904 VUL-0: CVE-2022-2175: vim: Buffer Over-read through cmdline_insert_reg() Tue 08:37 * Fixing bsc#1201249 VUL-0: CVE-2022-2304: vim: stack buffer overflow in spell_dump_compl() * Fixing bsc#1201356 VUL-1: CVE-2022-2343: vim: Heap-based Buffer Overflow in GitHub repository vim prior to 9.0.0044 * Fixing bsc#1201359 VUL-1: CVE-2022-2344: vim: Another Heap-based Buffer Overflow vim prior to 9.0.0045 * Fixing bsc#1201363 VUL-1: CVE-2022-2345: vim: Use After Free in GitHub repository vim prior to 9.0.0046. * Fixing bsc#1201620 PUBLIC SUSE Linux Enterprise Server 15 SP4 Basesystem zbalogh@suse.com NEW --- SLE-15-SP4-Full-x86_64-GM-Media1 and vim-plugin-tlib-1.27-bp154.2.18.noarch issue * Fixing bsc#1202414 VUL-1: CVE-2022-2819: vim: Heap-based Buffer Overflow in compile_lock_unlock() * Fixing bsc#1202552 VUL-1: CVE-2022-2874: vim: NULL Pointer Dereference in generate_loadvar() * Fixing bsc#1200270 VUL-1: CVE-2022-1968: vim: use after free in utf_ptr2char * Fixing bsc#1200697 VUL-1: CVE-2022-2124: vim: out of bounds read in current_quote() * Fixing bsc#1200698 VUL-1: CVE-2022-2125: vim: out of bounds read in get_lisp_indent() * Fixing bsc#1200700 VUL-1: CVE-2022-2126: vim: out of bounds read in suggest_trie_walk() * Fixing bsc#1200701 VUL-1: CVE-2022-2129: vim: out of bounds write in vim_regsub_both() * Fixing bsc#1200732 VUL-1: CVE-2022-1720: vim: out of bounds read in grab_file_name() * Fixing bsc#1201132 VUL-1: CVE-2022-2264: vim: out of bounds read in inc() * Fixing bsc#1201133 VUL-1: CVE-2022-2284: vim: out of bounds read in utfc_ptr2len() * Fixing bsc#1201134 VUL-1: CVE-2022-2285: vim: negative size passed to memmove() due to integer overflow * Fixing bsc#1201135 VUL-1: CVE-2022-2286: vim: out of bounds read in ins_bytes() * Fixing bsc#1201136 VUL-1: CVE-2022-2287: vim: out of bounds read in suggest_trie_walk() * Fixing bsc#1201150 VUL-1: CVE-2022-2231: vim: null pointer dereference skipwhite() * Fixing bsc#1201151 VUL-1: CVE-2022-2210: vim: out of bounds read in ml_append_int() * Fixing bsc#1201152 VUL-1: CVE-2022-2208: vim: null pointer dereference in diff_check() * Fixing bsc#1201153 VUL-1: CVE-2022-2207: vim: out of bounds read in ins_bs() * Fixing bsc#1201154 VUL-1: CVE-2022-2257: vim: out of bounds read in msg_outtrans_special() * Fixing bsc#1201155 VUL-1: CVE-2022-2206: vim: out of bounds read in msg_outtrans_attr() * Fixing bsc#1201863 VUL-1: CVE-2022-2522: vim: out of bounds read via nested autocommand * Fixing bsc#1202046 VUL-1: CVE-2022-2571: vim: Heap-based Buffer Overflow related to ins_comp_get_next_word_or_line() * Fixing bsc#1202049 VUL-1: CVE-2022-2580: vim: Heap-based Buffer Overflow related to eval_string() * Fixing bsc#1202050 VUL-1: CVE-2022-2581: vim: Out-of-bounds Read related to cstrchr() * Fixing bsc#1202051 VUL-1: CVE-2022-2598: vim: Undefined Behavior for Input to API related to diff_mark_adjust_tp() and ex_diffgetput() * Fixing bsc#1202420 VUL-1: CVE-2022-2817: vim: Use After Free in f_assert_fails() * Fixing bsc#1202421 VUL-1: CVE-2022-2816: vim: Out-of-bounds Read in check_vim9_unlet() * Fixing bsc#1202511 VUL-1: CVE-2022-2862: vim: use-after-free in compile_nested_function() * Fixing bsc#1202512 VUL-1: CVE-2022-2849: vim: Invalid memory access related to mb_ptr2len() * Fixing bsc#1202515 VUL-1: CVE-2022-2845: vim: Buffer Over-read related to display_dollar() * Fixing bsc#1202599 VUL-1: CVE-2022-2889: vim: use-after-free in find_var_also_in_script() in evalvars.c * Fixing bsc#1202687 VUL-1: CVE-2022-2923: vim: NULL Pointer Dereference in GitHub repository vim/vim prior to 9.0.0240 * Fixing bsc#1202689 VUL-1: CVE-2022-2946: vim: use after free in function vim_vsnprintf_typval * Fixing bsc#1202862 VUL-1: CVE-2022-3016: vim: Use After Free in vim prior to 9.0.0285 Mon 12:00- Deleted patches: * restrict-shell-commands.patch * source-check-sandbox.patch * vim-8.0.1568-CVE-2021-3778.patch * vim-8.0.1568-CVE-2021-3796.patch * vim-8.0.1568-CVE-2021-3872.patch * vim-8.0.1568-CVE-2021-3927.patch * vim-8.0.1568-CVE-2021-3928.patch * vim-8.0.1568-CVE-2021-3984.patch * vim-8.0.1568-CVE-2021-4019.patch * vim-8.0.1568-CVE-2021-4193.patch * vim-8.0.1568-CVE-2021-46059.patch * vim-8.0.1568-CVE-2022-0319.patch * vim-8.0.1568-CVE-2022-0351.patch * vim-8.0.1568-CVE-2022-0361.patch * vim-8.0.1568-CVE-2022-0413.patch * vim-8.0.1568-globalvimrc.patch - Added patches: * vim-8.1.0297-dump3.patch * vim-8.2.2411-globalvimrc.patch * disable-unreliable-tests-arch.patch - Updated patches: * disable-unreliable-tests.patch * vim-7.3-filetype_changes.patch * vim-7.3-filetype_ftl.patch * vim-7.3-filetype_spec.patch * vim-7.3-gvimrc_fontset.patch * vim-7.3-help_tags.patch * vim-7.3-mktemp_tutor.patch * vim-7.3-name_vimrc.patch * vim-7.3-sh_is_bash.patch * vim-7.3-use_awk.patch * vim-7.4-disable_lang_no.patch * vim-7.4-filetype_apparmor.patch * vim-7.4-filetype_mine.patch * vim-7.4-highlight_fstab.patch * vim-8.0-ttytype-test.patch * vim-8.0.1568-defaults.patch * vim73-no-static-libpython.patch - Updated to version 8.2 with patch level 5038, fixes the following problems * Fixing bsc#1191770 VUL-0: CVE-2021-3875: vim: heap-based buffer overflow * Fixing bsc#1192167 VUL-0: CVE-2021-3903: vim: heap-based buffer overflow * Fixing bsc#1192902 VUL-0: CVE-2021-3968: vim: vim is vulnerable to Heap-based Buffer Overflow * Fixing bsc#1192903 VUL-0: CVE-2021-3973: vim: vim is vulnerable to Heap-based Buffer Overflow * Fixing bsc#1192904 VUL-0: CVE-2021-3974: vim: vim is vulnerable to Use After Free * Fixing bsc#1193466 VUL-1: CVE-2021-4069: vim: use-after-free in ex_open() in src/ex_docmd.c * Fixing bsc#1193905 VUL-0: CVE-2021-4136: vim: vim is vulnerable to Heap-based Buffer Overflow * Fixing bsc#1194093 VUL-1: CVE-2021-4166: vim: vim is vulnerable to Out-of-bounds Read * Fixing bsc#1194216 VUL-1: CVE-2021-4193: vim: vulnerable to Out-of-bounds Read * Fixing bsc#1194217 VUL-0: CVE-2021-4192: vim: vulnerable to Use After Free * Fixing bsc#1194872 VUL-0: CVE-2022-0261: vim: Heap-based Buffer Overflow in vim prior to 8.2. * Fixing bsc#1194885 VUL-0: CVE-2022-0213: vim: vim is vulnerable to Heap-based Buffer Overflow * Fixing bsc#1195004 VUL-0: CVE-2022-0318: vim: Heap-based Buffer Overflow in vim prior to 8.2. * Fixing bsc#1195203 VUL-0: CVE-2022-0359: vim: heap-based buffer overflow in init_ccline() in ex_getln.c * Fixing bsc#1195354 VUL-0: CVE-2022-0407: vim: Heap-based Buffer Overflow in Conda vim prior to 8.2. * Fixing bsc#1198596 VUL-0: CVE-2022-1381: vim: global heap buffer overflow in skip_range * Fixing bsc#1199331 VUL-0: CVE-2022-1616: vim: Use after free in append_command * Fixing bsc#1199333 VUL-0: CVE-2022-1619: vim: Heap-based Buffer Overflow in function cmdline_erase_chars * Fixing bsc#1199334 VUL-0: CVE-2022-1620: vim: NULL Pointer Dereference in function vim_regexec_string * Fixing bsc#1199747 VUL-0: CVE-2022-1796: vim: Use After in find_pattern_in_path * Fixing bsc#1200010 VUL-0: CVE-2022-1897: vim: Out-of-bounds Write in vim * Fixing bsc#1200011 VUL-0: CVE-2022-1898: vim: Use After Free in vim prior to 8.2 * Fixing bsc#1200012 VUL-0: CVE-2022-1927: vim: Buffer Over-read in vim prior to 8.2 * Fixing bsc#1070955 VUL-1: CVE-2017-17087: vim: Sets the group ownership of a .swp file to the editor's primary group, which allows local users to obtain sensitive information * Fixing bsc#1194388 VUL-1: CVE-2022-0128: vim: vim is vulnerable to Out-of-bounds Read * Fixing bsc#1195332 VUL-1: CVE-2022-0392: vim: Heap-based Buffer Overflow in vim prior to 8.2 * Fixing bsc#1196361 VUL-1: CVE-2022-0696: vim: NULL Pointer Dereference in vim prior to 8.2 * Fixing bsc#1198748 VUL-1: CVE-2022-1420: vim: Out-of-range Pointer Offset * Fixing bsc#1199651 VUL-1: CVE-2022-1735: vim: heap buffer overflow * Fixing bsc#1199655 VUL-1: CVE-2022-1733: vim: Heap-based Buffer Overflow in cindent.c * Fixing bsc#1199693 VUL-1: CVE-2022-1771: vim: stack exhaustion in vim prior to 8.2. * Fixing bsc#1199745 VUL-1: CVE-2022-1785: vim: Out-of-bounds Write * Fixing bsc#1199936 VUL-1: CVE-2022-1851: vim: out of bounds read- Minimal fix for Bug 1195004 - (CVE-2022-0318) VUL-0: CVE-2022-0318: vim: Heap-based Buffer Overflow in vim prior to 8.2. / vim-8.0.1568-CVE-2022-0413.patch - Fixing bsc#1190570 CVE-2021-3796: vim: use-after-free in nv_replace() in normal.c / vim-8.0.1568-CVE-2021-3796.patch - Fixing bsc#1191893 CVE-2021-3872: vim: heap-based buffer overflow in win_redr_status() drawscreen.c / vim-8.0.1568-CVE-2021-3872.patch - Fixing bsc#1192481 CVE-2021-3927: vim: vim is vulnerable to Heap-based Buffer Overflow / vim-8.0.1568-CVE-2021-3927.patch - Fixing bsc#1192478 CVE-2021-3928: vim: vim is vulnerable to Stack-based Buffer Overflow / vim-8.0.1568-CVE-2021-3928.patch - Fixing bsc#1193294 CVE-2021-4019: vim: vim is vulnerable to Heap-based Buffer Overflow / vim-8.0.1568-CVE-2021-4019.patch - Fixing bsc#1193298 CVE-2021-3984: vim: illegal memory access when C-indenting could lead to Heap Buffer Overflow / vim-8.0.1568-CVE-2021-3984.patch - Fixing bsc#1190533 CVE-2021-3778: vim: Heap-based Buffer Overflow in regexp_nfa.c / vim-8.0.1568-CVE-2021-3778.patch - Fixing bsc#1194216 CVE-2021-4193: vim: vulnerable to Out-of-bounds Read / vim-8.0.1568-CVE-2021-4193.patch - Fixing bsc#1194556 CVE-2021-46059: vim: A Pointer Dereference vulnerability exists in Vim 8.2.3883 via the vim_regexec_multi function at regexp.c, which causes a denial of service. / vim-8.0.1568-CVE-2021-46059.patch - Fixing bsc#1195066 CVE-2022-0319: vim: Out-of-bounds Read in vim/vim prior to 8.2. / vim-8.0.1568-CVE-2022-0319.patch - Fixing bsc#1195126 CVE-2022-0351: vim: uncontrolled recursion in eval7() / vim-8.0.1568-CVE-2022-0351.patch - Fixing bsc#1195202 CVE-2022-0361: vim: Heap-based Buffer Overflow in vim prior to 8.2. / vim-8.0.1568-CVE-2022-0361.patch - Fixing bsc#1195356 CVE-2022-0413: vim: use after free in src/ex_cmds.c / vim-8.0.1568-CVE-2022-0413.patch- install suse vimrc in /usr (boo#1182324, vim-8.0.1568-globalvimrc.patch)- source correct suse.vimrc file (boo#1182324)- stop owning /etc/vimrc so the old, distro provided config actually gets removed. Leaving it around leads to a duplicated autocmd for * .spec, leading to spec file template inserted twice. - own some dirs in vim-data-common so installation of vim-small doesn't leave not owned directories (boo#1173256). - Add vi as slave to update-alternatives so that every package has a matching "vi" symlink (bsc#1174564, boo#1176549).- Add restrict-shell-commands.patch to disable using interfaces in restricted mode, fixes bsc#1172225 CVE-2019-20807- introduce vim-small package with reduced requirements for small installations (boo#1166602). - BuildRequire pkg-config(krb5) instead of krb5-mini to be able to build against Tumbleweed repo.- Add source-check-sandbox.patch to fix CVE-2019-12735 boo#1137443- Pre-convert gvim icons, otherwise building vim depends on rsvg-convert -> librsvg -> cargo -> Rust -> LLVM - Cleanup SVG icon, make lines pixel-grid aligned - Correct RPM Group- Use %license instead of %doc [bsc#1082318]- instead of explicitly unsetting mouse, remove it from the defaults in the first place (boo#1079185, vim-8.0.1568-defaults.patch)- Switch to make -j1 clean to see if it fixes random build failures on Leap/SLE 15.- Updated to revision 1568, fixes the following problems * No test using a screen dump yet. * Screen dump test fails on MS-Windows. * Dead code found. * Assert_equalfile() does not close file descriptors. (Coverity) * Dump test fails when using a shadow directory. * Cannot use 24 bit colors in MS-Windows console. * Compiler warnings without termguicolors feature. * Libterm doesn't support requesting fg and bg color. * C syntax test fails when using gvim * C syntax test still fails when using gvim. * Quotestar test is flaky when using the GUI. * Xxd does not skip NUL lines when using ebcdic. * Popupmenu is too far left when completion is long. (Linwei) * No test for the popup menu positioning. * Popup menu positioning fails with longer string. * synpat_T is taking too much memory. * Terminal screen dump does not include cursor position. * With 'termguicolors' Normal color doesn't work correctly. * When using 'termguicolors' SpellBad doesn't show. * Screen dumps not included in distribution. * Using feedkeys() in a terminal window may trigger mappings. (Charles Sheridan) * Undo in the options window makes it empty. * Screen dump test script not included in distribution. * Various small problems in test files. * Various small problems in source files. * On Mac 'maxmemtot' is set to a weird value. * May leak file descriptors when executing job. * Cannot see what digraph is used to insert a character. * Custom plugins loaded with --clean. * Build error for some combination of features. * May not parse the t_RS response correctly, resulting in wrong characters in the input stream. * printf() does not work with only one argument. (Daniel Hahler) * No right-click menu in a terminal. * Build failure without GUI. * Build failure without GUI on MS-Windows. * Crash with rust syntax highligting. (Edd Barrett) * The terminal debugger can't set a breakpoint with the mouse. * Timeout of getwinposx() can be too short. (lilydjwg) * Too many #ifdefs. * Can't build Mac version without GUI. * Too many #ifdefs. * Cannot build Win32 GUI without IME. (John Marriott) * Can't build on older Mac, header file is missing.- Recommend vim-data so that colors can work by default- Updated to revision 1525, fixes the following problems * Compiler complains about uninitialized variable. (Tony Mechelynck) * Missing -D_FILE_OFFSET_BITS=64 may cause problems if a library is compiled with it. * Cannot act on edits in the command line. * Acessing freed memory after window command in auto command. (gy741) * Still too many old style tests. * Segmentation fault when Ruby throws an exception inside :rubyfile command. * Slow redrawing with DirectX. * Endless loop when gui_mch_stop_blink() is called while blink_state is BLINK_OFF. (zdohnal) * It is difficult to set the python home directory properly for Python 2.7 and 3.5 since both use $PYTHONHOME. * Terminal test fails on some systems. (jonathonf) * Terminal test fails on some slow terminals. * When in silent mode too much output is buffered. * If $SHELL contains a space then the default value of 'shell' is incorrect. (Matthew Horan) * Timer test on travis Mac is still flaky. * Clojure now supports a shebang line. * Filetype detection test does not check all scripts. * Cannot handle change of directory. * Missing file in patch. * Missing another file in patch. * Missing yet another file in patch. * Test fails without 'autochdir' option. * Completing directory after :find does not add slash. * Python2 and python3 detection not tested. (Matej Cepl) * Older GTK versions don't have gtk_entry_get_text_length(). * Libvterm doesn't handle illegal byte sequence correctly. * Illegal memory access in del_bytes(). * When package path is a symlink adding it to 'runtimepath' happens at the end. * Integer overflow when using regexp pattern. (geeknik) * On MS-Windows CursorIM highlighting no longer works. * MS-Windows: nsis installer is a bit slow. * MS-Windows: D&D fails between 32 and 64 bit apps. * Visual C 2017 has multiple MSVCVER numbers. * Invalid memory access in read_redo(). (gy741) * Screen isn't always updated right away. * Redraw flicker when moving the mouse outside of terminal window. * Unnecessary condition for "len" being zero. * Insert mode completion state is confusing. * Patch missing change. * Clearing a pointer takes two lines. * Using feedkeys() does not work to test Insert mode completion. (Lifepillar) * Searchpair() might return an invalid value on timeout. * Reduntant conditions. * Weird autocmd may cause arglist to be changed recursively. * Accessing invalid memory with "it". (Dominique Pelle) * Test 14 fails. * Emacs tags no longer work. (zdohnal) * There is no easy way to get the global directory, esp. if some windows have a local directory. * Number of spell regions is spread out through the code. * The minimum width of the popup menu is hard coded. * Memory leak in balloon_split(). * Completion items cannot be annotated. * No autocmd triggered in Insert mode with visible popup menu. * Having 'pumwidth' default to zero has no merit. * Clearing a pointer takes two lines. * Getting the jump list requires parsing the output of :jumps. * Getjumplist() returns duplicate entries. (lacygoill) * Out-of-memory situation not correctly handled. (Coverity) * Possible NULL pointer dereference. (Coverity) * Out-of-memory situation not correctly handled. (Coverity) * In out-of-memory situation character is not restored. (Coverity) * Access memory beyond end of string. (Coverity) * Win32: the screen may be cleared on startup. * Debugger can't break on a condition. (Charles Campbell) * New version of HP NonStop (Tandem) doesn't like the default header for setenv(). * Timer test is a bit flaky. * The :drop command is not always available. * Test for failing drag-n-drop command no longer fails. * Cannot test if a command causes a beep. * Some code for the debugger watch expression is clumsy. * Warning for possibly using NULL pointer. (Coverity) * The jumplist is not always properly cleaned up. * Getting the list of changes is not easy. * BufWinEnter event fired when opening hidden terminal. * Errors for job options are not very specific. * Invalid memory acces with pattern using look-behind match. (Dominique Pelle) * Error messages suppressed after ":silent! try". (Ben Reilly) * Getchangelist() does not use argument as bufname(). * Cursor is in the wrong line when using a WinBar in a Terminal window. * Shift-Tab does not work in a terminal window. * Popup menu is positioned in the wrong place. (Davit Samvelyan, Boris Staletic) * Cannot write and read terminal screendumps. * Compiler warnings for uninitialized variables. (Tony Mechelynck) * Using :wqa exits even if a job runs in a terminal window. (Jason Felice)- Split vim-data into vim-data-common package for low-disk usage scenarios bsc#1078722 bsc#1078554 bsc#1075541 - Make set mouse= default in suse.vimrc bsc#1079185 bsc#1078564 bsc#1067890 bsc#1064068 bsc#1062691- Updated to revision 1442, fixes the following problems * Crash when calling term_start() with empty argument. * Crash when term_start() fails. * MS-Windows: vimtutor fails if %TMP% has special chars. * After ":copen" can't get the window-ID of the quickfix window. (FalacerSelene) * Illegal memory access after undo. (Dominique Pelle) * GTK: :promtfind does not put focus on text input. (Adam Novak) * Memory leak in test_arabic. * Not enough information about what Python version may work. * Pkg-config doesn't work with cross compiling. * Filetype detection test not updated for change. * If cscope fails a search Vim may hang. * Terminal window: some vterm responses are delayed. * Using ":undo 0" leaves undo in wrong state. * Using pointer before it is set.- Make vim require vim-data bsc#1077352 bsc#1075541 bsc#1074790- Sort with spec-cleaner - Add conditional to build with python2 in order to build with py3 only enviroment - Convert dependencies to pkgconfig style- Updated to revision 1428, fixes the following problems * No test for expanding backticks. * Cursor column is not updated after ]s. (Gary Johnson) * Accessing freed memory in vimgrep. * Accessing invalid memory with overlong byte sequence. * No fallback to underline when undercurl is not set. (Ben Jackson) * Error in return not caught by try/catch. * The timer_pause test is flaky on Travis. * execute() does not work in completion of user command. (thinca) * "gf" and don't accept ? and & in URL. (Dmitrii Tcyganok) * The :leftabove modifier doesn't work for :copen. * Compiler warning on 64 bit MS-Windows system.- ignore make check transient errors for PowerPC bypass boo#1072651- Update apparmor.vim (taken from AppArmor 2.12) * add support for the "smc" network keyword- Updated to revision 1417, fixes the following problems * Encoding empty string to JSON sometimes gives "null". * Build fails with --with-features=huge --disable-channel. * Too much highlighting with 'hlsearch' and 'incsearch' set. * Cannot intercept a yank command. * It is not easy to see if a colorscheme is well written. * Memory leak when CTRL-G in search command line fails. * Pattern with \& following nothing gives an error. * :packadd does not load packages from the "start" directory. * Warnings and errors when building tiny version. (Tony Mechelynck) * Color scheme check script shows up as color scheme. * Cannot build with GTK but without XIM. (Guido) * Crash with nasty autocommand. (gy741, Dominique Pelle) * Using freed buffer in grep command. (gy741, Dominique Pelle) * Invalid memory access on exit when autocommands wipe out a buffer. * Duplicated code for getting a typed character. CursorHold is called too often in the GUI. (lilydjwg) * Difficult to track changes to a quickfix list. * GUI: CursorHold may trigger before 'updatetime' when using timers. * Crash in setqflist(). * Buffer overflow in :tags command. * Hang when using count() with an empty string. * Reading invalid memory with CTRL-W :. * Using free memory using setloclist(). (Dominique Pelle) * Accessing freed memory in :cbuffer. * Accessing freed memory in :lfile. * Warning for unused function without timers feature. * Crash when searching for a sentence. * Test doesn't search for a sentence. Still fails when searching for start of sentence. (Dominique Pelle)- Updated to revision 1390, fixes the following problems * Balloon shows when cursor is in WinBar. * terminal test hangs, executing abcde. (Stucki) * Cannot drag status line or vertical separator of new terminal window. (UncleBill) * MS-Windows: drawing underline, curl and strike-throw is slow, mFallbackDC not properly updated. * Channel test for callback is flaky. * Shift-Insert doesn't always work in MS-Windows console. * Profile log may be truncated halfway a character. * No error when settting 'renderoptions' to an invalid value before starting the GUI. * CTRL-A does not work with an empty line. (Alex) * Window size wrong after maximizing with WinBar. (Lifepillar) * Cursor in terminal not always updated. * Cannot call a dict function in autoloaded dict. * Autoload script sources itself when defining function. * Configure check for selinux does not check for header file. * When recovering a file with "vim -r swapfile" the hit-enter prompt is at the top of the window. * ch_readraw() waits for NL if channel mode is NL. * Get "no write since last change" message if a terminal is open. * Local additions in help skips some files. (joshklod) * Not enough quickfix help; confusing winid. * Python 3.5 is getting old. * Cannot select modified buffers with getbufinfo(). * Wordcount test is old style. * Char not overwritten with ambiguous width char, if the ambiguous char is single width but we reserve double-width space. * getqflist() items are missing if not set, that makes it more difficult to handle the values. * DirectX scrolling can be slow, vertical positioning is off.- Updated to revision 1365, fixes the following problems * Libvterm ANSI colors can not always be recognized from the RGB values. The default color is wrong when t_RB is empty. * The Terminal highlighting doesn't work in a terminal. * Some users don't want to diff with hidden buffers. * Terminal window colors wrong when using Terminal highlighting. * Recovering does not work when swap file ends in .stz. * There is no easy way to get the window position. * When one channel test fails others fail as well.- Update to revision 1358 * Too many changes to list - Fixes CVE-2017-1000382 bsc#1065958 - Refresh patches: * disable-unreliable-tests.patch * vim-7.3-filetype_spec.patch * vim-7.4-disable_lang_no.patch * vim-7.4-highlight_fstab.patch * vim-8.0-ttytype-test.patch- Explicitly require python2-devel- Add disable-unreliable-tests.patch to disable unreliable tests bsc#1054723- Bump priorities so we can upgrade from 12.3- Updated to revision 627, fixes the following problems * Call for requesting color and ambiwidth is too early. (Hirohito Higashi) * "1gd" may hang. * Bracketed paste is still enabled when executing a shell command. (Michael Smith) * Can't run make with several jobs, creating directories has a race condition. * The cursor line number becomes negative when using :z^ in an empty buffer. (neovim #6557) * Building the command table requires Perl. * Running parallel make after distclean fails. (Manuel Ortega) * Get only one quickfix list after :caddbuf. * Using freed memory when resetting 'indentexpr' while evaluating it. (Dominique Pelle) * Can't build when configure choses "install-sh". (Daniel Hahler) * Warning for uninitialized variable. (John Marriott) * :simalt on MS-Windows does not work properly. * Duplicate test case for quickfix. * Cannot set the valid flag with setqflist(). * Moving folded text is sometimes not correct. * Illegal memory access with z= command. (Dominique Pelle) * Fold test hangs on MS-Windows. * Memory leak when executing quickfix tests. * Test_options fails when run in the GUI. * No test for mapping timing out. * Configure check for return value of tgetent is skipped. * job_stop() often assumes the channel will be closed, while the job may not actually be stopped. (Martin Gammelsæter) * :simalt still does not work. * Cannot add a context to locations. * Changes to eval functionality not documented. * If a job writes to a buffer and the user is typing a command, the screen isn't updated. When a message is displayed the changed buffer may cause it to be cleared. (Ramel Eshed) * Duplication of code for adding a list or dict return value. * Build failure when windows feature is missing. * Coverity warning for not checking return value of dict_add(). * Crash when complete() is called after complete_add() in 'completefunc'. (Lifepillar) * Off-by-one error in buffer size computation. * Building with gcc 7.1 yields new warnings. * diff mode is insufficiently tested * test_recover fails on some systems. * No test coverage for :spellrepall. * When gF fails to edit the file the cursor still moves to the found line number. * gF test fails on MS-Windows. * gF test fails still on MS-Windows. * The buffer that quickfix caches for performance may become invalid. (Daniel Hahler) * Cannot set the context for a specified quickfix list. * When creating a bufref, then using :bwipe and :new it might get the same memory and bufref_valid() returns true. * Cannot manipulate other than the current quickfix list. * For some people the hint about quitting is not sufficient. * The screen is redrawn when t_BG is set and used to detect the value for 'background'. * When t_u7 is sent a few characters in the second screen line are overwritten and not redrawn later. (Rastislav Barlik) * Package directories are added to 'runtimepath' only after loading non-package plugins. * The conf filetype detection is done before ftdetect scripts from packages that are added later. * float2nr() is not exactly right. * Using % with :hardcopy wrongly escapes spaces. (Alexey Muranov) * When setting the cterm background with ":hi Normal" the value of 'background' may be set wrongly. * Hardcopy test hangs on MS-Windows. * NFA regex engine handles [0-z] incorrectly. * In the GUI, when a timer uses feedkeys(), it still waits for an event. (Raymond Ko) * Since we only support GTK versions that have it, the ckeck for HAVE_GTK_MULTIHEAD is no longer needed. * The ":stag" command does not respect 'switchbuf'. * Using a text object to select quoted text fails when 'selection' is set to "exclusive". (Guraga) * The message "Invalid range" is used for multiple errors. * Warning for unused variable in tiny build. (Tony Mechelynck) * shellescape() always escapes a newline, which does not work with some shells. (Harm te Hennepe) * In the GUI the cursor may flicker. * When 'wrapscan' is off "gn" does not select the whole pattern when it's the last one in the text. (KeyboardFire)- Extend vimrc with mappings for 8-bit controls key escape sequences- Conflict with old vim versions to fix the upgrade from 12.3 boo#1036583- Updated to revision 566, fixes the following problems * :windo allows for ! but it's not supported. * Undefined behavior when using backslash after empty line. * Not enough test coverage for syntax commands. * Crash when getting the window position in tmux. * Cannot detect Bazel BUILD files on some systems. * Using freed memory in :caddbuf after clearing quickfix list. * Setting nocompatible for the tiny version moves the cursor. - Refresh and re-add vim-8.0-ttytype-test.patch- Updated to revision 559, fixes the following problems * Test_edit causes older xfce4-terminal to close. (Dominique Pelle) * Cppcheck warnings. * Edit test may fail on some systems. * Swap file exists briefly when opening the command window. * Extra line break in verbosefile when using ":echomsg". (Ingo Karkat) * Saving the redo buffer only works one time, resulting in the "." command not working well for a function call inside another function call. * No test for the 8g8 command. * Some etags format tags file use 0x01, breaking the parsing. * The typeahead buffer is reallocated too often. * Toupper and tolower don't work properly for Turkish when 'casemap' is empty. (Bjorn Linse) * Toupper/tolower test with Turkish locale fails on Mac. * Toupper and tolower don't work properly for Turkish when 'casemap' contains "keepascii". (Bjorn Linse) * Toupper/tolower test fails on OSX without Darwin. * Getting the window position fails if both the GUI and term code is built in. * GTK: using static gravities is not useful. * The :ownsyntax command is not tested. * Setting ttytype to xxx does not always fail as expected. - Remove vim-8.0-ttytype-test.patch, fixed upstream.- Update the update-alternatives code- Updated to revision 542, fixes the following problems * ml_get errors in silent Ex mode. (Dominique Pelle) * A large count on a normal command causes trouble. (Dominique Pelle) * There is no way to remove quickfix lists (for testing). * Storing a zero byte from a multi-byte character causes fold text to show up wrong. * Character classes are not well tested. They can differ between platforms. * Using a function pointer instead of the actual function, which we know. * GtkForm handling is outdated. * MS-Windows: when 'clipboard' is "unnamed" yyp does not work in a :global command. * dv} deletes part of a multi-byte character. (Urtica Dioica) * Folds are messed up when 'encodin' is "utf-8". * Coverity complains about possible negative value. * RISC OS support was removed long ago, but one file is still included. * When 'wildmenu' is set and 'wildmode' has "longest" then the first file name is highlighted, even though the text shows the longest match. * Line in test commented out. * Buffer overflow when 'columns' is very big. (Nikolai Pavlov) * Test with long directory name fails on non-unix systems. * Test with long directory name fails on Mac. * Abbreviation doesn't work after backspacing newline. (Hkonrk) * Defaults.vim does not work well with tiny features. (crd477) * Memory leak when exiting from within a user function. * Quickfix window not updated when freeing quickfix stack. * Illegal memory access with :z and large count. * No test for falling back to default term value. * Startup test fails on Mac. * Building unit tests fails. * Compiler warning on MS-Windows. * getpos() can return a negative line number. (haya14busa)- Update spec.skeleton with spec-cleaner- Updated to revision 514, fixes the following problems * Insufficient testing for statusline. * 'makeencoding' missing from the options window. * Git and hg see new files after running tests. (Manuel Ortega) * Options test does not always test everything. * Options test fails or hangs on MS-Windows. * 'cinoptions' cannot set indent for extern block. * "make shadow" creates an invalid link. * Quite a few beeps when running tests. * Clang version not correctly detected. * Some functions are not tested. * Running the options test sometimes resizes the terminal. * The packadd test does not create the symlink correctly and does not test the right thing. * The fnamemodify test changes 'shell' in a way later tests may not be able to use system(). * Using ":%argdel" while the argument list is already empty gives an error. (Pavol Juhas) * Not enough test coverage in Insert mode. * Dead code in #ifdef. * Patch shell command uses double quotes around the argument, which allows for $HOME to be expanded. (Etienne) * Terminal width is set to 80 in test3. * Diffpatch fails when the file name has a quote. * Getpgid is not supported on all systems. * The ";" command does not work after characters with a lower byte that is NUL. * Getting font name does not work on X11. * Some macros are in lower case, which can be confusing. * Part of fold patch accidentally included. * v:progpath is not reliably set. * Some macros are in lower case. * Some macros are in lower case. * Adding fold marker creates new comment. * Compiler warnings for comparing unsigned char with 256 always being true. (Manuel Ortega) * The mode test may hang in Test_mode(). (Michael Soyka) * Typo in MinGW test makefile. * Using :move messes up manual folds. * Potential crash if adding list or dict to dict fails. * Old fix for :move messing up folding no longer needed, now that we have a proper solution. * Can't build on HPUX. * Test 45 hangs on MS-Windows. * If an MS-Windows tests succeeds at first and then fails in a way it does not produce a test.out file it looks like the test succeeded. * Resetting 'compatible' in defaults.vim has unexpected side effects. (David Fishburn) * Can't find executable name on Solaris and FreeBSD. * Off-by-one error in using :move with folding. * There are still a few macros that should be all-caps. * Using g< after :for does not show the right output. (Marcin Szamotulski) * After aborting an Ex command g< does not work. (Marcin Szamotulski) * Compiler warnings on MS-Windows. * Not enough testing for help commands. * Exit callback test sometimes fails. * When a test fails and test.log is created, Test_edit_CTRL_I matches it instead of test1.in. * No test covering arg_all(). * The client-server feature is not tested. * Not enough testing for the client-server feature. * Missing change to main.c. * The client-server test may hang when failing. * Tests use assert_true(0) and assert_false(1) to report errors. * remote_peek() is not tested. * The remote_peek() test fails on MS-Windows. * Unnecessary if statement. * The setbufvar() function may mess up the window layout. (Kay Z.) * Illegal memory access when using :all. (Dominique Pelle) * Using :lhelpgrep with an argument that should fail does not produce an error if the previous :helpgrep worked. * Not all windows commands are tested. * Crash and endless loop when closing windows in a SessionLoadPost autocommand. * The autocmd test hangs on MS-Windows. * Running tests leaves an "xxx" file behind. * Clipboard and "* register is not tested. * Splitting a 'winfixwidth' window vertically makes it one column smaller. (Dominique Pelle) * The quotestar test fails when a required feature is missing. * A failing client-server request can make Vim hang. * Crash with cd command with very long argument. * Build failure with older compiler on MS-Windows. * The quotestar test uses a timer instead of a timeout, thus it cannot be rerun like a flaky test. * Insufficient testing for folding. * Arabic support is not fully tested. * Two autocmd tests are skipped on MS-Windows. * taglist() does not prioritize tags for a buffer. * Quotestar test is still a bit flaky. * On MS-Windows ":!start" does not work as expected. * Coverity complains about possible NULL pointer. * Endless loop in updating folds with 32 bit ints. * Looking up an Ex command is a bit slow. * Failed window split for :stag not handled. (Coverity CID 99204) * Can't build with ANSI C. * Client-server tests fail when $DISPLAY is not set. * Coveralls no longer shows per-file coverage. * No link to codecov.io results. * Typo in link to codecov.io results. * Menuage for skipping client-server tests is unclear. * Check for available characters takes too long. * Getting name of cleared highlight group is wrong. (Matt Wozniski) * Script for creating cmdidxs can be improved.- Disable term=xxx test, does not work with any vim version * vim-8.0-ttytype-test.patch- Update apparmor.vim (taken from AppArmor 2.11) * add support for the "kcm" and "qipcrtr" network keywords * update change_profile rule highlighting- Build default vim without X11 support, use update-alternatives to prefer gvim if installed for X11 support.- Updated to revision 425, fixes the following problems * Packadd test does not clean up symlink. * Packadd test uses wrong directory name. * The E11 error message in the command line window is not translated. * The "zero count" error doesn't have a number. (Hirohito Higashi) * Xfontset and guifontwide are not tested. * Illegal memory access after "vapo". (Dominique Pelle) * Restoring help snapshot accesses freed memory. (Dominique Pelle) * GUI test fails on some systems. * Illegal memory access when 'complete' ends in a backslash. * Can't access b:changedtick from a dict reference. * Functions test fails. * Flags of :substitute not sufficiently tested. * Invalid memory access in :recover command. * :recover test fails on MS-Windows. * Illegal memory access with vi' * Not checking return valud of dict_add(). (Coverity) * When using complete() and typing a character undo is saved after the character was inserted. (Shougo) * Double free when compiled with EXITFREE and setting 'ttytype'. * b:changedtick can be unlocked, even though it has no effect. * Unlet command leaks memory. (Nikolai Pavlov) * islocked('d.changedtick') does not work. * Vim relies on limits.h to be included indirectly, but on Solaris 9 it may not be. (Ben Fritz) * When using CTRL-X CTRL-U inside a comment, the use of the comment leader may not work. (Klement) * When building with a shadow directory on macOS lacks the +clipboard feature. * Redrawing errors with GTK 3. * Not enough test coverage for Perl. * No test for concatenating an empty string that results from out of bounds indexing. * The condition for when a typval needs to be cleared is too complicated. * If [RO] in the status line is translated to a longer string, it is trunctted to 4 bytes. * Test to check that setting termcap key fails sometimes. * Using uninitialized memory when 'isfname' is empty. * Leaking memory when setting 'ttytype'. * Crash when setting 'guicursor' to weird value. * Invalid memory access in C-indent code. * 'number' and 'relativenumber' are not properly tested. * Sometimes VimL is used, which is confusing. * GUI initialisation is not sufficiently tested. * Tests fail on MS-Windows. * Travis is too slow to keep up with patches. * ]s does not move cursor with two spell errors in one line. * Might free a dict item that wasn't allocated. * Build fails with tiny features. * If configure defines _LARGE_FILES some include files are included before it is defined. * Not all options are tested with a range of values. * The 'balloondelay', 'ballooneval' and 'balloonexpr' options are not defined without the +balloon_eval feature. Testing that an option value fails does not work for unsupported options. * Invalid memory access when setting wildchar empty. * Leaking memory when setting v:completed_item. * More options are not always defined. * Build fails without +folding. * Invalid memory access when using :sc in Ex mode. (Dominique Pelle) * The "+ register is not tested. * Size computations in spell file reading are not exactly right. * Possible overflow when reading corrupted undo file. CVE-2017-6349 bsc#1027057 * Another possible overflow when reading corrupted undo file. CVE-2017-6350 bsc#1027053 * CTRL-Z and mouse click use CTRL-O unnecessary. * With 'linebreak' set and 'breakat' includes ">" a double-wide character results in "<<" displayed. * Diff mode is not sufficiently tested. * Warning in tiny build for unused variable. (Tony Mechelynck) * Misplaced #ifdef. (Christ van Willigen) * Timer test failed for no apparent reason. * No tests for arabic. * Tiny build has a problem with generating the options test. * compiler warnings * filtering lines through "cat", without changing the line count, changes manual folds. * Test for arabic does not check what is displayed. * When the window scrolls horizontally when the popup menu is displayed part of it may not be cleared. (Neovim issue #6184) * Arabic support is verbose and not well tested. * GUI test fails with Athena and Motif. * When the same tag appears more than once, the order is unpredictable. (Charles Campbell) * Tabs are not aligned when scrolling horizontally and a Tab doesn't fit. (Axel Bender) * Testing the + register fails with Motif. * 'balloonexpr' only works synchronously. * Cannot build with the viminfo feature but without the eval feature. * Illegal memory access with "t". * Crash when using balloon_show() when not supported. (Hirohito Higashi) * Some tests have a one second delay. * Test fails with missing balloon feature. * :map completion does not have . (Dominique Pelle) * GUI tests may fail. * Not enough testing for quickfix. * v:progpath may become invalid after ":cd". * The arabic shaping code is verbose. * Filtering folds with marker method not tested. * Updating folds does not work properly when inserting a file and a few other situations. * set_progpath is defined but not always used * Newer gettext/iconv library has extra dll file. * We can't change the case in menu entries, it breaks translations. * Menu test fails on MS-Windows. * Menu test fails on MS-Windows using gvim. * Balloon eval is not tested. * Balloon test fails on MS-Windows. * Setting v:progpath is not quite right. * Test for the clipboard fails sometimes. * ASAN logs are disabled and don't cause a failure. * Test for v:progpath fails on MS-Windows. * When running :make the output may be in the system encoding, different from 'encoding'. * Diff mode is displayed wrong when adding a line at the end of a buffer. * Python test fails with Python 3.6. * The effect of adding "#" to 'cinoptions' is not always removed. * Compiler warnings on MS-Windows. (Ajit Thakkar) * Build errors when building without folding. - Drop test87-python36.patch, fixed upstream.- Add test87-python36.patch to update test results for Python 3.6- Updated to revision 324, fixes the following problems * When a json message arrives in pieces, the start is dropped and the decoding fails. * Not enough testing for GUI functionality. * getcmdtype(), getcmdpos() and getcmdline() are not tested. * ":help :[range]" does not work. (Tony Mechelynck) * ":help z?" does not work. (Pavol Juhas) * No test for setting 'guifont'. * Small mistake in 7x13 font name. * Insert mode completion does not respect "start" in 'backspace'. * Warning for unused variable with small build. * When using the tiny version trying to load the matchit plugin gives an error. On MS-Windows some default mappings fail. * Possible overflow with spell file where the tree length is corrupted. CVE-2017-5953 bsc#1024724 * When running the command line tests there is a one second wait. * Illegal memory access with "1;y".- Updated to revision 311, fixes the following problems * Double free on exit when using a closure. (James McCoy) * Ex command range with repeated search does not work. (Bruce DeVisser) * When the GUI window is resized Vim does not always take over the new size. (Luchr) * Cannot stop diffing hidden buffers. (Daniel Hahler) * No tests for ":set completion" and various errors of the :set command. * Cannot set terminal key codes with :let. * Bracketed paste does not work in Visual mode. * Assign test fails in the GUI. * Invalid memory access when option has duplicate flag. * mode() not sufficiently tested. * Asan detects a memory error when EXITFREE is defined. (Dominique Pelle) * When using a symbolic link, the package path will not be inserted at the right position in 'runtimepath'. (Dugan Chen, Norio Takagi) * Cannot use an empty key in json. * Not enough testing for GUI functionality. * Linebreak tests are old style.- Updated to revision 296, fixes the following problems * Jumping to a tag that is a static item in the current file fails. (Kazunobu Kuriyama) * The test for :profile is slow and does not work on MS-Windows. * On MS-Windows the system() test skips a few parts. * Some syntax arguments take effect even after "if 0". (Taylor Venable) * Warning for an unused parameter when the libcall feature is disabled. Warning for a function type cast when compiling with -pedantic. * Some syntax arguments are not tested. * When completing a group name for a highlight or syntax command cleared groups are included. * No test for invalid syntax group name. * Order of complication flags is sometimes wrong. * Compiler warns for uninitialized variable. (Tony Mechelynck) * After :undojoin some commands don't work properly, such as :redo. (Matthew Malcomson) * Test coverage for :retab insufficient. * Leaking file descriptor when system() cannot find the buffer. (Coverity) * Internally used commands for CTRL-Z and mouse click end up in history. (Matthew Malcomson) * When using :substitute with the "c" flag and 'cursorbind' is set the cursor is not updated in other windows. * Vim does not support bracketed paste, as implemented by xterm and other terminals. * Build fails if the multi-byte feature is disabled. * The buffer used to store a key name theoreticaly could be too small. (Coverity) * The Netbeans "specialKeys" command does not check if the argument fits in the buffer. (Coverity) * Leaking memory when syntax cluster id is unknown. (Coverity) * When a Cscope line contains CTRL-L a NULL pointer may be used. (Coverity) * When decoding JSON with a JS style object the JSON test may use a NULL pointer. (Coverity) * Build fails without the cscope feature. * No command line completion for :cexpr, :cgetexpr, :caddexpr, etc. * Ubsan reports errors for integer overflow. * Completion for :match does not show "none" and other missing highlight names. * Checking if PROTO is defined inside a function has no effect. * When a multi-byte character ends in a zero byte, putting blockwise text puts it before the character instead of after it. * Coverity gets confused by the flags passed to find_tags() and warnts for an uninitialized variable. * When 'fileformats' is changed in a BufReadPre auto command, it does not take effect in readfile(). (Gary Johnson) * When a block is visually selected and put is used on the end of the selection only one line is changed. * The test for patch 8.0.0224 misses the CR characters and passes even without the fix. (Christian Brabandt) * Crash when 'fileformat' is forced to "dos" and the first line in the file is empty and does not have a CR character. * When pasting test in an xterm on the command line it is surrounded by and . (Johannes Kaltenbach) * When freeing a buffer the local value of the 'formatprg' option is not cleared. * When using bracketed paste line breaks are not respected. * There are no tests for bracketed paste mode. * Pasting in Insert mode does not work when bracketed paste is used and 'esckeys' is off. * The paste test fails if the GUI is being used. * When several lines are visually selected and one of them is short, using put may cause a crash. (Axel Bender) * Memory leak detected when running tests for diff mode. * Gcc complains that a variable may be used uninitialized. Confusion between variable and label name. (John Marriott) * When setting wildoptions=tagfile the completion context is not set correctly. (desjardins) * When using bracketed paste autoindent causes indent to be increased. * The address sanitizer sometimes finds errors, but it needs to be run manually. * The clang build on CI fails with one configuration. * Vim defines a mch_memmove() function but it doesn't work, thus is always unused. * Completion of user defined functions is not covered by tests. * When making a character lower case with tolower() changes the byte cound, it is not made lower case. * When the user sets t_BE empty after startup to disable bracketed paste, this has no direct effect. * The generated zh_CN.cp936.po message file is not encoded properly. * Compiler warnings for int to pointer conversion. * Under some circumstances, one needs to type Ctrl-N or Ctrl-P twice to have a menu entry selected. (Lifepillar) * vim_strcat() cannot handle overlapping arguments. * When two submits happen quick after each other, the tests for the first one may error out. * When virtcol() gets a column that is not the first byte of a multi-byte character the result is unpredictable. (Christian Ludwig) * It is not so easy to write a script that works with both Python 2 and Python 3, even when the Python code works with both. * Characters below 256 that are not one byte are not always recognized as word characters. * When creating a session when winminheight is 2 or larger and loading that session gives an error. * When using an assert function one can either specify a message or get a message about what failed, not both. * When calling setpos() with a buffer argument it often is ignored. (Matthew Malcomson) * Tests fail because some changes were not included. * The keyword test file is not included in the archive. * The keyword test file is not included in the archive. * Tab commands do not handle count correctly. (Ken Hamada) * Build fails with tiny features. * Not enough test coverage for eval functions. * Farsi support is barely tested. * Farsi support is not tested enough. * Memory error reported by ubsan, probably for using the string returned by execute(). * May get ml_get error when :pydo deletes lines or switches to another buffer. (Nikolai Pavlov, issue #1421) * Compiler warning for using uninitialized variable. * A channel test sometimes fails on Mac. * May get ml_get error when :luado deletes lines or switches to another buffer. (Nikolai Pavlov, issue #1421) * May get ml_get error when :perldo deletes lines or switches to another buffer. (Nikolai Pavlov, issue #1421) * May get ml_get error when :rubydo deletes lines or switches to another buffer. (Nikolai Pavlov, issue #1421) * May get ml_get error when :tcldo deletes lines or switches to another buffer. (Nikolai Pavlov, closes #1421) * Crash on exit is not detected when running tests. * Dead code detected by Coverity when not using gnome. * When update_single_line() is called recursively, or another screen update happens while it is busy, errors may occur. * When checking for CTRL-C typed the GUI may detect a screen resize and redraw the screen, causing trouble. * Checking for FEAT_GUI_GNOME inside GTK 3 code is unnecessary. * The GUI test may trigger fontconfig and take a long time. * GUI test fails on MS-Windows. * With MSVC 2015 the dll name is vcruntime140.dll. * On MS-Windows setting an environment variable with multi-byte strings does not work well. * MS-Windows files are still using ARGSUSED while most other files have UNUSED. * When doing a Visual selection and using "I" to go to insert mode, CTRL-O needs to be used twice to go to Normal mode. (Coacher) * The return value of mode() does not indicate that completion is active in Replace and Insert mode. (Zhen-Huan (Kenny) Hu) * The Test_collapse_buffers() test failed once, looks like it is flaky. * Tests fail with tiny build on Unix. * When concealing is active and the screen is resized in the GUI it is not immediately redrawn. * Cannot access the arguments of the current function in debug mode. (Luc Hermitte) * Errors reported while running tests. * No test for "ga" and :ascii. * If a wide character doesn't fit at the end of the screen line, and the line doesn't fit on the screen, then the cursor position may be wrong. (anliting) * Visual block insertion does not insert in all lines. * The stat test is a bit slow. * Some tests have a one or three second wait. * Argument list is not stored correctly in a session file. (lgpasquale) * test_viml hangs. * Bracketed paste can only append, not insert.- Improve summary bsc#1021040- Add missing %changelog to spec.skeleton- Updated to revision 194, fixes the following problems * When compiling with EBCDIC defined the build fails. (Yaroslav Kuzmin) * For completion "locale -a" is executed on MS-Windows, even though it most likely won't work. * Setting language in gvim on MS-Windows does not work when libintl.dll is dynamically linked with msvcrt.dll. * Using :change in between :function and :endfunction fails. * When opening a buffer on a directory and inside a try/catch then the BufEnter event is not triggered. * test_command_count may fail when a previous test interferes, seen on MS-Windows. * 'formatprg' is a global option but the value may depend on the type of buffer. (Sung Pae) * Error E937 is used both for duplicate key in JSON and for trying to delete a buffer that is in use. * When 'cursorbind' and 'cursorcolumn' are both on, the column highlignt in non-current windows is wrong. * When 'cursorbind' and 'cursorline' are set, but 'cursorcolumn' is not, then the cursor line highlighting is not updated. (Hirohito Higashi) * Ubsan warns for using a pointer that is not aligned. * When in Ex mode and an error is caught by try-catch, Vim still exits with a non-zero exit code. * The system() test fails on MS-Windows. * The error message from assert_notequal() is confusing. * Building with a new Ruby version fails. * Using NOT_VALID for redraw_later() to update the cursor line/column highlighting is not efficient. * There are no tests for the :profile command. * Detecting duplicate tags uses a slow linear search. * Some systems do not have ruby_sysinit(), causing the build to fail. * Build fails with tiny features. * Accidentally removed #ifdef. * Profile tests fails if total and self time are equal.- Updated to revision 172, fixes the following problems * When a C preprocessor statement has two line continuations the following line does not have the right indent. (Ken Takata) * ":earlier" and ":later" do not work after startup or reading the undo file. * When the pattern of :filter does not have a separator then completion of the command fails. * To pass buffer content to system() and systemlist() one has to first create a string or list. * Running the channel test creates channellog. * system() test fails on MS-Windows. * system() test fails on OS/X. * When sorting zero elements a NULL pointer is passed to qsort(), which ubsan warns for. * Several float functions are not covered by tests. * No command line completion for ":syntax spell" and ":syntax sync". * On MS-Windows some float functions return a different value when passed unusual values. strtod() doesn't work for "inf" and "nan". * Using a NULL pointer when using feedkeys() to trigger drawing a tabline. * EMSG() is sometimes used for internal errors. * Build fails when using small features. * Build error on Fedora 23 with small features and gnome2. * Ruby 2.4 no longer supports rb_cFixnum. * Outdated and misplaced comments. * Ubsan warns for integer overflow. * JSON with a duplicate key gives an internal error. (Lcd) * str2nr() and str2float() do not always work with negative values. * Still some float functionality is not covered by tests. * For complicated string json_decode() may run out of stack space. * Channel test fails for using freed memory. * JS style JSON does not support single quotes. * The command selected in the command line window is not executed. (Andrey Starodubtsev)- Updated to revision 147, fixes the following problems * Not enough test coverage for syntax commands. * Test fails because of using :finish. * "2;'(" causes ml_get errors in an empty buffer. * Null pointer access reported by UBsan. * An address relative to the current line, ":.,+3y", does not work properly on a closed fold. * When using indent folding and changing indent the wrong fold is opened. * When 'maxfuncdepth' is set above 200 the nesting is limited to 200. * Small build fails. * Warning for unused argument. * Pasting inserted text in Visual mode does not work properly. * Nested function test fails on AppVeyor. * Normal colors are wrong with 'termguicolors'. * Line number of current buffer in getbufinfo() is wrong. * When using MSVC the GvimExt directory is cleaned twice. * Running tests on MS-Windows is a little bit noisy. * When using 'termguicolors' on MS-Windows the RGB definition causes the colors to be wrong. * searchpair() does not work when 'magic' is off.- Updated to revision 130, fixes the following problems * Not enough testing for entering Ex commands. * Display problem with 'foldcolumn' and a wide character. (esiegerman) * Cancelling completion still inserts text when formatting is done for 'textwidth'. (lacygoill) * Display test fails on MS-Windows. * Parallel make still doesn't work. (Lewis Muir) * Configure uses "ushort" while the Vim code doesn't.- Updated to revision 124, fixes the following problems * May not process channel readahead. (skywind) * Value of 'thesaurus' option not checked properly. * When using ch_read() with zero timeout, can't tell the difference between reading an empty line and nothing available. * Cannot use a semicolon in 'backupext'. (Jeff) * When reading channel output in a timer, messages may go missing. (Skywind) * The channel "drop" option is not tested. * Still checking if memcmp() exists while every system should have it now. * Drop command doesn't use existing window. * The :history command is not tested. * Tests 92 and 93 are old style. * When reading English help and using CTRl-] the language from 'helplang' is used. * Parallel make fails. (J. Lewis Muir) * No test for using CTRL-R on the command line. * Setting 'cursorline' changes the curswant column. (Daniel Hahler) * Internal error for assert_inrange(1, 1).- Updated to revision 101, fixes the following problems * When the input or output is not a tty Vim appears to hang. * When a channel callback consumes a lot of time Vim becomes unresponsive. (skywind) * Can't build on MS-Windows. * Popup menu always appears above the cursor when it is in the lower half of the screen. (Matt Gardner) * Options that are a file name may contain non-filename characters. * Some options are not strictly checked. * (after 8.0.0101) cannot set 'dictionary' to a path- Updated to revision 95, fixes the following problems * Problems with GTK 3.22.2 fixed in 3.22.4.- Export "TERM=linux" before running the test suite: vim does quite an extensive test relying on a full fledged terminal inside OBS, stdio is redirected to a serial console (where the build log is being recorded/extracted. Systemd set non-local tty by default to vt220 in upcoming versions (which the vi test suite fails to run on; this should be considered a vim bug).- Updated to revision 92, fixes the following problems * Using NUL instead of NULL. * Crash when using the preview window from an unnamed buffer. (lifepillar) * On Windows job_stop() stops cmd.exe, not the processes it runs. (Linwei) * When a match ends in part of concealed text highlighting, it might mess up concealing by resetting prev_syntax_id. * An exiting job is detected with a large latency. * New code for job_stop() breaks channel test on AppVeyor. * Conceal test passes even without the bug fix. * No test for what 8.0.0047 fixes. * On Windows job_stop() stops cmd.exe, not the processes it runs. (Linwei) * Minor comment and style deficiencies. * When setting 'filetype' there is no check for a valid name. * Tests fail without the 'keymap' features. * Positioning of the popup menu is not good. * Vim does not build on VMS systems. * When using an Ex command for 'keywordprg' it is escaped as with a shell command. (Romain Lafourcade) * Compiler warning for unused variable. * No digraph for HORIZONTAL ELLIPSIS. * Compiler warning for comparing with unsigned. (Zoltan Arpadffy) * Normal test fails on MS-Windows. * Compiler warning for unused function in tiny build. (Tony Mechelynck) * when calling an operator function when 'linebreak' is set, it is internally reset before calling the operator function. * VMS has a problem with infinity. * Checking did_throw after executing autocommands is wrong. (Daniel Hahler) * Compiler warning for self-comparison. * Tests referred in Makefile that no longer exist. * Exit value from a shell command is wrong. (Hexchain Tong) * MS-Windows: Crash with long font name. (Henry Hu) * More comparisons between firstwin and lastwin. * Cannot make Vim fail on an internal error. * Using number for exception type lacks type checking. * Channel log has double parens ()(). * The GUI code is not tested by Travis. * Accessing freed memory in quickfix. * Accessing freed memory in quickfix. (Domenique Pelle) * The OS X build fails on Travis. * Inconsistent function names. * Extension for configure should be ".ac". * Using freed memory with win_getid(). (Domenique Pelle) * Using freed memory when adding to a quickfix list. (Domenique Pelle) * Using freed memory with recursive function call. (Dominique Pelle) * Cannot add a comment after ":hide". (Norio Takagi) * When the channel callback gets job info the job may already have been deleted. (lifepillar) * When a test fails in Setup or Teardown the problem is not reported. * Various problems with GTK 3.22.2. * Cursor moved after last character when using 'breakindent'. * Test_help_complete sometimes fails in MS-Windows console. * C indenting does not support nested namespaces that C++ 17 has. - Drop bsc-1008800.patch, fixed upstream.- Add bsc-1008800.patch to fix gvim rendering with recent gtk+ update. Fixes bsc#1008800. Patch by Jan Alexander Steffens.- Updated to revision 45, fixes the following problems * Cannot use overlapping positions with matchaddpos(). * No completion for ":messages". * Order of matches for 'omnifunc' is messed up. (Danny Su) * Detecting that a job has finished may take a while. * Get E924 when switching tabs. * OPEN_CHR_FILES not defined for FreeBSD using Debian userland files. * When Vim 8 reads an old viminfo and exits, the next time marks are not read from viminfo. (Ned Batchelder) * Whole line highlighting with matchaddpos() does not work. * When using Insert mode completion but not actually inserting anything an undo item is still created. (Tommy Allen) * When using Insert mode completion with 'completeopt' containing "noinsert" change is not saved for undo. (Tommy Allen) * When using Insert mode completion with 'completeopt' containing "noinsert" with CTRL-N the change is not saved for undo. (Tommy Allen) * In diff mode the cursor may end up below the last line, resulting in an ml_get error. * Calling job_stop() right after job_start() does not work.- Updated to revision 32, fixes the following problems * getwinvar() returns wrong Value of boolean and number options, especially non big endian systems. (James McCoy) * A string argument for function() that is not a function name results in an error message with NULL. (Christian Brabandt) * Netbeans test fails with Python 3. (Jonathonf) * ":lb" is interpreted as ":lbottom" while the documentation says it means ":lbuffer". * Vim 7.4 is still mentioned in a few places. * Popup complete test is disabled. * Unnecessary workaround for AppVeyor. * Crash when editing file that starts with crypt yeader. (igor2x) * On OSX Test_pipe_through_sort_all() sometimes fails. * Typos in comments. * Missing comma in list. * Crypt tests are old style. * Can't tell which part of a channel has "buffered" status. * Build fails. * Cannot get the number of the current quickfix or location list. * When using ":sleep" channel input is not handled. * Test_command_count is old style. * The regexp engines are not reentrant. * In the GUI when redrawing the cursor it may be on the second half of a double byte character. * If a channel in NL mode is missing the NL at the end the remaining characters are dropped. * "gd" and "gD" may find a match in a comment or string. * When the netbeans channel closes, "DETACH" is put in the output part. (Ozaki Kiichi) * Inconsistent use of spaces vs tabs in gd test. * Error format with %W, %C and %Z does not work. (Gerd Wachsmuth) * A channel is closed when reading on stderr or stdout fails, but there may still be something to read on another part. * Superfluous semicolons. * Code for MS-Windows is complicated because of the exceptions for old systems. * Mouse mode is not automatically detected for tmux. * After ":bwipeout" 'fileformat' is not set to the right default.- Updated to revision 3, fixes the following problems * getwinvar() returns wrong Value of boolean and number options, especially non big endian systems. (James McCoy)- Updated to revision 2, fixes the following problems * Intro screen still mentions version7. (Paul) * The netrw plugin does not work.- Update to version 8.0 * Crash on exit when EXITFREE is defined. (Dominique Pelle) * Valgrind reports using uninitialzed memory. (Dominique Pelle) * Test 86 and 87 fail with some version of Python. * Netbeans test fails when run from unpacked MS-Windows sources. * Netbeans test fails in shadow directory. * Not enough test coverage for Normal mode commands. * The example that explains nested backreferences does not work properly with the new regexp engine. (Harm te Hennepe) * Regexp fails to match when using "\>\)\?". (Ramel) * Reading past end of line when using previous substitute pattern. (Dominique Pelle) * Attempt to read history entry while not initialized. * Compiler warnings with Solaris Studio when using GTK3. * Memory leak in timer_start(). * Invalid memory access when formatting. (Dominique Pelle) * Checking for last_timer_id to overflow is not reliable. (Ozaki Kiichi) * Illegal memory access with ":1@". (Dominique Pelle) * Superfluous function prototypes. * Sort test sometimes fails. * Needless line break. Confusing directory name. * MS-Windows gvim.exe does not have DirectX support. * Test runner misses a comma.- Updated to revision 2347, fixes the following problems * submatch() does not check for a valid argument. * The 'langnoremap' option leads to double negatives. And it does not work for the last character of a mapping. * Can't use "." and "$" with ":tab". * With SGR mouse reporting (suckless terminal) the mouse release and scroll up/down is confused. * Warning for missing declaration of skip_vimgrep_pat(). (John Marriott) * Tests using the sleep time can be flaky. * Timer test sometimes fails. * Timer test sometimes fails. * Warning for assigning negative value to unsigned. (Danek Duvall) * Adding pattern to ":oldfiles" is not a generic solution. * Filter test fails. * Oldfiles test fails. * Tiny build fails. (Tony Mechelynck) * When cancelling the :ptjump prompt a preview window is opened for a following command. * Missing colon in error message. * Some error message cannot be translated. * In rare cases diffing 4 buffers is not enough. * Compiler warnings for signed/unsigned in expression. * Check for Windows 3.1 will always return false. (Christian Brabandt) * Compiler warnings in MzScheme code. * The script that checks translations can't handle plurals. * Coverity complains about null pointer check. * Coverity complains about not checking for NULL. * Two JSON messages are sent without a separator. * With 'incsearch' can only see the next match. * Channel test is flaky. * Build fails with small features. * Fail to read register content from viminfo if it is 438 characters long. (John Chen) * :filter does not work for many commands. Can only get matching messages. * When adding entries to an empty quickfix list the title is reset. * printf() isn't tested much. * printf() test fails on Windows. "-inf" is not used. * Build fails on MS-Windows. * Using CTRL-N and CTRL-P for incsearch shadows completion keys. * Using 'hlsearch' highlighting instead of matchpos if there is no search match. * Insufficient testing for NUL bytes on a raw channel. * Netbeans test doesn't read settings from file. * getbufinfo(), getwininfo() and gettabinfo() are inefficient. * getwininfo() and getbufinfo() are inefficient. * Command line completion on "find **/filename" drops sub-directory. * ":diffoff!" does not remove filler lines. * Command line test fails on Windows when run twice. * Memory leak in getbufinfo() when there is a sign. (Dominique Pelle) * New users have no idea of the 'scrolloff' option. * Starting diff mode with the cursor in the last line might end up only showing one closed fold. (John Beckett) * printf() doesn't handle infinity float values correctly. * Timer test fails sometimes. * When a child process is very fast waiting 10 msec for it is noticeable. (Ramel Eshed) * Part of ":oldfiles" command isn't cleared. (Lifepillar) * Comment in scope header file is outdated. (KillTheMule) * Generated files are outdated. * The tee program isn't included. Makefile contains build instructions that don't work. * The callback passed to ch_sendraw() is not used. * MS-Windows build instructions are clumsy. "dosbin" doesn't build. * When installing and $DESTDIR is set the icons probably won't be installed. * Compiler warning in tiny build. (Tony Mechelynck) * printf() handles floats wrong when there is a sign. * Not all systems understand %F in printf(). * Modelines in source code are inconsistent. * Sign test fails on MS-Windows when using the distributed zip archives. * Cscope test fails. * No tests for :undolist and "U" command. * When starting a job that reads from a buffer and reaching the end, the job hangs. * It is not possible to close the "in" part of a channel. * QuickFixCmdPre and QuickFixCmdPost autocommands are not always triggered. * Get warning for deleting autocommand group when the autocommand using the group is scheduled for deletion. (Pavol Juhas) * MS-Windows: some files remain after testing. * Default interface versions for MS-Windows are outdated. * When using "is" the mode isn't always updated. * In a timer callback the timer itself can't be found or stopped. (Thinca) * Marks, writefile and nested function tests are old style. * Default value for 'langremap' is wrong. * Several tests are old style. * Old charsearch test still listed in Makefile. * Crash when doing tabnext in a BufUnload autocmd. (Dominique Pelle) * Accessing freed memory when a timer does not repeat. * Appveyor 64 bit build still using Python 3.4 * Crash when autocommand moves to another tab. (Dominique Pelle) * Crash when deleting an augroup and listing an autocommand. (Dominique Pelle) * No error when deleting an augroup while it's the current one. * Insufficient testing for Normal mode commands. * Channel sort test is flaky. * Normal mode tests fail on MS-Windows. * When 'incsearch' is not set CTRL-T and CTRL-G are not inserted as before. * No way for a system wide vimrc to stop loading defaults.vim. (Christian Hesse) * Redraw problem when using 'incsearch'. * When a test is commented out we forget about it. * Access memory beyond the end of the line. (Dominique Pelle) * Using freed memory when using 'formatexpr'. (Dominique Pelle) * Crash when editing a new buffer and BufUnload autocommand wipes out the new buffer. (Norio Takagi) * Tiny build fails. * Illegal memory access when Visual selection starts in invalid position. (Dominique Pelle) * Freeing a variable that is on the stack. * Crash when BufWinLeave autocmd goes to another tab page. (Hirohito Higashi) * Error for min() and max() contains %s. (Nikolay Pavlov) * Coverity complains about not checking curwin to be NULL. * Using CTRL-X CTRL-V to complete a command line from Insert mode does not work after entering an expression on the command line. * Crash when stop_timer() is called in a callback of a callback. Vim hangs when the timer callback uses too much time. * Outdated comments in test. * On MS-Windows test_getcwd leaves Xtopdir behind. * taglist() is slow. (Luc Hermitte) * Running normal mode tests leave a couple of files behind. (Yegappan Lakshmanan) * taglist() is still slow. (Luc Hermitte) * Can't build with small features. (John Marriott) * Tab page test fails when run as fake root. * MS-Windows: Building with Ruby uses old version. * Tiny things. Test doesn't clean up properly. * Typo in MS-Windows build script. * Too many old style tests. * The "Reading from channel output..." message can be unwanted. Appending to a buffer leaves an empty first line behind. * For MinGW RUBY_API_VER_LONG isn't set correctly. Many default version numbers are outdated. * Autocommand test fails when run directly, passes when run as part of test_alot.- Updated to revision 2334, fixes the following problems * No tests for :undolist and "U" command. * When starting a job that reads from a buffer and reaching the end, the job hangs. * It is not possible to close the "in" part of a channel. * QuickFixCmdPre and QuickFixCmdPost autocommands are not always triggered. * Get warning for deleting autocommand group when the autocommand using the group is scheduled for deletion. (Pavol Juhas) * MS-Windows: some files remain after testing. * Default interface versions for MS-Windows are outdated. * When using "is" the mode isn't always updated. * In a timer callback the timer itself can't be found or stopped. (Thinca) * Marks, writefile and nested function tests are old style. * Default value for 'langremap' is wrong. * Several tests are old style. * Old charsearch test still listed in Makefile. * Crash when doing tabnext in a BufUnload autocmd. (Dominique Pelle) * Accessing freed memory when a timer does not repeat. * Appveyor 64 bit build still using Python 3.4 * Crash when autocommand moves to another tab. (Dominique Pelle) * Crash when deleting an augroup and listing an autocommand. (Dominique Pelle) * No error when deleting an augroup while it's the current one. * Insufficient testing for Normal mode commands. * Channel sort test is flaky. * Normal mode tests fail on MS-Windows. * When 'incsearch' is not set CTRL-T and CTRL-G are not inserted as before. * No way for a system wide vimrc to stop loading defaults.vim. (Christian Hesse) * Redraw problem when using 'incsearch'. * When a test is commented out we forget about it. * Access memory beyond the end of the line. (Dominique Pelle) * Using freed memory when using 'formatexpr'. (Dominique Pelle) * Crash when editing a new buffer and BufUnload autocommand wipes out the new buffer. (Norio Takagi) * Tiny build fails. * Illegal memory access when Visual selection starts in invalid position. (Dominique Pelle) * Freeing a variable that is on the stack. * Crash when BufWinLeave autocmd goes to another tab page. (Hirohito Higashi) * Error for min() and max() contains %s. (Nikolay Pavlov) * Coverity complains about not checking curwin to be NULL. * Using CTRL-X CTRL-V to complete a command line from Insert mode does not work after entering an expression on the command line. * Crash when stop_timer() is called in a callback of a callback. Vim hangs when the timer callback uses too much time. * Outdated comments in test. * On MS-Windows test_getcwd leaves Xtopdir behind.- Updated to revision 2295, fixes the following problems * The field names used by getbufinfo(), gettabinfo() and getwininfo() are not consistent. * Tab page tests are old style. * Test files have inconsistant modelines. * Startup test fails on Solaris. * There is no equivalent of 'smartcase' for a tag search. * ":oldfiles" output is a very long list. * The default ttimeoutlen is very long. * Crash when using funcref() with invalid name. (Dominique Pelle) * Can't build with +eval but without +quickfix. (John Marriott) * submatch() does not check for a valid argument. * The 'langnoremap' option leads to double negatives. And it does not work for the last character of a mapping. * Can't use "." and "$" with ":tab". * With SGR mouse reporting (suckless terminal) the mouse release and scroll up/down is confused. * Warning for missing declaration of skip_vimgrep_pat(). (John Marriott) * Tests using the sleep time can be flaky. * Timer test sometimes fails. * Timer test sometimes fails. * Warning for assigning negative value to unsigned. (Danek Duvall) * Adding pattern to ":oldfiles" is not a generic solution. * Filter test fails. * Oldfiles test fails. * Tiny build fails. (Tony Mechelynck) * When cancelling the :ptjump prompt a preview window is opened for a following command. * Missing colon in error message. * Some error message cannot be translated. * In rare cases diffing 4 buffers is not enough. * Compiler warnings for signed/unsigned in expression. * Check for Windows 3.1 will always return false. (Christian Brabandt) * Compiler warnings in MzScheme code. * The script that checks translations can't handle plurals. * Coverity complains about null pointer check. * Coverity complains about not checking for NULL. * Two JSON messages are sent without a separator. * With 'incsearch' can only see the next match. * Channel test is flaky. * Build fails with small features. * Fail to read register content from viminfo if it is 438 characters long. (John Chen) * :filter does not work for many commands. Can only get matching messages. * When adding entries to an empty quickfix list the title is reset. * printf() isn't tested much. * printf() test fails on Windows. "-inf" is not used. * Build fails on MS-Windows. * Using CTRL-N and CTRL-P for incsearch shadows completion keys. * Using 'hlsearch' highlighting instead of matchpos if there is no search match. * Insufficient testing for NUL bytes on a raw channel. * Netbeans test doesn't read settings from file. * getbufinfo(), getwininfo() and gettabinfo() are inefficient. * getwininfo() and getbufinfo() are inefficient. * Command line completion on "find **/filename" drops sub-directory. * ":diffoff!" does not remove filler lines. * Command line test fails on Windows when run twice. * Memory leak in getbufinfo() when there is a sign. (Dominique Pelle) * New users have no idea of the 'scrolloff' option. * Starting diff mode with the cursor in the last line might end up only showing one closed fold. (John Beckett) * printf() doesn't handle infinity float values correctly. * Timer test fails sometimes. * When a child process is very fast waiting 10 msec for it is noticeable. (Ramel Eshed) * Part of ":oldfiles" command isn't cleared. (Lifepillar) * Comment in scope header file is outdated. (KillTheMule) * Generated files are outdated. * The tee program isn't included. Makefile contains build instructions that don't work. * The callback passed to ch_sendraw() is not used. * MS-Windows build instructions are clumsy. "dosbin" doesn't build. * When installing and $DESTDIR is set the icons probably won't be installed. * Compiler warning in tiny build. (Tony Mechelynck) * printf() handles floats wrong when there is a sign. * Not all systems understand %F in printf(). * Modelines in source code are inconsistent. * Sign test fails on MS-Windows when using the distributed zip archives. * Cscope test fails.- Updated to revision 2225, fixes the following problems * When using matchaddpos() a character after the end of the line can be highlighted. * Can't build with +timers when +digraph is not included. * Recursive call to substitute gets stuck in sandbox. * printf() gives an error when the argument for %s is not a string. * printf() does not support binary format. * Sourcing a script where a character has 0x80 as a second byte does not work. * Buffer overflow when using latin1 character with feedkeys(). * Compiler warnings with older compiler and 64 bit numbers. * Crash when placing a sign in a deleted buffer.- Updated to revision 2216, fixes the following problems * The qf_init_ext() function is too big. * Compiler warning for initializing a struct. * There is still code and help for unsupported systems. * There is no way to get a list of the error lists. * When using ":vimgrep" may end up with duplicate buffers. * No proper testing of trunc_string(). * Coverage report is messed up by the unittests. * Can't run scripttests in the top directory. * Wrong part of #ifdef removed. * eval.c is too big. * Build fails. * eval.c is too big. * eval.c is too big. * Non-Unix builds fail. * Wrong file name. * qf_init_ext() is too big. * Using dummy variable to compute struct member offset. * eval.c is still too big. * Coverity warns for possible buffer overflow. * Compiler warns for uninitialzed variable. (John Marriott) * getcompletion() not well tested. * Compiler warning for char/char_u conversion. * Not all arguments of trunc_string() are tested. Memory access error when running the message tests. * spell.c is too big. * Missing change to include file. * The return value of type() is difficult to use. * substitute() does not support a Funcref argument. * rgb.txt is read for every color name. * One more place using a dummy variable. * No autocommand event to initialize a window or tab page. * Syntax error when dict has '>' key. * Cannot update 'tabline' when a tab was closed. * Running checks in po diretory fails. * Netbeans test fails on non-Unix systems. * When using PERROR() on some systems assert_fails() does not see the error. * Line numbers in the error list are not always adjusted. * Not much test coverage for digraphs. * Coverity complains about not restoring a value. * New digraph test makes testing hang. * Digraph tests fails on some systems. * Using the system default encoding makes tests unpredictable. * Digraph code test coverage is still low. * Keymap test fails with normal features. * Color handling of X11 GUIs is too complicated. * Using submatch() in a lambda passed to substitute() is verbose. * Coverity reports a resource leak when out of memory. * GTK 3 build fails with older GTK version. * Netbeans test fails once in a while. Leaving log file behind. * The color allocation in X11 is overly complicated. * Man test fails when run with the GUI. * Lambda functions show up with completion. * Warning from 64 bit compiler. * Text object tests are old style. * When a keymap is active only "(lang)" is displayed. * "cgn" and "dgn" do not work correctly with a single character match and the replacement includes the searched pattern. * Looping over windows, buffers and tab pages is inconsistant. * Tiny build with GUI fails. * Can't have "augroup END" right after ":au!". * Code duplication when unreferencing a function. * Configure reports default features to be "normal" while it is "huge". * Clang warns about missing field in initializer. * Misplaced equal sign. * Netbeans test is flaky. * Setting 'display' to "lastline" is a drastic change, while omitting it results in lots of "@" lines. * When there is an CmdUndefined autocmd then the error for a missing command is E464 instead of E492. (Manuel Ortega) * Defaults are very conservative. * getcompletion(.., 'dir') returns a match with trailing "*" when there are no matches. * Test for undo is flaky. * Tiny build fails. * Loading defaults.vim with -C argument. * The default vimrc for Windows is very conservative. * Deleting an augroup that still has autocmds does not give a warning. The next defined augroup takes its place. * Mac: can't build with tiny features. * Closures are not supported. * User defined functions can't be a closure. * No easy way to check if lambda and closure are supported. * Mac: don't get +clipboard in huge build. * No new style test for diff mode. * diffmode test leaves files behind, breaking another test. * Compiler warning for loss of data. * No tests for :diffget and :diffput * The short form of ":noswapfile" is ":noswap" instead of ":nos". * Memory leak when saving for undo fails. * Memory leak when using timer_start(). (Dominique Pelle) * Pending timers cause false memory leak reports. * More memory leaks when using partial, e.g. for "exit-cb". * test_partial has memory leaks reported. * Can't build with tiny features. * No error for using function() badly. * Various tiny issues. * Closure function fails. * Using function() with a name will find another function when it is redefined. * Test 86 and 87 fail. * :delfunction causes illegal memory access. * Tiny build fails. * Coverity reports bogus NULL check. * Leaking memory when redefining a function. * A funccal is garbage collected while it can still be used. * On MS-Windows quickix does not handle a line with 1023 bytes ending in CR-LF properly. * Win32: Using CreateThread/ExitThread is not safe. * Not enough testing for popup menu. CTRL-E does not always work properly. * test_alot fails. * Not much testing for cscope. * If a test leaves a window open a following test may fail. * Warning with MinGW 64. (John Marriott) * Quickfix test fails on MS-Windows. * No proper translation of messages with a count. * GUI test isn't testing much. * Test_communicate() fails sometimes. * Quotes make GUI test fail on MS-Windows. * Compiler warning. * Test_job_start_fails() is expected to report memory leaks, making it hard to see other leaks in test_partial. * Result of getcompletion('', 'cscope') depends on previous completion. * Insufficient testing for cscope. * setmatches() mixes up values. (Nikolai Pavlov) * Expression test fails without conceal feature. * Result of getcompletion('', 'sign') depends on previous completion. * match() and related functions tested with old style test. * It is not possible to use plugins in an "after" directory to tune the behavior of a package. * Startup test fails on MS-Windows. * Small build can't run startup test. * Small build can't run tests. * Not running the startup test on MS-Windows. * Startup test gets stuck on MS-Windows. * Cannot get information about timers. * MS-Windows build fails. * No test for "vim --help". * Can't test help on MS-Windows. * Adding duplicate flags to 'whichwrap' leaves commas behind. * Insufficient testing of cscope. * #ifdefs in main() are complicated. * No testing for -C and -N command line flags, file arguments, startuptime. * No test for reading from stdin. * Reading from stdin test fails on MS-Windows. * There is no easy way to stop all timers. There is no way to temporary pause a timer. * Compiler warning for unused variable. * Color Grey40 used in startup but not in the short list. * Sign tests are old style. * Tests that use RunVim() do not actually perform the test. * Test glob2regpat does not test much. * Timers test is flaky. * glob2regpat test fails on Windows. * Completion does not work properly with some plugins. * Cannot detect encoding in a fifo. * When startup test fails it's not easy to find out why. GUI test fails with Gnome. * No automatic prototype for vim_main2(). * Generating prototypes with Cygwin doesn't work well. * With Gnome when the GUI can't start test_startup hangs. * Sign tests don't cover enough. * MS-Windows: The vimrun program does not support Unicode. * glob2regpat test doesn't test everything on MS-Windows. * All functions are freed on exit, which may hide leaks. * Test alot sometimes fails under valgrind. (Dominique Pelle) * In the GUI the cursor is hidden when redrawing any window, causing flicker. * Cannot get all information about a quickfix list. * The sign column disappears when the last sign is deleted. * Build fails with small features. * Test fails with normal features. * It is not easy to get information about buffers, windows and tabpages. * 'wildignore' always applies to getcompletion(). * Warning for unused function. * The +xpm feature is not sorted properly in :version output. * Test for mappings is old style. * Cannot map . (Stephen Riehm) * On OSX configure mixes up a Python framework and the Unix layout. * Mouse support is not automatically enabled with simple term. * Mark " is not set when closing a window in another tab. (Guraga) * Cannot highlight the "~" lines at the end of a window differently. * A font that uses ligatures messes up the screen display. * It's not easy to find out if a window is a quickfix or location list window. * Test fails without the +sign feature.- Updated to revision 2045, fixes the following problems * Looking up a buffer by number is slow if there are many. * Netbeans file authentication not tested. * GTK: display updating is not done properly and can be slow. * setbufvar() causes a screen redraw. * filter() and map() either require a string or defining a function. * Memory leak when using a function callback.- Updated to revision 2033, fixes the following problems * Memory access error when reading viminfo. (Dominique Pelle) * "gd" hangs in some situations. (Eric Biggers) * Not all quickfix tests are also done with the location lists. * Background is not drawn properly when 'termguicolors' is set. * Coverity warns for unreachable code. * Win32: Cannot compile with XPM feature using VC2015 * The Man plugin doesn't work that well. * File list does not include new XPM libraries. * Viminfo continuation line with wrong length isn't skipped. (Marius Gedminas) * Using Ctrl-A with double-byte encoding may result in garbled text. * Minor problems with the quickfix code. * Quickfix long lines test not executed for buffer. * Ruby test is old style. * Cscope interface does not support finding assignments. * Not all parts of the quickfix code are tested. * No test for what 7.4.1948 fixes. * Using 32-bit Perl with 64-bit time_t causes memory corruption. (Christian Brabandt) * When using CTRL-W f and pressing "q" at the ATTENTION dialog the newly opened window is not closed. * Perl interface has obsolete workaround. * Perl interface preprocessor statements not nicely indented. * Crash when running test_channel.vim on Windows. * Unicode standard 9 was released. * When 'insertmode' is reset while doing completion the popup menu remains even though Vim is in Normal mode. * Two test files for increment/decrement. * Running Win32 Vim in mintty does not work. * The quickfix init function is too big. * When using a job in raw mode to append to a buffer garbage characters are added. * Coverity reports a resource leak. * Falling back from NFA to old regexp engine does not work properly. (fritzophrenic) * Invalid memory access with "\. * When the netbeans channel is closed consuming the buffer may cause a crash. * Using ":insert" in an empty buffer sets the jump mark. (Ingo Karkat) * It is not easy to see unrecognized error lines below the current error position. * On Solaris select() does not work as expected when there is typeahead. * GUI has a problem with some termcodes. * On MS-Windows large files (> 2Gbyte) cause problems. * Number variables are not 64 bits while they could be. * With 64 bit changes don't need three calls to sprintf(). * Large file test does not delete its output. * Getting value of binary option is wrong. (Kent Sibilev) * 'errorformat' is parsed for every call to ":caddexpr". Can't add to two location lists asynchronously. * No testing for Farsi code. * Viminfo file contains duplicate change marks. * farsi.c and arabic.c are included in a strange way. * Not all quickfix features are tested. * Missing changes in VMS build file. * Compiler warns for loss of data. * When copying unrecognized lines for viminfo, end up with useless continuation lines. * When updating viminfo with file marks there is no time order. * filter() and map() only accept a string argument. * Cscope items are not sorted. * glob() does not add a symbolic link when there are no wildcards. * Values for true and false can be confusing. * Not all TRUE and FALSE arguments are tested. * True-false test fails. * GUI: cursor drawn in wrong place if a timer callback causes a screen update. (David Samvelyan) * Capturing the output of a command takes a few commands. * Cannot easily scroll the quickfix window. * When writing buffer lines to a job there is no NL to NUL conversion. * evalcmd() doesn't work recursively. * Evalcmd test fails. * Tiny build fails. (Tony Mechelynck) * Crash when passing number to filter() or map(). * Still cursor flickering when a callback updates the screen. (David Samvelyan) * GUI: cursor displayed in the wrong position. * After using evalcmd() message output is in the wrong position. (Christian Brabandt) * Crash when using tabnext in BufUnload autocmd. (Norio Takagi) * Running the tests leaves a viminfo file behind. * evalcmd() has a confusing name. * Messages test fails. * There is a :cbottom command but no :lbottom command. * It is not easy to get a list of command arguments. * Test for getcompletion() does not pass on all systems. * Using "noinsert" in 'completeopt' breaks redo. * Using "noinsert" in 'completeopt' does not insert match. * When a file gets a name when writing it 'acd' is not effective. (Dan Church) * Warning from MinGW about _WIN32_WINNT redefined. (John Marriott) * When there are many errors adding them to the quickfix list takes a long time. * buf_valid() can be slow when there are many buffers. * When ignoring case utf_fold() may consume a lot of time. * Can't build without +autocmd feature. * Still too many buf_valid() calls. * Warnings from 64 bit compiler. * buflist_findname_stat() may find a dummy buffer. * More buf_valid() calls can be optimized. * The cursor blinking stops or is irregular when receiving date over a channel and writing it in a buffer, and when updating the status. * Reference counting for callbacks isn't right. * Can't build with +eval but without +menu. * cppcheck warns for using index before limits check. * printf() does not work with 64 bit numbers. * ARCH must be set properly when using MinGW. * The list_lbr_utf8 test fails if ~/.vim/syntax/c.vim sets 'textwidth' to a non-zero value. * Build fails with 64 bit MinGW. (Axel Bender) * 'cscopequickfix' option does not accept new value "a".- Updated to revision 1938, fixes the following problems * Updating marks in a quickfix list is very slow when the list is long. * When waiting for a character is interrupted by receiving channel data and the first character of a mapping was typed, the mapping times out. * When receiving channel data 'updatetime' is not respected. * Wrong computation of remaining wait time in RealWaitForChar() * When umask is set to 0177 Vim can't create temp files. * GUI: When channel data is received the cursor blinking is interrupted. * Channel reading very long lines is slow. * balloon eval only gets the window number, not the ID. * Cannot easily get the window ID for a buffer. * Cannot get the window ID for a mouse click. * Cannot use a window ID where a window number is expected. * Invoking mark_adjust() when adding a new line below the last line is pointless. * Various typos, long lines and style mistakes. * User commands don't support modifiers. * GTK 3: cursor blinking doesn't work well. * Using CTRL-] in the help on "{address}." doesn't work. * Win32: the "Disabled" menu items would appear enabled. * No test for collapsing buffers for a channel. Some text is lost. * When writing viminfo merging current history with history in viminfo may drop recent history entries. * Some compilers can't handle a double semicolon. * Collapsing channel buffers and searching for NL does not work properly. * Warnings from 64 bit compiler. * Netbeans uses uninitialzed pointer and freed memory. * Doubled semicolons. * Tests using external command to delete directory. * Recent history lines may be lost when exiting Vim. * No test for using setqflist() on an older quickfix list. * When ":doautocmd" is used modelines are used even when no autocommands were executed. * Executing autocommands while using the signal stack has a high chance of crashing Vim. * The effect of the PopupMenu autocommand isn't directly visible. * No proper test for what 7.4.1906 fixes. * History lines read from viminfo in different encoding than when writing are not converted. * Not enough testing for parsing viminfo lines. * Register contents is not merged when writing viminfo. * Missing test changes. * vim_time() not included when needed. * Ruby 2.4.0 unifies Fixnum and Bignum into Integer. * Command line editing is not tested much. * Missing "void" for functions without argument. * Viminfo does not merge file marks properly. * Possible crash with many history items. * Compiler warning for signed/unsigned. * Overwriting pointer argument. * Inconsistent indenting and weird name. * Can't build without +spell but with +quickfix. * Using both old and new style file mark lines from viminfo. * When writing viminfo the jumplist is not merged with the one in the viminfo file. * Compiler warning about uninitialzed variable. * New style tests not executed with MinGW compiler. * When using the GUI search/replace a second match right after the replacement is skipped. * Off-by-one error in bounds check. * No test for directory stack in quickfix. * When writing viminfo numbered marks were duplicated. - Refresh vim-7.3-filetype_spec.patch- Link to perl directly instead of dlopen'ing it.- vim must require %{?libperl_requires}, if perl is not updated with vim in lockstep, the following error occurs: vim: error while loading shared libraries: libperl.so and the program stops working. (boo#982869)- Updated to revision 1883, fixes the following problems * Python: encoding error with Python 2. * Memory leaks in test49. * Invalid memory access when exiting with EXITFREE defined. * Memory leak in test_matchstrpos. * Setting really_exiting causes memory leaks to be reported. * Appending to the quickfix list while the quickfix window is open is very slow. * When a callback adds a timer the GUI doesn't use it until later. * Comparing functions and partials doesn't work well. * Typing "k" at the hit-enter prompt has no effect. * Whether a job has exited isn't detected until a character is typed. After calling exit_cb the cursor is in the wrong place. * Channel test is flaky. * Appending to a long quickfix list is slow. * Check for line break at end of line wrong. * Cppcheck found 2 incorrect printf formats.- Updated to revision 1862, fixes the following problems * Using a partial for timer_start() may cause a crash. * Compiler warnings with 64 bit compiler. * string() with repeated argument does not give a result usable by eval().- Updated to revision 1859, fixes the following problems * Tests involving Python are flaky. * Ubsan detects a multiplication overflow. * Getting an item from a NULL dict crashes. * Can't build with Strawberry Perl 5.24 (obsoletes perl-5.24.patch) * Still trying to read from channel that is going to be closed. * GUI freezes when using a job. * test_syn_attr fails when using the GUI. * Unix: Cannot run all tests with the GUI. * Crash when job and channel are in the same dict while using partials. * When setting 'termguicolors' the Ignore highlighting doesn't work. * Valgrind reports memory leak for job that is not freed. * When a channel appends to a buffer that is 'nomodifiable' there is an error but appending is done anyway. * When a channel writes to a buffer it doesn't find a buffer by the short name but re-uses it anyway. * Cannot use a function reference for "exit_cb".- Update apparmor.vim (taken from AppArmor 2.10.1) * add support for the "unspec" network keyword- Updated to revision 1842, fixes the following problems * non-antialiased misnamed. * When timer_stop() is called with a string there is no proper error message. * Memory leak in debug commands. * Cannot use an Ex command for 'keywordprg'. * Possible crash when conceal is active. * When splitting and closing a window the status height changes. * When using a partial on a dictionary it always gets bound to that dictionary. * The BufUnload event is triggered twice, when :bunload is used with `bufhidden` set to `unload` or `delete`. * Functions specifically for testing do not sort together. * Cannot get the items stored in a partial. * When using packages an "after" directory cannot be used. * The code to reallocate the buffer used for quickfix is repeated. * get() works for Partial but not for Funcref.- Fix build with perl 5.24 (perl-5.24.patch)- Updated to revision 1829, fixes the following problems * No error when invoking a callback when it's not safe. * May try to access buffer that's already freed. * No message on channel log when buffer was freed.- Updated to revision 1826, fixes the following problems * The screen is not updated if a callback is invoked when closing a channel. * Help completion adds @en to all matches except the first one. * Compiler warnings when sprintf() is a macro. * Removing language from help tags too often. * Redirecting stdout of a channel to "null" doesn't work. * When a job is no longer referenced and does not have an exit callback the process may hang around in defunc state. * When job writes to buffer nothing is written. * Callbacks are invoked when it's not safe.- Updated to revision 1816, fixes the following problems * 'guicolors' is a confusing option name. * Quickfix doesn't handle long lines well, they are split. * GTK3 doesn't handle menu separaters properly. * Can't use Vim as MANPAGER. * Running tests in shadow dir fails. * 'termguicolors' option missing from the options window. * Test_out_close_cb sometimes fails. * Using wrong feature name to check for 'termguicolors'. * Using wrong short option name for 'termguicolors'. * Sending DETACH after a channel was closed isn't useful. * Netbeans channel gets garbage collected. * Memory access error when running test_quickfix. * A channel may be garbage collected while it's still being used by a job. * Looping over a null list throws an error. - Refresh vim-7.4-filetype_mine.patch- Updated to revision 1796, fixes the following problems * Cannot use ch_read() in the close callback. * Leading white space in a job command matters. * Channel could be garbage collected too early. * Color name decoding is implemented several times. * Some character classes may differ between systems.- Updated to revision 1786, fixes the following problems * When using the term truecolor feature, the t_8f and t_8b termcap options are not set by default. * Using negative index in strcharpart(). * Warnings reported by cppcheck. * synIDattr() does not respect 'guicolors'. * strcharpart() does not work properly with some multi-byte characters. * The old regexp engine doesn't handle character classes correctly. * Compiled-in colors do not match rgb.txt.- Updated to revision 1778, fixes the following problems * When using complete() it may set 'modified' even though nothing was inserted. * When using feedkeys() in a timer the inserted characters are not used right away. * Undo options are not together in the options window. * Arguments of setqflist() are not checked properly. * No "closed", "errors" and "encoding" attribute on Python output. * Cannot use true color in the terminal. * Newly added features can escape the sandbox. * When using the term truecolor feature, the t_8f and t_8b termcap options are not set by default.- Updated to revision 1754, fixes the following problems * When a buffer gets updated while in command line mode, the screen may be messed up. * Crash when 'tagstack' is off. (Dominique Pelle) * When adding to the quickfix list the current position is reset. * "noinsert" in 'completeopt' is sometimes ignored * syntax not set when using ":buf" and 'filetype' set manually- Updated to revision 1749, fixes the following problems * Cannot detect a crash in tests when caused by garbagecollect(). * The help for functions require a space after the "(". * The Perl interface cannot use 'print' operator for writing directly in standard IO. * It is not easy to get a character out of a string. * Python: turns partial into simple funcref. * Folds may close when using autocomplete. * Test fails when not using utf-8. * It is not possible to only see part of the message history. It is not possible to clear messages. * Count for ":messages" depends on number of lines. * syn-cchar defined with matchadd() does not appear if there are no other syntax definitions which matches buffer text. * Not testing utf-8 characters. * strgetchar() does not work correctly. * Clang warns for uninitialzed variable. (Michael Jarvis) * Python: Converting a sequence may leak memory. * Memory leak in Perl. * Coverity: missing check for NULL pointer. * "gD" does not find match in first column of first line. * When using GTK 3.20 there are a few warnings.- Updated to revision 1726, fixes the following problems * Crash when calling garbagecollect() after starting a job. * When using try/catch in 'tabline' it is still considered an error and the tabline will be disabled. * Tabline test fails in GUI. * Compiler errors for non-ANSI compilers. * ANSI compiler complains about string length.- Updated to revision 1721, fixes the following problems * Leaking memory when opening a channel fails. * Coverity: not using return value of set_ref_in_item(). * Leaking memory when there is a cycle involving a job and a partial. * Tests fail without the job feature.- Updated to revision 1716, fixes the following problems * When using try/catch in 'statusline' it is still considered an error and the status line will be disabled. * For plugins in packages, plugin authors need to take care of all dependencies. * GTK GUI doesn't work on Wayland. * Non-GUI specific settings in the gvimrc_example file. * Double free when a partial is in a cycle with a list or dict. * 'autochdir' doesn't work for the first file.- Updated to revision 1710, fixes the following problems * feedkeys('i', 'x') gets stuck, waits for a character to be typed. * Building the Perl interface gives compiler warnings. * ":syn reset" clears the effect ":syn iskeyword". (James McCoy) * When using :stopinsert in a silent mapping the "INSERT" message isn't cleared. * Display problems when the 'ambiwidth' and 'emoji' options are not set properly or the terminal doesn't behave as expected. * :packadd does not work the same when used early or late. * Using freed memory when parsing 'printoptions' fails. * Using freed memory with "wincmd p". (Dominique Pelle) * Cannot use empty dictionary key, even though it can be useful. * New regexp engine does not work properly with EBCDIC. * Not all output of an external command is read.- Updated to revision 1691, fixes the following problems * When reading JSON from a channel all readahead is used. * channel_get_all() does multiple allocations. * When writing buffer lines to a pipe Vim may block. * Completion doesn't work well for a variable containing "#". * When help exists in multiple languages, adding @ab while "ab" is the default help language is unnecessary. * The Dvorak support is a bit difficult to install. * The justify plugin has to be copied or sourced to be used. * The editexisting plugin has to be copied or sourced to be used. * The swapmous plugin has to be copied or sourced to be used. * The shellmenu plugin has to be copied or sourced to be used. * A reference to the removed file_select plugin remains. * Coverity: copying value of v_lock without initializing it. * Coverity warns for not checking name length (false positive). * Coverity warns for fixed size buffer length (false positive). * Coverity: no check for NULL. * README text is slightly outdated. * There is no easy way to get all the information about a match. * When running tests $HOME/.viminfo is written. * The channel close_cb option does not work. * MzScheme does not support partial. * Ruby interface has inconsistent coding style. * Can't compile with the conceal feature but without multi-byte. * When switching to a new buffer and an autocommand applies syntax highlighting an ml_get error may occur.- Updated to revision 1665, fixes the following problems * When 'F' is in 'shortmess' the prompt for the encryption key isn't displayed. * When binding a function to a dict the reference count is wrong. * Invoking garbage collection may cause a double free. * Crash when an autocommand changes a quickfix list. * Handling emoji characters as full width has problems with backwards compatibility. * Terminating file name has side effects. * Using string() on a partial that exists in the dictionary it binds results in an error. * When a dict contains a partial it can't be redefined as a function. * Using Python vim.bindeval() on a partial doesn't work. * Using freed memory after setqflist() and ":caddbuffer". * Compiler has a problem copying a string into di_key[]. * The matchit plugin needs to be copied to be used. * Quickfix test fails. * Old style test for fnamemodify(). * Users who loaded matchit.vim manually have to change their startup. * Crash when using expand('%:S') in a buffer without a name. * remote_expr() hangs. * Crash when using partial with a timer. * On Unix in a terminal: channel messages are not handled right away. * A plugin does not know when VimEnter autocommands were already triggered. * has('patch-7.4.1') doesn't work. * No test for special characters in channel eval command. * No test for an invalid Ex command on a channel. * Crash in :cgetexpr. * Crash when calling job_start() with a NULL string.- Updated to revision 1635, fixes the following problems * Quickfix code using memory after being freed. * Using channel timeout instead of request timeout. * Timers don't work on Unix. * Not checking for failed open(). * Memory leak when out of memory. * When starting the GUI fails a swap file is left behind. * Timer with an ":echo" command messes up display. * Although emoji characters are ambiguous width, best is to treat them as full width. * Catching exception that won't be thrown. * Having type() handle a Funcref that is or isn't a partial differently causes problems for existing scripts. * Comparing a function that exists on two dicts is not backwards compatible. * string() doesn't handle a partial. * Contents file is only for Amiga distro. * Compiler warnings for non-virtual destructor. * The versplit feature makes the code uneccessary complicated. * Can't build with small features. * Still can't build with small features. * Still quickfix test in old style. * Build fails with tiny features. * Malformed channel request causes a hang. * When a JSON message is split it isn't decoded. * Starting job with output to buffer changes options in the current buffer. * When 'fileformats' is set in the vimrc it applies to new buffers but not the initial buffer. * Emoji characters are not considered as a kind of word character. * Channel test doesn't work with Python 2.6. * Channel demo doesn't work with Python 2.6. * All Channels share the message ID, it keeps getting bigger. * Can't get info about a channel. * Trying to close file descriptor that isn't open. * Missing changes to structs. * Channel out_cb and err_cb are not tested. * 64-bit Compiler warning. * Handling emoji characters as full width has problems with backwards compatibility. * Unicode table for double width is outdated. * Compiler doesn't understand switch on all enum values. * List of test targets is outdated. * If the help tags file was removed "make install" fails. * Vertical movement after CTRL-A ends up in the wrong column. * Channel test is a bit flaky.- Updated to revision 1591, fixes the following problems * Crash when using function reference. * Using ":call dict.func()" where the function is a partial does not work. * Get E923 when using function(dict.func, [], dict). * Warning for unitinialized variable. * Partial is not recognized everywhere. * Nesting partials doesn't work. * Compiler warnings with 64 bit compiler. * Old style test for quickfix. * Combining dict and args with partial doesn't always work. * Warning for shadowed variable. * The quickfix title is truncated.- Updated to revision 1579, fixes the following problems * Passing cookie to a callback is clumsy. * Dict options with a dash are more difficult to use. * Missing update to proto file. * ":helptags ALL" crashes. * An empty list in function() causes an error. * Crash when assert_equal() runs into a NULL string. * Crash in assert_fails(). * Using CTRL-] in help on option in parentheses doesn't work. * Using old style tests for quickfix. * There is no way to avoid the message when editing a file. * No test for ":help". * Setting 'compatible' in test influences following tests. * Tests get stuck at the more prompt. * ":undo 0" does not work. * Write error of viminfo file is not handled properly. * Cannot pass "dict.Myfunc" around as a partial. * There is no way to invoke a function later or periodically.- Updated to revision 1558, fixes the following problems * Using "ever" for packages is confusing. * Specifying buffer number for channel not implemented yet. * MS-Windows job_start() closes wrong handle. * Compiler warning for unitinialized variable. * MS-Windows channel leaks file descriptor. * Using feedkeys() with an empty string disregards 'x' option. * Compiler warning for shadowed variable. * The feedkeys test has a one second delay. * Cannot re-use a channel for another job. * Too many feature flags for pipes, jobs and channels. * Selection with the mouse does not work in command line mode. * Too much code in eval.c. * Channel test is a bit flaky. * Missing job_info(). * job_start() with a list is not tested. * Channel log methods are not tested. * On Win32 escaping the command does not work properly. * GTK3: horizontal cursor movement in Visual selection not good. * Sticky type checking is more annoying than useful. * Getting a cterm highlight attribute that is not set results in the string "-1". * Two tests fail. * Cannot load packages early. * Cannot generate help tags in all doc directories. * ":colorscheme" does not use 'packpath'. * ":runtime" does not use 'packpath'. * Completion for :colorscheme does not use 'packpath'. * List of test targets incomplete. * "make install" changes the help tags file, causing it to differ from the repository. * Windows cannot be identified. * It is not easy to find out what windows display a buffer.- Switch back to GTK+2 because GTK+3 interface seems to be slower.- Updated to revision 1525, fixes the following problems * Statusline highlighting is sometimes wrong. * "J" fails if there are not enough lines. * Channel output to file not implemented yet. * Channel test is a bit flaky. * Channel with disconnected in/out/err is not supported. * Channel test: Waiting for a file to appear doesn't work. * Cannot write channel err to a buffer. * On a high resolution screen the toolbar icons are too small.- Updated to revision 1510, fixes the following problems * Crash when starting a job fails. * Keeping both a variable for a job and the channel it refers to is a hassle. * Channel test fails on AppVeyor.- Updated to revision 1506, fixes the following problems * No error message when :packadd does not find anything. * Garbage collection with an open channel is not tested. * Writing last-but-one line of buffer to a channel isn't implemented yet. * Crash when using ch_getjob(). * No test for reading last-but-one line. * When channel log is enabled get too many "looking for messages" log entries. * Job cannot read from a file.- Updated to revision 1498, fixes the following problems * ":loadplugin" is not optimal, some people find it confusing. * Not using key when result from hangul_string_convert() is NULL. * "inline" is not supported by old MSVC. * Compiler warning for unused function. * Visual-block shift breaks multi-byte characters. * No command line completion for ":packadd". * Wrong callback invoked for zero-id messages. * clr_history() does not work properly. * Crash when built with GUI but it's not active. * Cursor drawing problem with GTK 3. * Error for locked item when using json_decode().- Updated to revision 1485, fixes the following problems * When using hangulinput with utf-8 a CSI character is misintepreted. * Function arguments marked as unused while they are not. * Test_reltime is flaky, it depends on timing. * ":loadplugin" doesn't take care of ftdetect files. * No test for ":loadplugin". * Cannot add a pack direcory without loading a plugin. * "timeout" option not supported on ch_eval*(). * A one-time callback is not used for a raw channel. * Channel "err-io" value "out" is not supported. * Job input from buffer is not implemented.- Updated to revision 1474, fixes the following problems * Sort test doesn't test with "1" argument. * Channel test sometimes fails, especially on OS/X. * Coverity reports missing restore. * Missing out-of-memory check. And Coverity warning. * Can't build without the autocommand feature. * Compiler warnings without the float feature.- Updated to revision 1467, fixes the following problems * Error when reading fails uses wrong errno. Keeping channel open after job stops results in test failing. * The "out-io" option for jobs is not implemented yet. * When encoding JSON, turning NaN and Infinity into null without giving an error is not useful. * JSON encoding doesn't handle surrogate pair. * Can't get buffer number of a channel. * Using empty name instead of no name for channel buffer. * Memory corruption when 'encoding' is not utf-8. * Crash when using json_decode(). * Memory leak when using ch_read(). * JSON tests fail if 'encoding' is not utf-8. * Json encoding still fails when encoding is not utf-8. * Vim hangs when a channel has a callback but isn't referenced. * Test 87 fails with Python 3.5. * Opening a channel with select() is not done properly. * When a JSON channel has a callback it may never be cleared. * When the argument of sort() is zero or empty it fails.- Updated to revision 1421, fixes the following problems * When calling ch_close() the close callback is invoked, even though the docs say it isn't. * Using "u_char" intead of "char_u", which doesn't work everywhere. * Tests slowed down because of the "not a terminal" warning. * May free a channel when a callback may need to be invoked.- Disable sniff support, its unmaintained.- Updated to revision 1410, fixes the following problems * The close-cb option is not implemented yet. * Perl eval doesn't work properly on 64-bit big-endian machine. * Having 'autochdir' set during startup and using diff mode doesn't work. * GTK 3 is not supported. * Completion menu flickers. * Leaking memory in cs_print_tags_priv(). * json_encode() does not handle NaN and inf properly. * Leaking memory in cscope interface.- Updated to revision 1397, fixes the following problems * When the Job exit callback is invoked, the job may be freed too soon. * Starting a job hangs in the GUI. * Can't sort inside a sort function.- Drop vim-7.1.314-CVE-2009-0316-debian.patch, Python 2.7 has the appropriate fix.- Updated to revision 1385, fixes the following problems * Job and channel options parsing is scattered. * Channel test ch_sendexpr() times out. * Can't remove a callback with ch_setoptions(). * Channels don't have a queue for stderr. * X11 GUI callbacks don't specify the part of the channel. * Channel read implementation is incomplete. * Calling a Vim function over a channel requires turning the arguments into a string. * ch_setoptions() cannot set all options. * Can't change job settings after it started. * The job exit callback is not implemented. * Can't get the job of a channel. * It is not easy to use a set of plugins and their dependencies.- Updated to revision 1353, fixes the following problems * Compiler warnings in build with -O2. * When there is any error Vim will use a non-zero exit code. * When the test server fails to start Vim hangs. * When the port isn't opened yet when ch_open() is called it may fail instead of waiting for the specified time. * The test script lists all functions before executing them.- Updated to revision 1345, fixes the following problems * Crash when using channel that failed to open. * Crash when closing the channel in a callback. * Channel test fails on non-darwin builds. * Channel NL mode is not supported yet. * It's difficult to add more arguments to ch_sendraw() and ch_sendexpr(). * Can't compile with +job but without +channel.- Updated to revision 1328, fixes the following problems * Cursor changes column with up motion when the matchparen plugin saves and restores the cursor position. (Martin Kunev) * "\%1l^#.*" does not match on a line starting with "#". * Channel with pipes doesn't work in GUI. * Crash when unletting the variable that holds the channel in a callback function. * Can't compile with +job but without +channel.- Updated to revision 1294, fixes the following problems * copy() and deepcopy() fail with special variables. * Encoding {'key':} to JSON doesn't give an error. * assert_false(v:false) reports an error. * When jsonencode() fails it still returns something. * jsonencode() is not producing strict JSON. * Crash when evaluating the pattern of ":catch" causes an error. * The job feature isn't available on MS-Windows. * ch_open() with a timeout doesn't work correctly. * ch_sendexpr() does not use JS encoding. - Remove vim-7.3-diff_check.patch- Updated to revision 1194, fixes the following problems * New lines in the viminfo file are dropped. * Old style tests for the argument list. * Generated function prototypes still have __ARGS(). * Wrong argument to assert_exception() causes a crash. * Illegal memory access when using :copen and :cclose. * When running gvim in the foreground some icons are missing. * Recognizing does not work when the language is Turkish. * Using searchpair() with a skip expression that uses syntax highlighting sometimes doesn't work. * Cannot define keyword characters for a syntax file. * Can't sort on floating point numbers. * Default features are conservative. * Conflict for "chartab". * Using the local value of 'errorformat' causes more problems than it solves. * 'langmap' applies to the first character typed in Select mode. * Langmap test fails with normal build. * Autocommands triggered by quickfix cannot always get the current title value. * No support for JSON. * Build with normal features fails. * Coverity warns for NULL pointer and ignoring return value. * type() does not work for v:true, v:none, etc. * Automatically generated function prototypes use __ARGS. * No error for jsondecode('"'). * ":argadd" without argument is supposed to add the current buffer name to the arglist. * Missing error number in MzScheme. * Expressions "0 + v:true" and "'' . v:true" cause an error. * No tests for "is" and "isnot" with the new variables. * This doesn't give the right result: eval(string(v:true)). * No test for new behavior of v:true et al. * The +channel feature is not in :version output. * empty() doesn't work for the new special variables. * test_writefile and test_viml do not delete the tempfile. * Crash with invalid argument to glob2regpat(). * free_tv() can't handle special variables. * Error messages for security context are hard to translate. * The channel feature isn't working yet. * Can't build with FEAT_EVAL but without FEAT_MBYTE. * Compiler warning for not using return value of fwrite().- Updated to revision 1130, fixes the following problems * Repeating CTRL-A doesn't work. * No tests for :hardcopy and related options. * When making a change while need_wait_return is set there is a two second delay. * With 'rightleft' and concealing the cursor may move to the wrong position. * Vim can create a directory but not delete it. * When using ":next" with an illegal file name no error is reported. * Using {ns} in variable name does not work. (lilydjwg) * delete() does not work well with symbolic links. * delete(x, 'rf') does not delete files starting with a dot. * No longer get "." and ".." in directory list. * argidx() has a wrong value after ":%argdelete". (Yegappan Lakshmanan) * delete(x, 'rf') fails if a directory is empty. (Lcd) * Using ":argadd" when there are no arguments results in the second argument to be the current one. (Yegappan Lakshmanan) * There is no perleval(). * Can only get the directory of the current window. * Python None value can't be converted to a Vim value. * Memory leak in :vimgrep.- Updated to revision 1087, fixes the following problems * Wrong way to check for unletting internal variables. * The Tcl interface can't be loaded dynamically on Unix. * Crash when using an invalid command. * CTRL-A does not work well in right-left mode. * Using "." to repeat CTRL-A in Visual mode increments the wrong numbers. * The CTRL-A and CTRL-X commands do not update the '[ and '] marks. * Crash with an extremely long buffer name. * CTRL-A and CTRL-X work badly with blockwise visual selection- Updated to revision 1066, fixes the following problems * Segfault when unletting "count". * Illegal memory access with weird syntax command. (Dominique Pelle) * Typos in the :options window. * Compiler warning for ignoring return value of fwrite(). * When a spell file has single letter compounding creating suggestions takes an awful long time.- Updated to revision 1046, fixes the following problems * The fix in patch 7.3.192 is not tested. * When a symbolic link points to a file in the root directory, the swapfile is not correct. * Vim overwrites the value of $PYTHONHOME. * The local value of 'errorformat' is not used for ":lexpr" and ":cexpr". * The column is not restored properly when the matchparen plugin is used in Insert mode and the cursor is after the end of the line. * When there is a backslash in an option ":set -=" doesn't work. * An Ex range gets adjusted for folded lines even when the range is not using line numbers. * Using "q!" when there is a modified hidden buffer does not unload the current buffer, resulting in the need to abandon it again. * g-CTRL-G shows the word count, but there is no way to get the word count in a script.- Updated to revision 1004, fixes the following problems * searchpos() always starts searching in the first column, which is not what some people expect. (Brett Stahlman) * Leaking memory when hash_add() fails. Coverity error 99126.- Updated to revision 979, fixes the following problems * When pasting on the command line line breaks result in literal characters. This makes pasting a long file name difficult. * When using :diffsplit the cursor jumps to the first line. * Using ":sort" on a very big file sometimes causes text to be corrupted. (John Beckett) * test_cdo fails when using another language than English. * When changing the crypt key the blocks read from disk are not decrypted.- Updated to revision 972, fixes the following problems * Test 87 doesn't work in a shadow directory. * Configure doesn't work with a space in a path. * test86 and test87 are flaky in Appveyor. * Rare crash in getvcol(). (Timo Mihaljov) * The asin() function can't be used. * Memory leak when there is an error in setting an option.- Updated to revision 963, fixes the following problems * Crash when dragging with the mouse. * Segfault reading unitialized memory. * X11 and GTK have moure mouse buttons than Vim supports. * Memory leak when encountering a syntax error. * vt52 terminal codes are not correct. * There is no way to ignore case only for tag searches. * test_tagcase breaks for small builds. * Writing tests for Vim script is hard. * New style testing is incomplete. * Missing changes in source file. * Test_listchars fails with MingW. (Michael Soyka) * Can't build when the insert_expand feature is disabled. * When using 'colorcolumn' and there is a sign with a fullwidth character the highlighting is wrong. (Andrew Stewart) * v:errors is not initialized. * Sorting number strings does not work as expected. (Luc Hermitte) * 'lispwords' is tested in the old way. * When a test script navigates to another buffer the .res file is created with the wrong name. * When using Lua there may be a crash. (issue #468) * Vim doesn't recognize .pl6 and .pod6 files. * A few more file name extensions not recognized. * Test_tagcase fails when using another language than English. * Vim checks if the directory "$TMPDIR" exists. * When setting 'term' the clipboard ownership is lost. * Test107 fails in some circunstances. * Cannot run the tests with gvim. Cannot run individual new stests. * test_listlbr_utf8 sometimes fails.- Updated to revision 935, fixes the following problems * Test 94 fails on some systems. * test_utf8 has confusing dummy command. * Crash when using longest completion match.- Updated to revision 930, fixes the following problems * When a BufLeave autocommand changes folding in a way it syncs undo, undo can be corrupted. * Python interface can produce error "vim.message' object has no attribute 'isatty'". * Libraries for dynamically loading interfaces can only be defined at compile time. * Compiler complains about type punned pointer. * t_Ce and t_Cs are documented but not supported. (Hirohito Higashi) * Wrong indenting for C++ constructor. * No utf-8 support for the hangul input feature. * New compiler warning: logical-not-parentheses * When removing from 'path' and then adding, a comma may go missing. (Malcolm Rowe) * When running out of memory while copying a dict memory may be freed twice. (ZyX) * Compiler warning for comparing signed and unsigned. * A digit in an option name has problems. * The dll options are not in the options window. * The rubydll option is not in the options window. * Missing proto file update. (Randall W. Morris) * Leaking memory with ":helpt {dir-not-exists}". * Prototypes not always generated. * User may yank or put using the register being recorded in. * Completing the longest match doesn't work properly with multi-byte characters. * Ruby crashes when there is a runtime error. * A clientserver message interrupts handling keys of a mapping. * "gv" after paste selects one character less if 'selection' is "exclusive". * MS-Windows: Most users appear not to like the window border. - Refresh vim-7.3-sh_is_bash.patch- Updated to revision 898, fixes the following problems * Build failure when using dynamic python but not python3. * Indentation of array initializer is wrong. * On MS-Windows the iconv DLL may have a different name. * C indenting is wrong below a "case (foo):" * vimrun.exe is picky about the number of spaces before -s. * Custom command line completion does not work for a command containing digits. * Editing a URL, which netrw should handle, doesn't work. * Freeze and crash when there is a sleep in a remote command. (Karl Yngve Lervåg) * The 'fixendofline' option is set on with ":edit".- Updated to revision 889, fixes the following problems * Crash when changing the 'tags' option from a remote command. (Benjamin Fritz) * 'smarttab' is also effective when 'paste' is enabled. (Alexander Monakov) * May get into an invalid state when using getchar() in an expression mapping. * Vim leaks memory, when 'wildignore' filters out all matches. * Compiler warning for unused variable. (Tony Mechelynck) * Not obvious how to contribute. * ":find" sometimes fails. (Excanoe) * Coverity error for clearing only one byte of struct. * Can't see line numbers in nested function calls. * Test 49 fails. * When leaving the command line window with CTRL-C while a completion menu is displayed the menu isn't removed. * Block-mode replace works characterwise instead of blockwise after column 147. (Issue #422) * When doing an upwards search without wildcards the search fails if the initial directory doesn't exist. * Using uninitialized memory for regexp with back reference. (Dominique Pelle) * The OptionSet autocommands are not triggered from setwinvar(). * Triggering OptionSet from setwinvar() isn't tested.- Updated apparmor.vim (taken from AppArmor 2.10.0) * add support for the "ib" and "mpls" network keywords- Updated to revision 865, fixes the following problems * GTK: font glitches for combining characters * "zt" still doesn't work well with filler lines. (Gary Johnson) * Dragging the current tab with the mouse doesn't work properly. * It's a bit clumsy to execute a command on a list of matches. * Vim doesn't recognize all htmldjango files. * Filetype detection is outdated. * pango_shape_full() is not always available. * Still problems with pango_shape_full() not available. * plines_nofill() used without the diff feature.- Updated to revision 854, fixes the following problems * When '#' is in 'isident' the is# comparator doesn't work. * Compiler warning for possible loss of data. * "vi)d" may leave a character behind. * CTRL-A on hex number in Visual block mode is incorrect. * Moving the cursor in Insert mode starts new undo sequence. * does not show up. * Saving and restoring the console buffer does not work properly. * "zt" in diff mode does not always work properly. (Gary Johnson) * Missing information about runtime files.- Updated to revision 843, fixes the following problems * Xxd doesn't have a license notice. * The ruler shows "Bot" even when there are only filler lines missing. (Gary Johnson) * CTRL-A in Visual mode doesn't work properly with "alpha" in 'nrformat'. * After CTRL-V CTRL-A mode isn't updated. (Hirohito Higashi) * With a sequence of commands using buffers in diff mode E749 is given. (itchyny) * Invalid memory access when using "exe 'sc'". * Gcc sanitizer complains about using a NULL pointer to memmove(). * It is not possible to save and restore character search state. * Illegal memory access with "sy match a fold". * Invalid memory access when doing ":call g:". * Invalid memory access when doing ":fun X(". * Invalid memory access in file_pat_to_reg_pat(). * 'linebreak' breaks c% if the last Visual selection was block. (Chris Morganiser, Issue 389) * Invalid memory access in file_pat_to_reg_pat. * Cursor moves after CTRL-A on alphabetic character. * Invalid memory access for ":syn keyword x a[". * Crash when using "syn keyword x c". (Dominique Pelle) * Crash when clicking in beval balloon. (Travis Lebsock) * Resetting 'encoding' when doing ":set all&" causes problems. (Bjorn Linse) Display is not updated. * When expanding `=expr` on the command line and encountering an error, the command is executed anyway. * $HOME in `=$HOME . '/.vimrc'` is expanded too early. * More side effects of ":set all&" are missing. (Björn Linse) * gettabvar() doesn't work after Vim start. (Szymon Wrozynski) * Comparing utf-8 sequences does not handle different byte sizes correctly. * Can't compile without the crypt feature. (John Marriott) - Refresh vim-7.3-diff_check.patch- Updated to revision 803, fixes the following problems * Repeating a change in Visual mode does not work as expected. (Urtica Dioica) * Accessing memory before an allocated block. * Using freed memory when triggering CmdUndefined autocommands. * Test for ":diffoff" doesn't catch all potential problems. * Using "A" in Visual mode while 'linebreak' is set is not tested. * C indent does not support C11 raw strings. (Mark Lodato)- Updated to revision 797, fixes the following problems * Using freed memory and crash. (Dominique Pellej) * Test fails when the autochdir feature is not available. Test output contains the test script. * The buffer list can be very long. * Can only conceal text by defining syntax items. * Can't specify when not to ring the bell. * The 'fixeol' option is not copied to a new window. * Warning from 64 bit compiler. * Crash when using more lines for the command line than 'maxcombine'.- Updated to revision 788, fixes the following problems * CTRL-A and CTRL-X in Visual mode do not always work well. * :diffoff only works properly once. * Behavior of :diffoff is not tested. * Background color response with transparency is not ignored. * Search does not handle multi-byte character at the start position correctly. * 'langmap' is used in command-line mode when checking for mappings. Issue 376. * When using the CompleteDone autocommand event it's difficult to get to the completed items. * It is not possible to avoid using the first item of completion. * Equivalence class for 'd' does not work correctly. * Coverity warns for uninitialized variable. * Using CTRL-A in a line without a number moves the cursor. May cause a crash when at the start of the line. (Urtica Dioica) * Compiler complains about uninitialized variable and clobbered variables. * line2byte() returns one less when 'bin' and 'noeol' are set. * Still a few problems with CTRL-A and CTRL-X in Visual mode. * copy_chars() and copy_spaces() are inefficient. * Using both "noinsert" and "noselect" in 'completeopt' does not work properly. * On some systems automatically adding the missing EOL causes problems. Setting 'binary' has too many side effects. * It is not possible for a plugin to adjust to a changed setting. * snprintf() isn't available everywhere.- Updated to revision 763, fixes the following problems * Appending in Visual mode with 'linebreak' set does not work properly. Also when 'selection' is "exclusive". (Ingo Karkat) * Using CTRL-A in Visual mode does not work well. (Gary Johnson) * It is not easy to count the number of characters. * Cannot detect the background color of a terminal. * When 'conceallevel' is 1 and quitting the command-line window with CTRL-C the first character ':' is erased. * Spelling mistakes are not displayed after ":syn spell". * The request-background termcode implementation is incomplete. * Comment for may_req_bg_color() is wrong. (Christ van Willegen)- Updated to revision 752, fixes the following problems * When setting the crypt key and using a swap file, text may be encrypted twice or unencrypted text remains in the swap file. * The tab menu shows "Close tab" even when it doesn't work. * The cursor line is not always updated for the "O" command. * ml_get error when using "p" in a Visual selection in the last line. * Wrong argument for sizeof(). * In a string "\U" only takes 4 digits, while after CTRL-V U eight digits can be used. * ":1quit" works like ":.quit". (Bohr Shaw) * When using += with ":set" a trailing comma is not recognized. (Issue 365) * Cannot specify a vertical split when loading a buffer for a quickfix command. * "p" in Visual mode causes an unexpected line split. * No tests for Ruby and Perl. * The entries added by matchaddpos() are returned by getmatches() but can't be set with setmatches(). (Lcd) * ":[count]tag" is not always working. (cs86661) * ":cnext" may jump to the wrong column when setting 'virtualedit=all' * For some options two consecutive commas are OK. (Nikolay Pavlov) * It is not obvious how to enable the address sanitizer. * Unicode 8.0 not supported.- Make Perl support dynamic bsc#804070- Updated to revision 729, fixes the following problems * Illegal memory access when there are illegal bytes. * ":let list += list" can change a locked list. * Autocommands triggered by quickfix cannot get the current title value. * Overflow when adding MAXCOL to a pointer. * When 'list' is set Visual mode does not highlight anything in empty lines. (mgaleski) * 0x202f is not recognized as a non-breaking space character. * For indenting, finding the C++ baseclass can be slow. * ":call setreg('"', [])" reports an internal error. * Occasional crash with 'list' set.- Updated to revision 712, fixes the following problems * Out-of-bounds read, dectected by Coverity. * Not freeing memory when encountering an error. * The filename used for ":profile" must be given literally. * Various problems with locked and fixed lists and dictionaries. * E315 when trying to delete a fold. (Yutao Yuan) * Fold can't be opened after ":move". (Ein Brown) * Compiler warning for using uninitialized variable. (Yasuhiro Matsumoto) * Joining an empty list does uneccessary work. * Compiler warning for start_dir unused when building unittests. * Searching for a character matches an illegal byte and causes invalid memory access. (Dominique Pelle) * Can't build with Ruby 2.2. * Window drawn wrong when 'laststatus' is zero and there is a command-line window. (Yclept Nemo) * Undo files can have their executable bit set. * gettext() is called too often. * ":tabmove" does not work as documented. * It is not possible to make spaces visibible in list mode.- Updated to revision 694, fixes the following problems * When starting several Vim instances in diff mode, the temp files used may not be unique. (Issue 353) * When there are illegal utf-8 characters the old regexp engine may go past the end of a string. * "zr" and "zm" do not take a count. * There is no way to use a different in Replace mode for a terminal. * When "$" is in 'cpo' the popup menu isn't undrawn correctly. (Issue 166) * Memory access errors when changing indent in Ex mode. Also missing redraw when using CTRL-U. (Knil Ino) * Can't build with MzScheme. * Session file is not correct when there are multiple tab pages. * Running tests changes the .viminfo file.- Updated to revision 683, fixes the following problems * When using --remote the directory may end up being wrong. * CTRL-W in Insert mode does not work well for multi-byte characters. * MS-Windows: When Vim is minimized the window height is computed incorrectly. * The search highlighting and match highlighting replaces the cursorline highlighting, this doesn't look good. * Typo in the vimtutor command.- Updated to revision 676, fixes the following problems * When 'ruler' is set the preferred column is reset. (Issue 339) * Using freed memory when g:colors_name is changed in the colors script. (oni-link) * Using "0 CTRL-D" in Insert mode may have CursorHoldI interfere. (Gary Johnson) * When 'M' is in the 'cpo' option then selecting a text object in parenthesis does not work correctly. * When using netbeans a buffer is not found in another tab. * When 'compatible' is reset 'numberwidth' is set to 4, but the effect doesn't show until a change is made. * 'linebreak' does not work properly with multi-byte characters. * There is a chance that Vim may lock up. * 'colorcolumn' isn't drawn in a closed fold while 'cursorcolumn' is. (Carlos Pita) * Can't use a glob pattern as a regexp pattern. * When netbeans is active the sign column always shows up. * Using 'cindent' for Javascript is less than perfect. * Warning for shadowing a variable. * When completing a shell command, directories in the current directory are not listed. * The first syntax entry gets sequence number zero, which doesn't work. (Clinton McKay) * Missing changes in one file. * When a FileReadPost autocommand moves the cursor inside a line it gets moved back. - Refresh vim73-no-static-libpython.patch- Updated to revision 658, fixes the following problems * The tabline menu was using ":999tabnew" which is now invalid. * When using "gf" escaped spaces are not handled. * Stratus VOS doesn't have sync(). * When splitting the window in a BufAdd autocommand while still in the first, empty buffer the window count is wrong. * ":bufdo" may start at a deleted buffer. * Compiler complains about ignoring return value of fwrite(). (Michael Jarvis) * Configure check may fail because the dl library is not used. * Can't match "%>80v" properly for multi-byte characters. * Xxd lacks a few features. * Insert mode completion with complete() may have CTRL-L work like CTRL-P. * glob() and globpath() cannot include links to non-existing files. (Charles Campbell) * Text deleted by "dit" depends on indent of closing tag. (Jan Parthey) * Missing changes for glob() in one file. * Compiler warnings for pointer mismatch. * 'formatexpr' is evaluated too often.- Updated to revision 640, fixes the following problems * When using Insert mode completion combined with autocommands the redo command may not work. * The default conceal character is documented to be a space but it's initially a dash. (Christian Brabandt) * 7.4.592 breaks the netrw plugin, because the autocommands are skipped. * Marks are not restored after redo + undo. * If no NL or CR is found in the first block of a file then the 'fileformat' may be set to "mac". (Issue 77) * A search with end offset gets stuck at end of file. (Gary Johnson) * Incorrectly read the number of buffer for which an autocommand should be registered. * Can't build with Lua 5.3 on Windows. * Combination of linebreak and conceal doesn't work well. * After deleting characters in Insert mode such that lines are joined undo does not work properly. (issue 324)- Updated to revision 629, fixes the following problems * For complicated list and dict use the garbage collector can run out of stack space. * Syntax error. * The NFA engine does not implement the 'redrawtime' time limit. * Vim hangs when freeing a lot of objects. * Wrong ":argdo" range does not cause an error. * luaV_setref() is missing a return statement. (Ozaki Kiichi) * luaV_setref() not returning the correct value. * Compiler warning for unitinialized variable. (Tony Mechelynck) * Returning 1 in the wrong function. (Raymond Ko) * Compiler warning for unused argument. * Crash with pattern: \(\)\{80000} (Dominique Pelle) * May leak memory or crash when vim_realloc() returns NULL. * Possible NULL pointer dereference. * The last screen cell is not updated. * Compiler warning for variable might be clobbered by longjmp. * Coverity warning for Out-of-bounds read. - Remove vim-speedup-gc.patch, fixed upstream- Updated to revision 608, fixes the following problems * Compiler warnings for unitinialized variables. (John Little) * Can't match "%>80v" properly. (Axel Bender) * Range for :bdelete does not work. (Ronald Schild) * Parallel building of the documentation html files is not reliable. * Conceal does not work properly with 'linebreak'. (cs86661) * ":0argedit foo" puts the new argument in the second place instead of the first. * Using ctrl_x_mode as if it contains flags. * test_listlbr_utf8 fails when the conceal feature is not available. * When doing ":e foobar" when already editing "foobar" and 'buftype' is "nofile" the buffer is cleared. (Xavier de Gaye) * Crash when searching for "x\{0,90000}". (Dominique Pelle) * Using a block delete while 'breakindent' is set does not work properly. * The test_command_count test fails when using Japanese. * Tiny build doesn't compile. (Ike Devolder) * Cannot change the result of systemlist(). * Out-of-memory error. * Memory wasted in struct because of aligning. * It is not possible to have feedkeys() insert characters. * ":set" does not accept hex numbers as documented. * 'foldcolumn' may be set such that it fills the whole window, not leaving space for text. * Running tests changes viminfo. * The # register is not writable, it cannot be restored after jumping around. * May crash when using a small window. * Compiler warnings for unused variables.- Add vim-speedup-gc.patch to improve garbage collection performance. Based on https://github.com/neovim/neovim/pull/1761 (boo#899747)- Modify vim-7.3-filetype_changes.patch to expand tabs when editing * .changes files (bnc#900839)- Update suse.vimrc to stop remembering file positions for git commit cases. This fixes bnc#538369 and based on msys commits 1ef258e and 65ffc90.- Updated to revision 580, fixes the following problems * Ex range handling is wrong for buffer-local user commands. * Segfault with wide screen and error in 'rulerformat'. (Ingo Karkat) * No test for replacing on a tab in Virtual replace mode. * FEAT_OSFILETYPE is used even though it's never defined. * Ranges for arguments, buffers, tabs, etc. are not checked to be valid but limited to the maximum. This can cause the wrong thing to happen. * :argdo, :bufdo, :windo and :tabdo don't take a range. * Non-ascii vertical separater characters are always redrawn. * Giving an error for ":0wincmd w" is a problem for some plugins. * Having CTRL-C interrupt or not does not check the mode of the mapping. (Ingo Karkat) * Building with dynamic library does not work for Ruby 2.2.0 * Can't build with tiny features. (Ike Devolder) * Address type of :wincmd depends on the argument. * Mapping CTRL-C in Visual mode doesn't work. (Ingo Karkat) * No error for eval('$'). * Unicode character properties are outdated. * Redrawing problem with 'relativenumber' and 'linebreak'. * Matching with a virtual column has a lot of overhead on very long lines. (Issue 310) * Using getcurpos() after "$" in an empty line returns a negative number. * Wrong cursor positioning when 'linebreak' is set and lines wrap. * ":52wincmd v" still gives an invalid range error. (Charles Campbell)- Updated to revision 560, fixes the following problems * Tests fail with small features plus Python. * Crash when computing buffer count. Problem with range for user commands. Line range wrong in Visual area. * Cannot build with tiny and small features. (Taro Muraoka) * Crash when doing a range assign. * Using a range for window and buffer commands has a few problems. Cannot specify the type of range for a user command. * Since patch 7.4.232 "1,3s/\n//" joins two lines instead of three. (Eliseo Martínez) Issue 287 * Warnings for unused arguments when compiling with a combination of features. * Highlighting for multi-line matches is not correct. * Repeated use of vim_snprintf() with a number. * Using "vit" does not select a multi-byte character at the end correctly. * Function name not recognized correctly when inside a function. * curs_rows() function is always called with the second argument false. * "ygn" may yank too much. (Fritzophrenic) Issue 295. * Langmap applies to Insert mode expression mappings. * Various small issues. * Missing part of patch 7.4.519. * test_close_count may fail for some combination of features. * Failed commands in Python interface not handled correctly. * One more small issue. * When the X server restarts Vim may get stuck. * Appending a block in the middle of a tab does not work correctly when virtualedit is set. * Memory leak using :wviminfo. Issue 296.- use SUSE LINUX GmbH everywhere- Updated to revision 537, fixes the following problems * With a wrapping line the cursor may not end up in the right place. (Nazri Ramliy) * Using status line height in width computations. * Crash when using syntax highlighting. * Sun PCK locale is not recognzed. * When using "vep" a mark is moved to the next line. (Maxi Padulo, Issue 283) * Specifying wrong buffer size for GetLongPathName(). * When the X11 server is stopped and restarted, while Vim is kept in the background, copy/paste no longer works. (Issue 203) * When using ":ownsyntax" spell checking is messed up. (Issue 78) * map() leaks memory when there is an error in the expression. * matchstr() fails on long text. Daniel Hahler) * Still confusing regexp failure and NFA_TOO_EXPENSIVE. * Crash when using matchadd() (Yasuhiro Matsumoto) * No test for what 7.4.517 fixes. * Many commands take a count or range that is not using line numbers. * Comments about parsing an Ex command are wrong. * When using 'incsearch' "2/pattern/e" highlights the first match. * ":hardcopy" leaks memory in case of errors. * Warnings when compiling if_ruby.c. * Can't build with tiny features. * Test 63 fails when using a black&white terminal. * Value of v:hlsearch reflects an internal variable.- Updated to revision 516, fixes the following problems * When generating ja.sjis.po the header is not correctly adjusted. * Users are not aware their encryption is weak. * "-fwrapv" argument breaks use of cproto. * Generating proto for if_ruby.c uses type not defined elsewhere. * Crash because reference count is wrong for list returned by getreg(). * Memory access error. (Dominique Pelle) * In a help buffer the global 'foldmethod' is used. (Paul Marshall) * Completing a function name containing a # does not work. Issue 253.- Updated to revision 507, fixes the following problems * Setting the local value of 'backupcopy' empty gives an error. (Peter Mattern) * Compiler warning. * Crash when expanding a very long string. * CTRL-W } does not open preview window. (Erik Falor) * 'linebreak' does not work well together with Visual mode. * Issue 26: CTRL-C does not interrupt after it was mapped and then unmapped. * The "precedes" entry in 'listchar' will be drawn when 'showbreak is set and list is not. * Cursor movement is incorrect when there is a number column/sign/fold column and 'sbr' is displayed. * Can't compile on a system where Xutf8SetWMProperties() is not in the X11 library. Issue 265. * When using ":%diffput" and the other file is empty an extra empty line remains. * Using byte length instead of character length for 'showbreak'. * When 'balloonexpr' results in a list, the text has a trailing newline. (Lcd) * A 0x80 byte is not handled correctly in abbreviations. * Abbreviations don't work. (Toothpik) * Check for writing to a yank register is wrong. * ":sign jump" may use another window even though the file is already edited in the current window. * test_mapping fails for some people. * Cursor movement still wrong when 'lbr' is set and there is a number column. (Hirohito Higashi) * Cannot specify the buffer to use for "do" and "dp", making them useless for three-way diff. * When winrestview() has a negative "topline" value there are display errors. * In Insert mode, after inserting a newline that inserts a comment leader, CTRL-O moves to the right. (ZyX) Issue 57. * A TextChanged autocommand is triggered when saving a file. (William Gardner) * Cursor shape is wrong after a CompleteDone autocommand. * XPM isn't used correctly in the Cygwin Makefile. * With some regexp patterns the NFA engine uses many states and becomes very slow. To the user it looks like Vim freezes. * substitute() can be slow with long strings. * Test 72 still fails once in a while. * Typo in file pattern. * Language mapping also applies to mapped characters. * Cannot append a list of lines to a file.- Updated apparmor.vim (taken from AppArmor 2.9.0) * add support for 'hat' keyword * fix highlighting of comments in alias and link rules/bin/sh/bin/shgvim-basegvim-enhancedxxdh02-armsrv2 1700726918  9.0.2103-150000.5.57.19.0.2103-150000.5.57.19.0.2103-150000.5.57.19.0.2103-150000.5.57.19.0.2103-150000.5.57.19.0.2103-150000.5.57.19.0.2103-150000.5.57.19.0.2103-150000.5.57.1 vivimgvimrcegviewegvimeviewevimgexgvigviewgvimgvimdiffrgviewrgvimvivimgvim.desktopgvimREADME.Japanese-XIMgui_x11.txtgvimrc_example.vimsuse.gvimrcgvim.pnggvim.pnggvim.pnggvim.pnggvim.pnggvim.pnggvim.pnggvim.pnggvim.svg/etc/alternatives//etc//usr/bin//usr/share/applications//usr/share/doc/packages//usr/share/doc/packages/gvim//usr/share/icons/hicolor/128x128/apps//usr/share/icons/hicolor/24x24/apps//usr/share/icons/hicolor/256x256/apps//usr/share/icons/hicolor/32x32/apps//usr/share/icons/hicolor/48x48/apps//usr/share/icons/hicolor/512x512/apps//usr/share/icons/hicolor/64x64/apps//usr/share/icons/hicolor/96x96/apps//usr/share/icons/hicolor/scalable/apps/-fmessage-length=0 -grecord-gcc-switches -O2 -Wall -D_FORTIFY_SOURCE=2 -fstack-protector-strong -funwind-tables -fasynchronous-unwind-tables -fstack-clash-protection -gobs://build.suse.de/SUSE:Maintenance:31593/SUSE_SLE-15_Update/9a77e4e7e7833a7a0267af43541d7d8b-vim.SUSE_SLE-15_Updatedrpmxz5aarch64-suse-linux cannot open `/home/abuild/rpmbuild/BUILDROOT/vim-9.0.2103-150000.5.57.1.aarch64/etc/alternatives/vi' (No such file or directory)cannot open `/home/abuild/rpmbuild/BUILDROOT/vim-9.0.2103-150000.5.57.1.aarch64/etc/alternatives/vim' (No such file or directory)ASCII textELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, BuildID[sha1]=a55b7e9c30858c540290f10197db6b58b90cb05d, for GNU/Linux 3.7.0, strippeddirectoryPNG image data, 128 x 128, 8-bit/color RGBA, non-interlacedPNG image data, 24 x 24, 8-bit/color RGBA, non-interlacedPNG image data, 256 x 256, 8-bit/color RGBA, non-interlacedPNG image data, 32 x 32, 8-bit/color RGBA, non-interlacedPNG image data, 48 x 48, 8-bit/color RGBA, non-interlacedPNG image data, 512 x 512, 8-bit/color RGBA, non-interlacedPNG image data, 64 x 64, 8-bit/color RGBA, non-interlacedPNG image data, 96 x 96, 8-bit/color RGBA, non-interlacedSVG Scalable Vector Graphics image!!RRR R"R R$RR RRRRRRRRRRRRR RRR#R!R R RRRRRRPPP P PP PPPPPPPPPP P i][lAtC{utf-855f120a0c10090c1e5eff08e9b52818d460cc9d68bc331c84ffeca95b9b1590f?7zXZ !t/']"k%{J #$yuC̵覄=vg,dAJW E grb#ȡl#]R[/'4LD?pt <$bͶ>)}gSb.KPx,n,̟G{0{ke$G*i5\HJd<#%J9\kc?-yQq873̎H6Z|T4P%߾6ݻX0'RUO%1/sctȮod/"N25J;c(K 2SFQI20:`o;g@HO m}XT}AJY#4I` ny:Cɨv$:3GQdsuZaMQ1lCL/qub'=V[)|`z#~v޷Z%l]#7HŒ$@bj{ QԒ,B̽|N7qHV_C€3xoRWWx%Ϫ5+@"՝A{.r:AMC7.p]St vQE"df َNP2 8,'.15F[&7_cQdoIG9R}k;;,t_"JT$hUb{% t&g*ڼ) խ!aJsSĀM rk)\]ps},)KV}0x{1+߾ʇFYž nXjIn>tk֋:ގn̺^g+7L aՐH2)M5^do#OT^dW t'uG[x>l_Mi·[Ʋ<$ 7=`s5ԵWoKKe7~lh WMoxx0)/X~PdvV"VgmJ&paykC9la.&GhOrzv܄- 㡿+†oYQ}ZQ|ǹ-朂rlv53njR9$h>ćNk b9 :LV/eS.ż<7*z> šGkԳNP;n_j&R;:p'hfO}h %K>Z@TLj),vZ`sVɪVK/G V*g}E|#۷~;)Mu0B)㇭Bu=ͳMp}qTgY.!S+oTW"UH`%\ 3*謀 y5v)l aZo٫Y|b4&Qj8QrTfeJ؇O+KL\H^Fs8>n_F X1dw%&'Oz[t7G1Fc\H޺NcswHd`:[:i3~yLrrDE;p.r,XUסPHwxZ _FQ$U۰H*m H09C%!x"Ys/k/d.Ǔ4QCe,䉷AH|+lv!3"KB3dd~ fّ<'$$z)$^dr3=FXPʞ!m_ln?ljqq[N>5"!<# 8do'2QZV;hRbFLqu{D%)f!U6}.slJڜ''1}hYb,(7SC @MMu Ǯj@&zn,5T >ʆE^*2?7u8^<x%lI4BO[VKybʯUkڷt3'*n3E0}.߆f (:yo bT嵻=>|p0DudY3FYVt&I_+tRbI xKv@s\ɍrD@lյs6SO<մ9<m(/r[,-רY=go[ly,s;"1T\/A=3;KF/ /Ѕ|\:x =1LG]tu38sL>s_įD`db}S;Խq^u"c=)aà%!o]6b̠rz. DNhUo:Pr˿tڠ:T Ӏ Zx:k+e<$E҂K@ٮާHaIt]+{Zu n+̂mDRHC9+_=~)x#hiY D󧎢䞞\3 Hd]Cg_wp*MaN'xu=LLupun%9(Pb\‘jc ZŽ9жrXp4/!\%66OT_‘ݎCl7,Gl6J!5Y7c3!H~JhD%ߴC&ḬxmzƆy]5#v)3a6&!qPJi32jj `+G;*N1?L\=ɚ崺\(Q_K)=EEèa5\"cн3JCG8-& UB, 7G㴎vX'd_27qAP&U1݁fp[p!Zs,pvia]>2fUoZ8j?0pIFRJt{F ZI}=g=<. 2n#k)85_K3E M2Q+n!@$l>J.?jaD;)v9pʀE%jtM N}Gyi&VAAkY^Rq IF<3ǂnJM/c~5Lyuop %⦱ !flwC"wV߲4Tz󬎪<7 $h]8ӯ$ƞe!2R4I7(\ _uܗE@BJ d.tAÏ@Ꮥج :AJDvml?uO}Q7 jS Nr_@P@ @p&Q;Ωۼ Z(b^ә 4c׌/<ĹK~6QKev^Lwb)_+d zTiBgZ Eje(y-~czVw0c̐I^Z[8Fz[F?V^JA0 ̋6z8٫'qmNc! ((8'@K=gch( D XZIO$~c\`LbK|GTu{w &g,!%7 _O ś_ |y,'ZXkqG!+\aq&W*?T)>UŘձhtsgL%AŒ KPd[ɗhS^N X=)t?'ôeSmp 7IX.~ 3` V$_u˧{Jxj#ѭykߒ-_c؄[K?5ExsYI癹GU\fd؛0Jfkܤ *~Lyؐx Ng8׭goVE-_ԙ KaKCF x?EoI0Hõ&UՖj<7m%mWk g,ew Oe-" f%eF;ѴSkǀ4NWZQK 3 :Ca+Y }|w< K$yina?3Oyփ :\S$Ph'[ W:6 9%M+ѥ]gkd\~ l~%=FϸgHy"},AT%95Ug#D6"{I2~9s]Ujm.Rx yUy i 6GQ!ɻZq6]o%rmADXO$(nC',: HɄe)4#T1ʖHsHe3'(bgl3?4YΥn`ZR(ѻ<+GlmMw%P2E$DdQx9pGTaR^_j$#A-n"GX.9x86oziۆi(ZmOX`)?[$0crcޠdMOsYj2 3C= 6`uKoZou!Υ[Ji傝\(؉0uX1YcӲe(ywxF\2Wf~uD/<2R՞w3&PE/Nx!Z0 `7"W5B'O_\5iylwucorż&ÿj|!PLZ{ %-dc`DL}&;e]}'- 0-$bATtzdO&2#o1N&'o'y6 *=t 'QXhP"+}z Jm 'p~mu:4n*m9]~*kr5yY9]:WX(uL(WU2y]|'82?ؔ>&߷9[P%haFkat)y[GuMpkG ABVLz~vFϤ?c@!Fp%'~T^NۙKdj*~᪘^ cM--"t鶐g*,&n~ɥT$J^@zuSz3MXڽ@w16r] c&LQ1JՍ_nZ>9a[~.Uaw?Xv:Bֶ%i!Ih>l$!\Q_q~z^e7?hӜas.i]#)t?k} c>#NЌG`NYg*Ĵ9fx].pTc5#hUcޥ½x.t樷^jR,,z% ٻyR߃ycLDN]-tUMG u"bLp;I^7y`e c/ Le[+-3Q3ͯ;ySa|M)8E%={ _ ն~ !<94(7WJ ,i"Xy=^hCV&Cr >;nis@Nwcy/;4^c쉴7v}18GZ ayݣ㣒lBtfHvc\ɟeUGBS",+vt_Xk}lpU&\(/`M 9 ӋED1T>7 5}$okbzڲ*֝}$ <lGh͸5mvN\Od6wvc+/%^eC~]kXd\*CnuIįϚq-xԽu6iZ8\Q?>z"AL4rcxL^2# c(MﺙepթiפiV{OUgXIZNMu!;Csy %!zF(ú+>-?'ΦΩhF޶;פ7ɯ`3[(\Ar6hu Ɏ5gO藎J#Ȟa~*ϻz-pZ}> `C2[v2'mO*CBKFr z.߻4 ltxYPJL)ԲfKj>g1BO F6} 3~7nIc D/XHFdzh.ҙbܺ媉bݶp"DB#'ɋmV}557i/JJcYuK#hg,?l7&e!rղ*lGƃDa{Bl]!jkkkhtX,mF 4 i 8|UP|͇TVG~$Eޘ6V"d]=&qTiPd/VpP пYcM.!>gW3wfwG>$]ndU{ۜ,8eA {w3R K4鉻#nڂOJw#=WOgY'/ڳPKvVӁʫY HhL㘨3 `!$K֘bvz;f-\%ˇ<7v;nd u=z&Ą3!2Qe4i3B_* ʠwuu~U-~kz\po9L[lqF@T(zK8JCP.V }+JmwÃ,p[ٗDb᠗|3JJ/D>Zq?TgI*胭@=*3n-=.VXML׺{=Qg]2_u& Ԁ)mB%12Mq>˗dW JS1g[%;L @}p5\;.5~0u ک$3{z|2 *Zwgk>ck,y՗1U@AjU<v5rgBLF;ug.K2PI6**dPSzRB54uizlB-:r &~<=ِ\JFp NS6Рvi,a||/ yOOIdqisiw+|Nκ ]z݈5L6w/H\5F*!ۨEpxA3cF|*D?&cbJbj^\WlJ}ioPtR~<- 3q LMRk^<½e M!qՁثl4:CP11)` vݍ!:g<_BȗTRcZo?ENp2 T"UGKUnz~69i+\.7VXR.;<7-m9˒/X0!]227Mn-D*tR SZ[QE+LN\Rg#qN)/0^Hv44h:hÆDW5hQg-ZIKTϱsG#8d1 A@ދ9>, x؀%\ $NnB+ZȹͽUI\|=C p+c.g5'"%y~rl{\$9fv4O~7?ޥ3gF>ނA|ʵ_C^$&ľկyx41IFX-+jDijeEeu,ZBhXoBd{I֎&˿q ZEi8岱B ԍ[h;k̔D Y2)J ,ㆾogxD$*6d'*kqW^:/ى<)5Ҿm[ݰ EPzyS"}8 'zR#T2?.cuonKԨ&bVY1]&ޑ)?pZ$﷕Mn)-Is'@(ZRAJs-ld@6Vڻ{Q,𕑄7=>VYQ@pZ_ wjR@tS|Г(-7MXS TmXc}8=8 q܍_.bzi}8rc:of3L Y*(ì߲ޒx1K5JFK['/B(7#@*k6RBM pKƵOrznt,`1%6,1X Jee^6+қG _.3:&1S:'gg}xf4 u- oIY QVve@!gz@&YVtHI'?Kfl~3S8I6:&IZ3W0nVJ׭䥁z_YVVlI{'xGS׺E4h L7 /Az6x7(X.DM Ѣ$ j|_9w 5o~QҤe22BhN~;] F_tAhLwV0ë֭kSDU43xi\ ĐyHƃe EGwiL bus-f,{76k1̗qtg~-xC>Yh|7}\#}}ة\ S^`:,}{y|pl| )^87~)U6^b Qcwg\qdj9%}~IʜUWMA#HVZ s1lYԣ' WYSgwTT ʶҤo6Amum`o^$ikyΎngL=dC8<Նl˚֎5rLM%)tj"P/u)ܙ.Qp* D+W@ifm*ɋ۔u'D8tllrm?qܠ[6$_9gqwW}z O! myklxܴ9y~OE|4 yV܂NuViI|%FD[Oa\D h ܒsE e { 88*O8Tp$ly ?!34)t 1t ʫQOnG0oL.5];pXlXMOv+?/z[îqNSi pޠhN1Ig CH;rh7NO(xX.K!; ,O=@qCw׶jb(-.kh<yF KCo(m0IV&G#=D,puS$ <ivjZ@2vq w{yA מ/#rBwmkH燠Z6}y)Yk+f;E+ڸn|+bϠ7j}u[A v$etRBY_⛝[EA *NTP9 pe?mڐWH ȱt(1_<ޕ'qMλaS3h?R3d.Pl,w{)+ 8ً=, t|$36\e& |Ȟ<n*M naksK;Ϗԧ\q .o `SED!X*j?ȔO-JPt`|w&!)RZzHL=J_@6z~ }fO_̲߸X`1ݕ\ o8Dp4'/肒zBdG뗭5*M&wsɚ':=Au\kdEoj/uDR =[Q7MfRC* N# ǙaKx|<2dU1@! )U[FHU :cjHo(Ћ񽉹ERD^G&NⴗC&]yuд|xI,CHl;f~j؎rKYx—k)Rm ?)  aCᥠgI&@KRc>'(6=`0 n  + EOu!`lyUZ y9^ /0ȟd}1u~&GYbthuDh' f73w2 ޕzfܾr>=%th0@NoĮzցmB I;'=%iss=|͖}LSBå*FQWYBd_̾!>Hfj_"o>hȗ< |>%Eб"uZH6rz|)H7QJܼT<_郼~@.q@ F*=^3ݿ>H, *u#VBT* )M!92LRYf[I=iE]r+ UOzISdZ ;I0۸EIVA& Wkqg,UB?X<GœHZ9;BOo;ps-f\Vh;CqwNb^OapJ΀dU)3moysO @qT] ?8A\/x83bO]^åRoMb2LyJ1'o諹_4H뜨WGP7 VJȶqH/4⡮dT7 Jwp$,>FVrg7.sKFX̌Vq)00]}NgKTΉԢ=8 )Iu_K/HJArj ՞-^ԋޘúԝYZ3O.ݔ>W9H!:4k<@Ư >Ժ-cˠm# +)l-Uuo}J-5ʞ85 V)jHa5AGkKZZO)X͢ Kf ` c{w"z,j`?`7ujԮKv!*LSS"8pvt$-AO0;Fːa `MnEl iFrKϢQ!*b}&"Kɧ&A@ʾ#R3W:o`@`.RANOJ֩GToMY/bf`=:=? {η;pc\p-;8Hc-¨U&eQnQcd! Dvy1[y .>n-6 qPJO]uH};ךeU;i?࿲-˕3ۡή/Ұ;#|X8h~/n$PI^SD/==,'w fHlCKޤ*=Ί?4XWdPUT;va<zF&5<74[৻1?x3'6(<΁!pCTH)V~!HL,!6BL"%y从LeCn9W&;3iGp -}_C.JThӭ9[HndDkbgN#d@!TP\F !00@h?NW_z4'in{[U 3y@Jd߸:ȋoWӗ4n'>ϽF׿oj3v|8 |VO8 Gt=DžfS0" =9khV)*FFJe^ h8ٿ1KfV񆃞 #.ףV,[C?zX)AثD`D8 F!(Tzp7ar;)-8R.cZz}Ta #0=JUl\`> 'U%Q9/${TpgtN;=R3ol.m 8Ϋ@IS 8.o1N(?|v(Y쾽9$Mk XsϫÖ$Dmbu)#f<a ̜)}\Gc vByg'}7@yZ@[2/+OU('T_7B֮iӫOi jKL'A?rN/ QLj,( &>$3vV+)ԋ |(Z+t4 y "T?/=Wdޅb*VdxVUWДږÂ^UMrP!}xNt1hf;`Uia磖`yr6?` M2 -ILtcK;z&yb`dN"g&⋵y{ &z}(jZɊu,GgTk'^N@Cܰ"J [2Kx1[{J\eF%@{a9zF ]Dfq!n t.}As4"ڊ|#WpeDުKm6W_Jͯc?h<|)e pa{.,_֧k1΅,椚!y튼NUQHgҪp#"_6k)\_Z3)0 &[#S*i%DӞ'Lpd]CyUeZPOZ*0ƺ5 ! 4CA4z&]E -E׽ ;ͅ> P]ځo qM/->`veu%厐};U1ާzJ"E?ۑT{EӪUdmo9ˀStvQWP]UIJ698b9v6lYt,ImA$\]_ [܃uՠ`*# J',Ze˰]N'! 4I߻0<Ҫ;Hkl.fqH#ĭoZS#txx,)HUU^ Eƶ8HxhYވ6 %9'd7Enr1FwD:"2Z KN4'u˼lʗyP>PFrsy2Gqmxjܙfn&?{i˿m%K zM&/? J쿍K*p=SP-tq$S(n@S1K^M zv*!]yϞ/(yD\ SQ+tRqs #^Ti+u]lDaBC[,P$:Bè"N+^ʬ"rZm,L7g 3:Kʱ'o7?cJܢ~)`N#+GBE2@ZocS)I\d e.m(=73vHuV%LDn)6L v=mL= ^Z˩;~k0<ڜq= /[sOh`>>UꜸ/8گ:12;^38̟H I '`Uu:4 i}ƙvhS*[9}['{fG'I^F}S54VFol&U8Yq^2x5y#ԽTSL /C+C_{~O$<;ց2[!4XbVaV:"\R=ccޮcy˳cb%b"@M0VH^N hJO'sɒ C'=Ө~ʝ; LߩRB_e܇K:0fˆisUgheQb'B>b{%!o'`$g/) k%˲8~EuAEL =Rpj-l=U0!Sw߸S'ZF#m@'9\U&GWThz'@ڭ]QVyb ] q0Dwdv$a!ytK1qV_ʋPq *s})! TҬ:`Ф~Dz5@Tiw90ijUږZ/089Ho|EN%f-0D]8[]~ c77xOW@f]Y_$=tk xhEgZ2U8JN.#d7!/ ]`X(V? QʶΟkjRNiAuJȋ>3=r&uFP@"?x.1b8 c䦥+:(ykI@m;*7U3DɡiqBO^r>kMn 4ԟutz/BPE8HNI@Z{ȁ3꜊MW򛉗V5 ^R1cp-)?F,WmH:(m8 zYp7B=H v|;rqA99aIjT+:Ɵh#t\js)`I^Sd(} jr<܎miIEh& m/~*G 2n]*:@:bT{$h+Qguˁ;l]'u"D̽ K;'Y1#;Z.YuoȣE#$]a~wɞx6=Qҫ4k7 PLYjm0`U"[*q5: s&z0tf#]A_<..˛XĊ?PbHM;pH:IIRxUŲ!JkMxPĄ&7E% &S 0>L 2nqӥŮ-T޵6+! ܴY/ 6[cpW )t14qT!T #I6#T{I8A.l~b~U'G*fWrN;=/'^e~n$k ViHV$m<4faQtNĜ5*ֶݽ՘BDq%J0"~{'8b}zh؜pA+*yζ|GȚ"Ds~ :d@;V~pΊ1[1xPY?omXN8KOp7:Wa/ ҂P.KviU|k5؎߻U.{87.]%-U2g'kb<tAPR6I#I<S0VDdѷp/ dh B#!NSC[8O"g:}5ŲQoRɳفϗoh=hC7lW]; ac(`b0*Qɿs\=& ?{u=lS* F!9f׹P!ub۞. ,RoF1kD8#A'6Dio7>:ZLԜ4O o4N+bnT\D_[5'v-nmy7_GZq'"áE,V+=^F.xwx%syD YʔKL¹.)W$/|4 jh i[g-Fl =7)#a%# H:B G _-54 K9.aXSufGTbXeތ(Gj,74ѡncb`Ei,;Zfn4`>OhmIGdI{e&ڵuKgLxn 0[EwfC':"dy'CZc\\3=ҙpt |˾3ңq@!ɋ 3Y2%:ޑ~[<.SyVUPa]ن$_ Gc] -مyA:Bڦ~^_C74A+d'H heo4-6jLtg}jGH%%##$0E5M+ X%-/ ,ث 8Zfl8L}"goMnȐ7ڂbUZy]/\ћH luCI79ܪāӪ *E;9YYľl+<#:7P7ҧ[.% $ېSmf;u}DoRܒ*mymr3&DRq†rψwG'Ρ(&d_Nx 5a.ޔigg3JxSg62A_FOƇqaغw?c8p_I"*汇m^eat] {7[!FiAO'Ľ,XY:гIfC.` 7XEW\vLMAgi?㞃dG*FPͧzufz"R 6;vzp&z®thϸytxE^}[3:((%hÐ fs kƟU 8uD lUV}𦃚/yG|P7O@S&2힝w;&x3_2qApp;i?iFD*ѣ2st& bz0 x4 zY~?f0blukЧIf+3eՌpX5CH Kj#^kfSyP.Yr[( eVW(BE"P[`N.m`n.z:_> 5cf/>S7$n_[{fJ*/I2=<❍g6js )x5Z S 7BS8 t.+OeP+ 0`, pL[}I# (Qx~Q41ld'#$RAR|$GYrTMX:[aȅO \@."`֑|* "`Xu2#m*\V.hl>\5Iu}\2xyB؍Ŵd@G/K- ݒ;xq}ȿfDv=dʪ0Gos?8IHeѼH Ǡ?RG̕kTXҼ2=s/ U'UFO>CN{oojKY$^kQQw$IRG֢9+MP3gz.8x+IqMt ?*K+S+DuqE޲rm$y=(8W¬ճz\[k@l!1cƸfqŚCu_O {ihoV'Z.HkB꘸~=*l[|EcUD7pMԞcnC(`^"5wȫwc)ۯ#GRfpE@\T5铲jX>3LB;n39@1MoBs3 \;d\@ܫ0E9#h Z|NdʟS DZϾ;[ã]#:e ;8c旪r\@ɞuMXQlKf`O0Sm RcidFP7jgBRwU,yqPc'WD~[ 1];yq9#1O([o7{nhon*&ͯ8ŏƀhruW-Q^)3$W}?djqX('b݆HkE,-!Œ8yrz4άzyS:%΃X@Ch 8v }c"C 3#lfr k8SS\34X.Ԡ#J'6X6 Hgơ?Zvzd_gtHG+)Q!3^JfXkv|P4jE߇9j<ȓyB Z I Q#-Q$֑Eq>g-F2 H{TXM/ *jkʚ@f&0L~<7Lx=sI2#W,bp7vt ũQsV2ϤoL0a2:s 4gsNǑw/J^ZMX e&gqI56v"qN y:@W-VFAy2 c7=j2t^o ~e=K(}.O(.~-wY(dboΩC2!`@Qzd P Y'8=7S蠕M<%i"$arBq{}m S~Zpf!T H@+$/H]2:ޏ^i<6P&פvCy&c_6X0Ɲu> <9^s 4 e QgԵG`wJ/Cn"ܘhŶ/O#t~Mz۟ac PgB"= ؋=q ԶD"m6iq%sWUւȉ "lm} ^C7 $qu˕_.%4+lS4*jzKAG|pQWg#<]owJ6v5| qY#Gx[zt26(/q׶1;\_ #:-iuX^$s+G!\oɣPx -Qiy4 M|3I7VkNTA]0^-bンGUT:XK \pp,H )BYFaϡJHm ٢4 raLk]G,~2du @"4e=,1b)%cX4)@8MVqbH pKt|#(}KK_t^qIlC$tLqagsFgv( n%>Q.c9:}Z|kdS<^'rBERn(KE-̩h aw0_G);4Fˮijs zI( \8s>$?vS5C$yx2N )1P f:.Hds2QO%q8~VQ僔ebw̆XL/%®\h>!zzb W&,5 nN,,a'ѕUfssT57F5⨸0 jʀ.^Vz@H1ڬ$_'%|t9ɔ )]ع.}>ESk 4l;\ߔ+nQ3Be&ld4?>n׌O *ejxYr&p(3חn|dڕe'b B?z{GkSن[?^ (5/хߞ~>|<.ܶBJCQ!K(} :Z֧:>kHnНkd}z=[X.=@ mCT!0GաP('* s"`krՄ#'P?!ux&8;T-y CL5Лio9j2ۼ/SP?,4KO&Wޏ^b Ah&V2+F C61=ydǰM?+vWv/AjpRG]{pͭk03$d,mx0oSK>. a/ş*JsAMvJ5J>ev&LS;.< $x@XLL߾I9Å7cSQ.I2M0[ s%AKU_Ȝt&-ʬ<ܒn챱,g^WW3TwT|Ms+}LxsאT2 pUif=🎾{-|zfkj!IXBn7б2}ᡭ!_qܷå Up7%ykzSStj0VCaS=DL&Ktg 4yxU˶`cKy 87JDyE¥푻q|ݭɏ=Huyc`0P"ߦ iWS?Yy/6";Urp`bmg[B-JpXΘbV/P@:nAI@#ɜkV\|mGhEJ\ֲh©-Ѿl\h)]2_&װB^%,疢[!{\~-\y->]J:vG 3*326LT9A)b>+X.rt|ĥ^ n~׈TdeߕP7r[e>¤ ~|}r͂zר h5K[Qo?H,(:,le0nkv[ƀ]Btܶ'Xʠ,ƻ-a`[ˆ殩e İ5vT1BvT|`.t l&\es9Q,@n,iOWݗhip1;)y` 791.nvԙ!JaL:G; %V=vGdvcI,9gd|*fV-׃;Q;(`cwT޸@>w8( º>*A9ml>",#,IDE3}۶g PO_EpKhU -3e@._ua [#)*x@#zq|zT=*ghUUk"WKSSRgu}* w#ZEkǹ:#X{TsF.oE#]`$v( Gbpigڲ f` ٹC jd(l/jK}=sJ|x)&MgR|!-USgU =R&OonQ#t۾4Tt"۸o,wRe p/>J|ḫ3$9zٚFHvl\*5ZH{Uy0% 6@l+, >A%i%op*t*Rql7Ď](ӣĬA:L:)9)ThA^I o |IAYJ&NY GEv= *xH9E:۔A`ѭu/;?"TG[H?(d"^JIsģUIF,NmV]+_Mֆ HdGDH2J{}cE{.V8=˦`VJ mB/3rثXwuϷڂ0?2츴'$-C~Bd>G, 1r^!xG?QzT4H E0JEGL wdNx86oN/jʊm:&]ME'ϧ-;wig`4g|v=Rie5CZ(Cje_hTJd|"H;"c|H3_]ɑ`u}W˹]c?}rPn4Ďڡ9izPF$ݥ u1r[NBf! "-}1'B6V kn?S*é@ uƈ"Dβ+sS^tg|C;+5"O7q7R8rxW\L2D!=nܯH`}dq{gi9U*6@7]*_wKcWHa~e=UU ~{2o$J&n7"?]LA^ C5E'i$ 6cPQac31K*1`192Im9L:U: ,|XɍCe][@ARdcF:q:$. R[<1bh?͡>+n(x>wI\ UYO:\Hݨdw.½%)/#=/iygh6RՋ}(pvދ⳴P~:ןKAy 'Ië^}ThZ{s1#֦@CHGU K&6W(A[&|[އ8ca !!G>ʢ#%_˪ -V2c b?%II'*U*A;'M p5*z[^E;sGñQЖP1]4k\g;98o)] GF!I2?<^f7H.WݣH~o/@+e ^d`ߐ, B>Š43;]0vG&+Dx`r_Ή>im)!+pn>P}L9aBZ)k"ğͩs$+&x(pyT '4|8&TU4nHLw<"$ORZeb3ƵL֠ [7%nXXFyX73 [gpEϦJ^f.El!ޫ(V,i3=OL,Ll7.9K= |j)n㌿TJ\DP{1E Sļ~&,OPlƨ+onTAR~) Dg@5b5¸я\SZ Agd>ąn\O|O8+Q Ug|*}ׇwzu ,@S8]$y C,P^ʵ"B'2k,{M2)ԺMiAbNw{ej kDiKezۚQ\wJ>Jh)Me ?!x?l_BlkN%|MW5@~2uҚRZjL&K%MU3[GM@rSۊ7mSxtl:2o!D%6y4`W4m6雞gHKr̤;~$(G̰d1#`[W @`B'ֿXA gIZK-^y}a9˗b=5Hݮ׳K1HF%qPp'yHsƝJDP$=2X mͩ(o0R6Nְb;b5qIs6y|/'z0h|8)Y1C 8P.QYwj$fdUB(ۛ m djW9B !K$4oW NB)2(5 >P8L#i uY8N#`N@$Ja9xNegs_ ; K'FоtRh90֞8s:a|mVSz㡉ӂ7|ȗ+L! n"g}!6o-GmuWXJvۍ\xǩ!cu@\;qqxƃ)Z9KYLH%'LTO)ICEb*o8q1>vcq4[x)5 o`3%XQl.!F"qS_[J~bmM{Qp=YM ӅɎn%2%=)VIEti)6gdl8ޜ?_rtaam>޾ L&Bϴ9vZF#ٳT\1zo_&ЕOY^z ]rHH\J0\*(>xul4 CbD⪗:Ժ%imbIn~^Tn+WD z[O[I&*q^ʹ; ac1Ξ8κnX{_[ ז"%펮D\Aww+TGGqm--Ƚ􍏡PTJ>6Ȅ%O_EH_ M_v&-C3 iQ4 [#RɪD796iWůfDSkn~2.s.>(^v?fy !y;e,D,8bhc]G|O:~fi.LayN#Wc6lqA bA S<jz?qAfYt*˳ǿOkmXĨzk>8fkyJ[a)~#W|ZᩳQay"w`]e1]u(r6 !pIub ;_Kr A# Qə|]C|+F9AQjKFAYhBT#6඄#1څb=<t?@˥b  H#;n| 1 h"G];S~-kՉcγOZ m9@ʠɫ_YÕ+InF9*8&kb9V z9E/I֊nGxOlwpJi.6 t՜6>p\JzRcH/6P'F-(Evd1!l#͕:'LZeHCT+i}톥uoFXL2F7{3̃Wh u3q!;!V/gN t⩖&ȈS~CKmm^, oPJI?(i<]P2h[ƈ+؝j`QHK4Ъ 7>stV,jyF@[.V?Uz'.`;U!\S"Xq}-,^I!*G*'6J۴53blYm1F:20qh$x- L&~a*m K f@ ~rC]ś~IqCvg-_uEj(cߘ-T:Q꒲zɌP T`郙 E3i:jp=ɘě/.wHk.u7Q%N AcGjW?^~2´jNref@7%mǙՂBnpU yFO1=f0< 6#oWg(gg`!oax[)5@`F~_m3v&CŁQ5 DaV@XyZwUz[e6e5(Vsvx8-!NDL.y¡1٫IDR29Ya)[^rM17j*@56 kG6:z4AC- ( ^!㉒5xg]Utsvb d |Xay H}i:ސVm =}?8-{]gskgmrg#$ٱ %[[Y^"рK49$%;@Za}x;$yn_7o>ՒW Dſ8Hg6Ks s[b+~ðClQLJ]zZ Kx |P+*}&dֈp?%ģQ+0*=!˱*hQx ^yjG!PW,HĠz*ӣ}F,8wDpOrrH\fCayـ;gI[;\'9NP gxu'bdaAĞ cˁmj]8Jrxo""K 3\.ݥXns>(3ZwCnYu +ݵmDg"[(S\.m KR]WO(g0A[ͫ`W#81؍_.\,k#hqs71eny /.W[P9L#3_q&~Ȁo{amuJhhjSG!c !J;qi_v~A(ntO.O {Pu#EyvCBf_} Wt3(Q;3V W:D@*lhb/gڥ%JR|GO1e:F ]u E.yYoD'X +JkԩWpN%*;-(7ҝQF~܉v|DF1vFTBrM\.G$QRWk2(qXR>nh 2·<ѹ*.|P&T\ ( YH6\6$d_Fr#ɣJ;t|wd~U'dx0 e)I<T 솶OxX2T-Oa"D׃k.O6<> ]Q5#qͩxKSNwEi ٘:TPvRbcŒ,/Zh; %E.Ο#9'`Y쐄Y$IEo1u":Ֆ,ڡt>vO€\$SS@-,F8? ʯGw &(&f)#kSIWibFtYJo{p&K;ڳZhMC,W@ŐS ݛ,;c=x<V ?t"QE?:aȅBE^|{3t d|$‘寵ҡx"TutT5!p{0[[;)&gҠxC`/МNv Hڞ"}*5E6..% p(++ 1mg:nAgdHkZpxo(L n~c}RW'ҁt;zƑ/p @a(hFp.a q,Đ{Ln0c"UOmCEnNqQRg-p#ςXYaH.Si00:u[DՕ)ec2e1@;yQҬYs֞{n\ #hSQxBXajh0lY$ڹi@䙥zrWH?d8V>Ӄ`H*Taˡlv7wynX1v)Ҿ ^' 3 OO_@Tma#21S9sJB`OWࢳEP. ku/3dzhN8̦(m 4A*A ͏hA~X.~ϫ$k([gAqhocS K+:c'<3tTyc toofe2 6< : Rغf)&m} *"60X yQzG"lIh8'JBgZ_IAxtwHiI9.bb9Ѷ\֊1--F-q /X{\f^CQct]ɶ`&V:bcP$" 2㢹+j+Ÿ2r7Ϳ/F!L_6,π^^{,8 `hOLpjK:)1Zh+wAy<DFoz&`;d;&b&5^̬y-$ʒ!wW?mtsɆkxy_NbxS __X˸xZ_,|$蒭%kHd_ɠuXYt[D|֦s>Qqs Okȿ51hҔLTv݆ UYppLZ嚃3ŇBWljd@Zj*jdޣNt ,0Ig^ zDHuuKyp㩹  w*d;ZJBخik.!T"CA` T3Hʪ6 g*~NnJU$3i A޶B{/d($K$(%Zdb1(PZR t26T K7Nn3"i0T2Ϳ%lӖSE4J tDTb=Oƀ=B08WkttW $+>BEch} 9#̓?OOa&"MHaW'ppb>m{{$˟ qumR5o KO\~-_:"aZI7BJl[nh>ii]Y_>_c.&UʉVUz%< bax`4evYsi\QYQgzyDױi|w2qwLg'Gh[YEX)F~aH g9MA#TK=/a'}8sHsV ?Ff0az:|A֙ox[  9ՙ6 `!wFεza=ؼur=zDqƐyQ+wФfjStԻ6v̎SBt~قt[@– kTH2?aR,B>-,5$՘`2D_1ʍ s+#CLuup$#7Eԟ+O$Bri .ibrSI2 )c,^$Q@0Z%H 85j G-*ү"eyLq̪a" Xnq ]5kT1@M+VVlƃ 8% |Ր"{\>E1vqo?#.yhʃWR_;k>L,wg0mkl/?r|FJsԇ^`N"_CA- d}OSA!l(lybBZ(S܉NhK %wPAg3i1DkĄ sO`'hI4}h['U^ݐ#R1*_/0t*N#eQ 6VZ+tW˾ljpf {uK/+p@ZAMOhn7adYuU۳jj 7qpqWm/N"] 14kU#$ `8x1?EGlO+2<S)2-b&tjи0'wٶt;4WYM ]aFXD>,>b QƳ3uFS;|;f ,E`;W[uW7[Jhe;vmHkIHsTGI%fW%7Sᡌ ɗҸ9rm8qY8š1S-cQFk/6엙t \!zՓo߱+Dn9MEw.'zL ν\{%RP鶬Fw4wqjX{ csfܚB@n =o (=S} ix$.^8,Ү~mG31RM`=aSTW{ s)#ȉ~As2c};Mٵ%C9oBW?_|K~r1(UW 7ʢPd'Y>-o*l߳d_r} ƜDA?\CzMM4^KWo^ WXƥ{Dx}:).#raop?.xGX=8+ui2p-x#@)=_qn0tp>Ճa 9VרY4S,{G1w IaO\7p#>4\<-`.B:`$[UnW %JR2 L9FpdImwsErw aH@cT}|:ȼX46j^hʤc S. _'\dϮ)3@I?c%7׆O``w R(Rp8T` ^~] 0v7.MPk- 3(NҚ!0 z,-ACt@fΣomإgcuTs@8VLZT#vF$S]cqxxcQPL {܅h{)s{4P4E Zۆ"^ҋcn[()S!j[.T'YoDZcC&}.˅c~fcRmp7cEjDΕ^9S9It;6V3l"S1o^+IQ *A?P&YDBzVH18.6}Sٶ;BQq[WbXIUjtȯ;!o&P6 acCy_^*5Fa֤s}Mo`ސԷCXXH8Ր,6ߥH4v%qiK9[ ]H}0m}3yV2ELg>*2pv:4)-!upk_ű=mtk`u6MgR&4$ c|uC#ghş@%dTYv >`8q`pǞ2M;f0|Nu/-e_Ie:R.7nwG~Hu:B JIk >T{&s8i=q9_?čNU;|D NT:L9ɱ;ԛt&,@t}#]J+~٪M=z*!(f noRm͝5SLR@R~{ 8V3;gV'VS{xosU_vR ,_kE4rR+r˰سP .0i)!8}* &ȥ;o~KҗT~sP>MT{< -s6/CQ~ot 2LJ@ֆ;S+R=/R$W9{`WZ5n\Igqq/cSKְ[j]_uYJU!2)  tqvkJ|D; 9N!gza]d8zU@JdȘC0MHߦ܈F,3Z[.(ȃl0W»nPZE.w:!pfd*?Z3nj7$9pmܬb"[7f%*i=PUO%ö5xv @Gwkf.<%cwCǷו| eO Khrdb8Mҭϐ.x<2?_nқRc00{ZkT &Rxaa<Ʊ{6h v\呷 ?, / T -Ӳc@ҥV2ptd_25wãݸ· |_AD}E%y M 0/u6E崬-|~YRJt!@ zNfQTp]0AcկO|i$9zuV{$JĒc2{Jۧz<4j~3k~ 9fTGF9}ߚ!(8!,887l{xwg;˗фJ-mI'1_6]ƥ-2NIc )A^Wv=:oo:=oYAQndg}8 !40"=nie(GRo4 tFw*$?$3B^v`c^0I~ GB3Izwӟ}++B{\1KzPdFVe=P_Y>sr8t#=H.=Y%[VA!qU TqK4,b' NgU]gP_[HgB q-F^!x7AGp;6 ߛYU wvk\KeIl&#y;%)Eo`' n+6. *Sd_MDqaIM?~g!1B %y){x|BXƂ )SoP+rhnm`F>($} $E"ke(gԐz|;ܡYߦ %߮ /5D@l̖=AG9GIwd)+ظ:q0m3cf3HM#wjejR<(4/a"o/pMtdpq|nR\apun |ڐ2~Q7*tMkO PPYQ"~PSw^'UՎs-y pD=+gn[nj mO1sHh3\a&DvftxgHbpD KZ&"};5$/C/vZ{iٻ@.9%"o@שכv8vd-!g7p8s`t\UȈ\'p람ۡap^*+p%"˱pj:֍EzX[6s4pQjӾ=?./.?4#G|p&wٳ C 8soV Q#P%dE[tJy ^MpN D6I6 E%Sغ]1.prz=k:Չm3a}̠_Ҋ4!5aAqLK$u9/\p.f5¨ϥM9\#|_ٻ$c^.ksOJkW`vt\i0|AkY'^(@$MYu8bDCqF󐹌d>2jZq}D$ 传VT'ku,4Qٞ K~u'}Ѻe֦xwq9>5jCgZ>P@wC.D*\k}wW_DKV-2;B3h!{BC)+%L;NVqYS[y,Paڒvci6l^~x_w]xA:X<ԡuOj0'%hU*t:A ܪo]2rˇW# b-5 =v!>I>cC}:߾عC`LtSP` vijI Y_#?ߴ1)Ϣ J._ 3ߚi=_O3}ٗ$DW|ʅp@jު.7e ΚK[1c;s$Mr?j47&cp8BWJc{L6#^tcq!2_`4ǖi u$o_n!40Yu<=~(E[PҀpqWS{5$Bj7E8Ng襀$2rd *XQ(h~ѭח@޲9gK̞̒1O/Zvg+hQZkn)BB+-*!g[^̟\ ъMqTH9 2ʡP6` ;ݛz8 ,; D9?0 KJ=+p\\D92F"v7yz@ˎoH ?Iz*:PtxuQQZftUw'nbDexhҦ7F!(v|uۼv9% 3T(n PK`=m77_ E <5Uhk=6QARUb#{:G IE |^) O5slYzRҗ{{R;ޯ%_b ^YW>΍; JJxDrqjv4d v6Kd>cd ӜvpG6=QRZHb ?kK̚0%Hw5jӡ?!s҄PcyH,ek^4}e}0x̙כ'fUlOv4$YYtMj-| v_]{ (-)Ⱥˬ\䁬 /`jmPW6vSKrtDŚբ BkʠR{RZ&'GAl&Y)cB}fTۖ,->F^~k1erP@:;Ii֥rHTp{E?j)6B#cy)|(٦sAsW7DP*8BװF֢H(^H7m~u%HBj,{@aC2MǙ(X_9Yr!BM{jH`+r@ՠ?cւZX*HjbMuK*\jR//q`a+\/:tAoIGoR|hJvO~I 98'%c=P5:#Bބ4RWUƿl9?dHEL?)j~6EE!P3]~fY:Fi>TªhM#2Pr}A)_^ 0E.rɤ˰ O$5έ%ͨ׫_P]"w6sכ:3}wdVa$Rgfm3MϬ~qx oymxt_^/z D*/Ix#B?:LPz8$o-c5rqgx_Ԑ~0z#7Ƈބ$ZTiMi?4ZD&gUhiꅎpDQ18r/$5O c'J Ãhuz^Lgq)0ܟWX1P,U67d#mE3e-[Q9MMJhT˅zkPpmѹ2,J*r" †!{D1|+7 |KUx\87>nF/2NJ&s&`0G \ %̤U*/*ca1Q[)Z_=i&-?_kw=}B`>1;49^Ղ*i;4R+r]7lVEܼK%RqM>ucQ$bWWrc9(Xk"F!E*. pVϬ!< "3hw[-5Q`+Bޫea\P4zPr=څ1mӐMP c*CٗjΒ~%Qc %^{{M"`1Vڷ]ӅzF)YӘ~'h]#7OmT+evH?Ѧ2Jha[F'3 t[$bCz^$|?=_ k=~4\3z!`E3T:u9x8+EQ U]0 KYj rDNH6;wZn!HJ sn oXѴÎ0C+gS'6;kJ;,׍W7C,j£ yAYB ŀI?A_zh1AJD/bў5qIңc[&I{rݢDrBm-5VBd^":8h%X=b4.yG"8Ȑ)"Bu3ձW[X: w剡 Kf=S*=EbjHsR6C IuҢ%ecN,~u(7߇m+OY5(;@/n#gj *l㐌eA?Km@EwI<+2 Ѓb){uKy2#RI`dxOH&< 0s [|LyYb- m#7]/BSɫd̝|̼L|+1fӡƣw}\ #(hNYQ(t@*6w:aW+>[Qa5y_ԶB@d,G"u:3f? [h9|fq 恃 :{_sgY:k|9҆5GB-Ȼg5w~I~G+m }ƫlM8z{j3'px0ڰd&+DtUnbq R12DpgeMYh?Ȣ=H :$A\ŇMuA{pHǧllDS`j,%jwI@^wRXP**h *iDlҲ\ <6%%ݤ}P*1DT'yN*kkIK.w6yqy'-n}Ou&r-n?="dDw!d#;!Zpu5w%;w;&G%jh GQ6SU@h|ZF(w7hU5 IïP0 >#I`pMpk >lɮH F(It(n8ZJx6I_QtDqy3j |vqv_81QJƌ͵y [ tbciP>AZZ0= oTroZ[x ·8_ {o;bR^YrAyn"{v ,&2ʙ+1qViMz)r_MzJK4i̇A.vȗ*rx[ŝNJ6AYӞNhء4|}_RѴ2}J:N:n+:yZ- KO妢@GѴ]#]/#$Ȭ̹WU D ލ{Omm]m3SݡO6h]ME&1IΛ2ʹ>Vrx~!1TAZثIl.Z44C+~VAWs`V4 l(F6-C6X"铇r'8rrEOL48oMs@qEĭ)_ jw,tdw#Z~϶,R_Lp}+GA;W΀2&sB g8ܕ=aJl(>7sL%bW(piV|pAOX| |v~ DRϽ X8pRO*}6oD@5G&'X7yD p<=V| }E8 }q;=ͳ׋bF-r=[ ʘ V7lMlKԷz A CG]!`caՠ efYDn|Y-d.jMJU: qg;1 0Z _cҷ(vt- @"O*Q?r9OlMVNjǮCt/uMޑYQ9 ?jNؾhOwEahb׌O#j/W}0A0: O>y Q;n+ȡF3Epp^ˏ\28 R$(!|QAwg ܥqPl7O—+ݭ'8FԞNf^| -8I8tgp~ӏhp@|n8z%y4S{8VYډ BWGʴÜLGq,?kH ?|@i_ږP( t-0r3*A掟%`"YH5oD[axrKIܔ{:"]_E[]2Ƕ {;`#"pQ/JGl~ci8wBC6\TwM ';I)Pۂ3)kG mAn}6/NBEba'U'TIj}+y ȡ5X(OQW'ȝ0,3`_wcNr5ǦDaE26 J ưM=M"j@{C(wv(7aOG,Ы@éڦϩH%XڰU~GN@ҿQf'QNr. ,Ͳ~=ᏧTMrZĠ ggQ :8ژ|n7eX ]\SjTFG]j$"= oXPNl{ RU}9ypʕne4C6۠|D'\5M`dyV|Dc;/-G,x܎Q5Q2NpPcVFidED@q39Jgg9I.R\Ĺ+JjJ*` E5d{%Uj {'dQ1V}e$ VBaN19&$⩱Z5 NE1.0E?bսl^Z}|TW<5(n {7}WpB2 ZRJd׊B@.dzhaER8S;RNG[{3LBXuW1U+x ŋwU=W075vsO>Nx)BZ w *C=:e.00zYGqCA)++.,nFU %7bd{T=|Z`+ik+\mT!%lEX3E$X>!39K:(AQbsﰈdhlܲ 剬G$Y tr^5IƣuJd:βpOyT4 JՂRWvWS6 9`zLrSł|{%-CR %τP&+D hCiO[,GŻa >e$KIDyUw,Jj~U~%:0=ߧ:&wOu^R;Qp=iv|̛_/P(N>핡n ٜ9^ d!49DRxn[Yxٓ *\l@6Ȁ?,F_Zb% ! %bLj;Hٌ)Q 窩(tpT`ifetކw|dQQzv{ٽke4.-,f!R&fӾ<鸖DG思 v҈vå"ׄ`)B͘5zw;K_5O X?p)-!&kpJ\29F>KOhS,YY'3Th޲%EW :FW e04n*G+A]!rxi9AΎZD'?9iDTֶ3|-O+W?Bra|t4`ULq3 _=AL~H>MvXxBtڶU|=&'B-ji--~E'd9VANzb=9QjJɉ+p&IJ:nEzc;Ѵ,i$Y՘q (3E2+W4_d浙B/t{jimύy ֓5: z3pFb6M;8WV+ Z6p1V p뱡%k!X9䋝R_v8qw'{w+5:{RNVG zDKbnab\o h!L..8k\+#gO*04id;DE@bov롴W?p]1o%zI*Cfې t n*p J"Kb#6ނo)E=sn;$ʏ NH%_T?B{K6N: 1JF@ NU+OqCa>IQ=%.oTOՒ:ne6SJ pOBV}TlLw@vaZ~5\ŷB>Bs74wd}l4LwvԌ`:A?oޫ)v?r1_L#M9\jC~d`[=\ 1s5B%Us2*o Gr*Qx JX #y*F"anK4ohŹRhu#kMwE|΋>:sS=0T&ZԆJ] Iױ`hKc~^9x:bܖIy93Еve;Y˴}8| vbat?rk5·d48_ ?="aLѻBJ뤶;iMsŬ:vAV.v8͓DazMT^^LZlwג7B-Z}0z2uЗ {ӹ:C F8>ս@mB*A&q\xSpm7/%mr=%C8t5{Ū%ԢV CW[#y8=%qO 7E y/B=RJ6xy$NH12JWڹ]R ]3C]Y_4d)J# ʮ ʩY,{zR@x;pqY%E Vy qJa@>dʑ6NPe]n:aGFNێ&|HU * ̤{ʪc\%L1KR*\XOeյ+ G=[% `)Q? `?rFÃ.t iF{nN}ʢN㢨ɮmv`Νu.|<ª"9/_?)MZ@T__N^qjڊ壦_S$:J{ P4گԼ() ;̂w-8h9xهN(`pG;ߑn =Ug?Nzg5kO#2'IG=fݡʡY='{tiǟRr B:"QR_' @aꠥ6G dxS6%!?iWkl/BK48籈2'wbуB^KeWaTL$JO" *꫆nyV|^d0ē':du7u?nl(G (m94'Y_vu"-5"7zRanަb1Y4(.|zPɸF5oY(Ѷ.-EwSz[X9[z]K,sbq;/R;0;0R$kG 2鹙)BȚ_:CwNZp'A*AQS>rpN{촎 j;VȖ pYFQAk~bI~+% I9xڹsEC-j39Zъ^9PW6w=4qE0Ľ =W>t0zGw+٫;t8E4>kA..n^ENCI(*%JUu1S1vx&v8O:"s!͚MN U!Jed[DLYtⱫw&^-PgBy1L&CM,^RPWn=GNkRUp4kd:@uެk8w3R[1;j[/;8ԗ~&$w*#o<;Tp&CS 0PR *ah`*8FQ :QlyrUQ6Ǐ'u|sWFPxWhm'Q Nu> JAH&|.WGkl b|{h^{\!faЂ܃<㪫|-Wh23uH- (֛  ~P i_^ߑ/`\0Ty ^Fn=[ XhTfGGn%ԹT D)Ie:z{O{vU{{%8@$S_h[D<.*vcK}ь0$b qugs`;?o)#03 83ۨ+۟V'IU:MpҴt6^mw@t1 [uj9,fG:5||q}=o)1"ؕl(ƂjBϣ? Ò3[V!ە8;oLfjQJ `iDAS 7N q5-6ҷN<ȼd 8AqrCtvًpؠ٧yV<@}|/$y(*-Bog?E!^ac,0ᇙHdΆ bK{O: &"cR^c\%ɒ+~[D|٨W^v^o8$3*^*h9ED N K,AIf0NT)GMUj 5w4JcH*,VjvՅy|LI:G/lԎnctKt(V{ w ANf?_y6mery\wvYI'ȼ[*L^ QX(Ձ&-ضaQ`V`QAQ9^ԲB.9Ӣqf+/!,JfKM:-/`n$FR3d`b|=9-&uWD 2XA#j(GCѦsu(=+LnV()H >Oȣ]z.-: e:DjL7|ݗ+u9zpfϱo%;҂kb'Y"NYNo%ͩ+es5_ƊQ$܍2ʹ Sff6K:OؓFZW5Հ7;Bۓm" {O)5"K 'Tec^k=?N5ie;tPuP"-G^ ".׹Tz: bTa63xiemk9AZ~Ycۜuu$ГlN;G|'jC[&dV W]3yE%d9s+74ÓvQ<V20 $G$(S'Mzɥfm- 0ۋ$WSf*3o]<[?IU)[W)mD^?rC2MЧzON^,s݈o8ml,$>F&};nCKk˰ѯ,wHC0k)jPA's=T:/A|5:Hsj?h=@'1II 9w`˞!)vlc8OF`ђ_GU֫Lz_>wM7~Wo Xh[I(2LnrXGLXxN*>n9؁3Մ$D°bi6lh4}+FtnSHAe@D\rG*AÚQ,S;;9ֶS]aZY/l6ׂQr:<ձW"vU|Qj1 | W0rkѭV.$GaGgMoZ(oYcYLTlֽlp_ϯR:UpwNRk8^Tut-(zo:V+IZUARt?q:TL9Ú;WC>奸"q^ f{&jK~84$ J=Q9R-s<O|-qIl۱ l?SoE ޑr3GnգRl^Mȍބl"] xBa90N_w5_A :j#vU9FA Øգ,ph[Yq;e&k7Hټ7[EMCuysz56\O4jd& 4p˛l͊lIU $2dS+}c4VKqu(՚GpPTL+X&JLD/mHŊN- 6ȇ;u¢9ܗ;e8Wi2 K\rn;.a್IٺR tf%C'U.E0PǺ(r)b׺hFJ t(fqʈ8vM=lu4xK@_\MH%`Ċ:|$!3YꓲG$TICrΎGOcN4JoZ+c'ڠ7#cF5m3rH Jy)0䣴#2zҎ'XnyvL K8L%qrgwFYapQVmwҳR1'FmC F_l4ts&s'0,qӋ")U_",r D=gM%77z:e­(4>keqc_ (sYzCٝ~H (caxbo"NT>t7k-< kgl"jsW-,ھޤ{?mm;w|6f#܋jrcqr*shLޣ)P Π` @gqnvxHUJXgVC cl_vo!vuƾXbɩ \AP4=u^DT1,嚁B.6I5im͍ʞB>DSwdž:SqclXuWS@Tfy$z(5,,VnBS>ZNm0ǩ)oŞWk>p8hWDiCO_ZK ѤZ= +>.RZ)ߊ.}{3\Wmx:& ͦ+L겖c2l;6\޺Ɔ-$g%>+C6=J,ٴ=yaƾsml T}m3Jb@#8Q8BȈḢ1 5xF/đ@G"#hudl7 u͜\V& I,hvsLWe%Ts8Fʝ`rОj<n3ijnXgޤ8fga Nmpn'5Jh qoh"~hPyHWMY, ׺WXѼNIEn T^ɔ9gK2# ʎXb #m&1(6M8jĠ (1ceafV 16T8g >o^imV@A63[LoVV*Z-eӐQ>>6}C)f=)Ӫ0dq[1'+$4X^1fH5~顇IÂ*U0rt'8@CLO"69ؖm;jРeÀ֜pPz7^lth*dRiK9o[L9^ش&™~8'|_e6lgHthC]δT'ycQdc-g YP4@s2W;v .:wk "BD f =j*:蹝4{/AOd~*Kad|OǛ; *Rl) 8>jX_pji39@=csz^B k̇GQ`ol=HqXuQ!3%D6 V;Q9B "^* s %e!H29޽.c ;L-L WCfsg'&~kc¹$o!׮ JfMQ Ak9֗eHv0xayԦ OlhbyČ+6(o1` Wzx;ܶ}r fެaS;Kly[Y^nk@{g9a8ͭuB; ޱWMEI Z sRI\rcf5%ѣl R?rуl,lgR zZ"Fiq`4j[w#'aa<Îvb<ػ*E_UNRS:kLUԲFT긥nsp6sĒ{Ұ6Y(OJKfU:-,io F:Sqj'JwQi+iw(2ӷjĹl @!ݢxjTbMt·ffy#vI],+Aފ*olFfY<)bzȎF{X0z j55F"32Jb?%s([}SДhÎ`7d7NHepк .eÍ~FTDg+ 0`#@ؙq0ϓ`w˞ztnDy8 . ']өC~UAZ= Vp伝 cg˴.^KUimu8e5+zen.MPVD Xո(w!M@}9vR+^V[I9i_s5D'EL V[\WqbB&.#B7;rT߿l9vf_3@p4c:'RIr|헲 &5q&4v52\1qqFOleϗr\}%X05ו@1rSvip%eHumeXr.Ld,uNS!K%%dSR4єֹ)EͷhngrӨMFr9J9z@3jys]*uӸfT%5̖CcECh<2wz 6S5\N6RIuG,xL{.XIn`S㌑*L<W@ާ0[*yÛ]z e')A,]ʋa

HW7`ib΃"V O]f MA1s}U0 =X`&m)̂1n[O PfN~-7raؼ[#P20nۃ !8)=+m0 M]LgJ,vipM;]Zit:A|Y05ƌC6hw$4_e# Tȳ+Üppr`3KV!UjmG#9 JIcC\Hm݆Ny%byS#pv\~rmmJPmQZO8S ElV!'Tbw}s)}{-73ߤѴs2#WFiLo &C*RS"߫d^_x\eVFΡ w}ڱZ6DݦY2ԋ>Զ^HΪNXU'ńWndoG4 ${ve&&adcBũNe;Wh2vҦѥ2IK-MgG@Fɔ9{qm(Dz`1͹p]{L܈16D;.K?D$qL5eG,[$TLo%Ūci*j\Yz]W}}DZЎY{7Y3& e%zTt9 d"2v^:)q ֳ׎4~aq0K7f굜ͮ][!TRlmYc,ڄ"FCl|^cIkC WgQt$[(6/_S #9`/UrȭLw0H5楯rJ9l0""B]ٗN\\=}t{~k>]kY Vl6m.%_YwC"Z@I;r,qgQ)d Dz:˶͆T#<6S't`0(_S #"0NƍW :9kS % Ák1b/ y*yX];@BjvQND:͡ۅ^."i8?z]uQTV1pE)HI\L5zR1[&p,` 5<EU.S~zK֊)B.anX8NuhɤcFDFV} y9 9ls9$Uyq̼qLw+fOCBXôybπϥKmVBO}A X8W1`εL ( D$(,9ɼg =ʃ0x&a%Hf=ӒouQ1@ԧ2"P ukX1"-~ڤ($$yNBHƽ"tw X^^ Z2ˀ&-WiA| H@2L)\8n&au8 KU3i;EL߷H:\HYh,/ږXTxQYYқz=0D#8{pyrدN-NJ0aaa,4{xWmb99M ^}fSKXQV`0v}^mȸ7L( )V#ԏ1Ij@1 EٶĚw63_u- &p$*ۼAxcAE%UC0zB=~jI.ĖelNbb-jSQn)i˟/{e3?]e IL:ͥzbNVIzG )(0 M/ u_N\[Zc8n$<5l„fNEA7ȡ YxBb($L`zÍǣ;ABm@:$F1=ʥʥv䜨8-HK9,ٯ_j*}gsi混R JeLegۭBq/$팶Ha$Go\Q:z\EȀɪy\Q¨e&<|I " Lt+s]PEj7hzN (7 )ߴ bɠN"NѐA6, HB=! ` BuI!I&ba@ 2rW39$ '*LG8ٰWPa=f۵|fزۖϚtrU- @*ue5TtbLXHHI!$ {G=s@}N`qсa|~QX)~VjNo1Nu{S3O13E_fgy))I9g'PH@ o'vKeeqK'j}S^c빛훥B6lHC(/[M.[?Y j~O_7=Orp;>q@_c/K"MDfIr 471 dED͡/-Rv摌~J0>7ecx']G 5ЄKΥ%1@$yB@<_Çl~-q6 v9>}laH:UI kk#uq}PfwK o;Y/V$.e '!϶ME A6,>ѣ.b:I:'lIs N)BmҐDSj|2Zi@ A @dl7 @LQ ~R';byMmR So1l@\ R e2$[UUR51YyY2]]wY@@$!i|Vv>BR@oMxfBA0][:{~'}L;ǧHIq3ޫ}|<0 IdH'{so_z_Ci $3!C@oeÏ@b`tߔ$cHN6ZƙVv("I2$7RLۿѯfHw$`HQC{۳u γk@a! $ ߰=Bep&BixQ!1(Z<v{o.T屆y0 ,!vFEoh 0 0[Go{wt^B$$IڳKs/ήĀ@ G=LmӘ׆x @&k)cYrTU e@؁S2gMU$M+ɳށ0;%J(3g}L[gWauװ5xͦ'Wmv; 756_#It$ r=H@н}@lBtZx[Zdk ưk1́klmå= 6y0w(@1}ȚNڃ9}zgwxkOp@?$K d1 DzkȚYPּRn7/3KWk6Bv8 xjf6{{o=M$Y&|ɛip8vt3Shy[⵷QERJyB$a  @"@Pi|fVs+LD?{ $'U6< i s.v< 8-]0ZHK$G* tX!\pČPcHn_i6&W2Bw'KۜoO' 7Ur`BX砝y>KGԹKg; R׮y-S0$'2B㰆:n6錄eIMD*yv{ éV% M6ɢ@B8lst@ zMo6Ύ/:?89_+:*1ݔ4sBy=`6[w_k]YP$K= 321beOr$! =Fǩeݴ49XCKWOE z؄\Icݩvه$v\\_d yޗ~_}6cp. 0{|+?@İbͲN Ia!a꼽1x!fYVzLi2z) 2jjcX *\{.H~W긍yR9OR$LJh,PH.?t9B~%(&81̔grwf yGjxbaDy'q UrKK9X\/;6ރ1~Kq@6 B&?/fb@\@ Boż=۩+j*JH&(C9p<8܀n[_6ݾD`M]y|Vɩm< ^, aH#{TUEVLa ]zv5ϋԦU&yd? mFQh@ D zx+mx707Dx^KRyVF c~a{Z64Ulo"Fo@Gz@$HBlaG^,BwwlHCU-E,deJ$hqqdh{^)1 Lː`Ч9 T\ԥ:-Loݎ˗j_˧|sI&>bnSt?>;)jxўZŽK&>og\8lFJ :JOƹ%E<'D!1D˾q)4i \DHr]˂ltT  $D@|8 /R0Nմ_f񙀓'N0ˌ!Pl׭Yu꿮~&$ @oSċ/_`Ոd@JO'I "@u߫ԋПN:cBhp2@!9b>ƿ14}3>oPΞάab@D@͌ht;1s.@ t'&yASS#fC'bHt4CA,V@`F>\?CW'!UDҎaVQ=-tI.!ز{"b) ke"Jul| |i@Y?'*O27:]vap{Isux]v6loH*3v}*} F~k 5_qHs_Df_^? >e#:`y׌`%8NT뫱ދrOS}O7\ H߉'#[W-:~Ym܎1ħ8v|߭?C2'Rی2@u$id+~%"I?[-fy}~y?؀=t|ŵIf'\8:DeF͋;h h(&}ᏼXOޙ^7+{\N'd8pT>o @n+臨@ I8gN.r< 5~P(Gܙ[Jn3B`.&ۨg[Z;+BW@H i?ct2v@SVA3>uFDFc(XlS<"'muR\+]z Ԥ?p_< E#P5 rr \7R7D NKX`Ǖ)%%=$Nة9i  ޝ:Ҡ؈=9a Y q(Cv|JaSesyb02ѻBH8LB#:Lfc[{sBR0p7<#<9ߓ?@ TIcvy P0j(rGٷ*ڥNB<;h P>43luezE :-s J@Jӕ=)Ɂ[je2{O:8pq.`&P2Jqm3?M(JLjM5A2F1 p9BIp?@gJ zMVЌTG V#+f$7'nܴ;j鱂(FŇ9hz|0ڸoVv UB3Gs6S~QhԞ9 h  ÝɾB( l=]HxFRZtR!&FHONHOwP fqab70{LnOU#]Yc̳[}o,䟆QqN_ru;}K<];mmJطT]tI?b ;܉AjQúgZp.Su2|f: @'ͳ.%~3~א̦ pBin/kWJϧklMRQzU$o!i{l;}(tXht9}'*c P0~ '? %C8L b0,y'$"E7ޑQ7E]9/"ͱ<-zV=~Ju=:{70(P"{Q-A߳+5)< V#PPx5Rp=u?Fswķ~Vy@@ xFSLJlgɹ}_U}ڻ5Yq wz:W9$os:rQ Hb_o}}皛ھs 1@Ӈ7LJ.ɣb =r|ս7)uN1UŠ)bD'mn]}Y.t2M[Մq[ݴu?)QE_%vL'7滝n+45=I^q_w|Ss9;#/%x|7;N{s8۝nAo_/ooOG<_~}>?O?lhh/Y ?/H~9 hXőTjj*l3׶%m g_Že vPOWw,ܖH?bHdwmWW7K;a*gUO{#9zOo||b-i)׷{dD[_)?_/67IZ .}RfӠT%ʥV% wPuf0}%r?^/&CM3,킃ϧ1Ӕ[ QqjW~/_7=|ߗǴq\rW!"5+/[X+v_i2{tdB2I>Rtz¥U\l?O3x|z/3Qh}q.i!?< Ľ¨Ӹs;K\dMcyޭ$4rfߗdϧ+{T^Ao' zu}InؘC8&W04;T?_kWjj/s^WnG!S׹de5zw~f"]gKQpv)vdVM}p}^Mī ׹cUvMo"v)Y=F+붑l~4\?7,_kwY]sk:bS ^/TSmS9u]FutǵBP$:R?tZmΓcu?DhZ.l4)"q%le*N4ᾛ}F;泥E&ړשty:|ad B$ Y $S$@$dI/¯QKaCѷ|4ՁoI2Cyu9Xw PF,;.8(N~VGX=:*.9;#W[e̅T wp&*> HI'! d'J֨mxlYRM5cȵj$T%;~"nI34I wV$۰92:I I$'IBk&$ IafRBI e2 '-U!,!@j2N)f&6~ yw8ĒLlm7̐AL&MLSakȧ`hHVT=7~ڿ'<l lOb2٤N7\I9p$!I"Nq Y; -Iz HL| I BR$Q!!!f2E05PX#)8n2 W+@tM:$ {$C96{ZBa4^) L]P/53t6ܥ9s*&^(9VfR;2*TNu$!$$$ڰ nm8 d`s1,bפ.f0Ȋf|J;]^cd IsHl`/* KDCY%U Cj3dٵn$6yLݰ&M.5d=gQWiEGukÂSsi;Kd&0uզäM]h@IڭmFMW~--OHu]N]Dc6O&/I9$L]b U^64˄.e!mSN¨3j$ da(*y*W%nk6-|jnDu Ǜ "3RT ɂ躬 s6ƝE_HAA 39w Eiqr(oI$d:,ZI`eݝqVD\qs[sk9(%N8պuG98:N8S+:KI(%.8 RSZ QsgNNjP /s9&kUze?=f5? #0=nO:r+"fqKUUڰ,X" r),KPSjT nfT{Χ'!lxH#N/I$dPTaOU|?Pesu$YeViE98)$@ϮABda dafg<٦2P!VMԂ*O@)" @+giHڦ I (I.0iw.y!gps]>4څ!a3XFU86U7[6LG?䮁{ߞJ(:@)1#"^(L+73^`d4G*I kq5u@@p7 u755DMPBRL}CӶ-@ Fly}[]i4 =2'ӿYLaxn5_" cr9\ 0M!ezu컃@$7uNY!4E yM#,mM;w$c3P8aqmg$CGX@:P~86K8b&0 a0O 9"$`JR C^@Wy\wuQu; ,(@tJ'ж ǧظo6x L |Ӵ&gkckK.Ω=41)@$g@Q2RY dR.Srf_[77:hgg#[Uk ެخnʅVT+!Fgc QG%Y :€j1gS"$E:(`{;qqY a 9\ӈXq/]m1ah1[8*'ldF B$G*-׉سV7i:vM }MmN+n UE!Tǥ1Py >KPnu}^ގ.预’,ȪբHSƳBj3`p֨< `u2S@khl-1vaN*d {?W]^r$E#x; W\[/wUueRbl޲ʬZn3WX 5`ۤdEY6 *.$(%-w!mha [ m_?g&B((,Ĕb0$QAbsidu;N f$$ȓ5oyi,+ {[,*q{ݮhw8j[[ԡү 7 wc\qfHj1VEd)V!sb* ε_k?g[m ⓭e؂NM)c ;Tu_ú3vw6Y`LKi , K! p6z{^΋r[@`tL`O㜚ٻF)2J Q)b(@PE%0ar^'~&9ކh H"֬|Vg#ݣrIgo`ÀboRĦ&wC r (v~6>TtM7`CE켨Ԡsܽ|KD 4pZ7W*uIḽ3fo:\w  aXz EيR@ADBPTJ \]D4cmΩ1W"$j)=țQX5ID]Qp!(z̈Θ ARFoOJru8!\gQfLY-5Q@Q$N?wA88)2DJPk~0@" Q&A\쉲rsse*ԀL>/ޕ"bsRSUѧpL3D4xz*vMݛ4J6:E@0-+yq 7';N9n9&[4̜ 95V)vZ8dlVt[KP}6|KD7!)T۞r@@n'A. (vf-&,KmаnY㫰WSt! GGHAvjYt!WJ+$% \Hѣ!LZ5ծ\i{S:4)+3]vWǕ@8r[1Fl 8޷*, finQI6hYsׁ~jbeUB( TPm=v˜@K~ppv'%qֵOnCJ(!l|=jXM$šX^cD$9s/wfEmP'm=87F#YyM s4RO2Ix?sV݋OJ?;(dٻ&b]eSxiʽ݈m'_byVmYLi+y^NL=l I !I͙yB=Gzg(W`*w؇Lv^.N  iP dHQ 8^H,2R( cs/ÂEI9Ai 9Mdx2TelIa a^,HmS(d#g]om<tƪNyf)<V”+ +VxΛŷsYth =o9^4TIU )k%sP-WP۱h"Z[˾::9ݽێS+u, dBBAXI]̮{@4'+If$:#ߏJiz3)ؠ[6;V뎅d%"`F`/a,0&CQ MeP@XICe؝Ga3 ;0s[/_ZTKu(f03Ie7BvPrLHXd&e6QZ(4ؖ|iEDA g'ܣ!鈈"eݖAH ǏFPhL9V YYdO^c ʷG@YWL&H=Ǻ.:&}199MLV_RYLB!f_"|7Imz؟q0  _H|h_y!SNڦPjl  Kκ;!/_ՕwqPt6 s.X*opR'ԝQ9`ĤH& QͲ]b7Q55(5c’ 4a e_6HEp"ܸjMqWYHFݥpĄ%ʍ2N[Tj IGhQ{*,RhY)!8(06.[ )L/N)Ɠ/\jfYz8Q444 5@\1Â8V=eu,JGf(}h? D&z'\cI%@ƴtdmNHO5GD~)NS7M ɑS a'N;û+uWu1d[S%\%g { zHd1)7)05M1-Fl KQaxO#G""^ƾ{p!(Eyv))V4)R SDr zƈa$T @@,s>uG|MfH)t\LK2L* +9zstof4vZK W&r晰@Ag:Vݶ 8rWg$U%C^h:PO@ǻM 0:9G4L`؁>2HDZ8:A񲋖.7LbjiKN66RXH6_68B%V@ddR1XAd[q,BC0PTRBR R# |E]DIe&%Ip]RQ8ˊ.)ZX΂_Bj]B, (`uPd, "L:#;.(:r$B`E˽xB2()?oG&@.NN/aGf~[@%K  mܷI| 3f& i :k xD4lS]Hb@O:øR,Y'.sK2e=L)BxUnWD_)NYg%~0Џ&"/H7[5t?:2O$>i@)fU 0Bn馼VmpScBχB:4fHEPa*Pʓm,hljk h "2$0 @!}l5ᫎr)m`hp%՛P\PFZ% U*TJh hBmnNo78:112gUI% _+ZX%u;~fsd(a8Α@?8ȇu81 zR=ȸhp"fFZsvFMmC=ʮN v[d_.ZhAH-]zH͊&(\՟S<;J.lMVB@$@IR_@e<mSG'dU`(]6(Q5?6bI7|,Rxdi~,q*m bV! {FerSQLGy0-l۪F6u`Ʈr1ȁ|S*Ř"af.3DE2< Ɯ;U zlNA"! ߽|wȊB5܊ "rA88['[{|(:n,^BX@rX1lE:$XE$e$tPrHHT_uؖP,1AJ1Hb-kb;}}{p^bP: p!/W)Z4KS E]GWiݮw*]in9*z焥sfWlru9kgq pR$s":;i*qs[NKKXm:VdFqmdz()[x5 ʭZ)b=o~szUmʚW_B;o ~L`p;'I P=:x%U|jֱja)k-BHpvXQ I`; y73!)qZD㵋p.Yxr3vB{f,VSWEPHZ,`HZH:3ȇRQ0?*d@ (mN4b3C8@0ji^J6]uwtnfZ.twk\diQ.H)Ƕif)1 HXn$|ěD8L =}Lz?bbs[X^7`:YE2+rS`cZ^&L:͋?!ǃove:}.Ggtn)BuERg㉌+Xe >CJ@K^>;%#)< 7B$,! @`d#Y5b`Ce%. <^SɜsH#vn}u=b歬b|:[$ItC  2.ri\e8pFfL"ΰw)X{,Sѓ'`(Hro Q_,J6p,"Z> "U,&׆8`|cr;1ȃ]n>A~nDɢ)P"B)FAɀQ2Rbd:TBŰx6S (s qUUP+sWΪ2ħ&MPNVV1ju"/w]o\g&EK5E ƸN\Z Lp@JUST!, ӌE[gzaڂ(eQ)ȃ"Luxܳ%jP  V. sl**B"ZRm]%lZ84L&cw"Tb@מ;uQi;JegER0<&{&8`cad{k.#eJqYR(p$pȪ3nrBP2tEKXB *|mr" Q)s? aF0 iZl^<*B΢he<ɔ@z$!LQ8@L[>u3G ĺ\#a2@D)D(1H@`-jZWBjXV z GB yF^ O$h D&@jG>Hvp= 7Dqvl]7$I$HI$I$I$I$I$I$I$I$m6mmmmmmmcmm6I$I$I$I$I$I$KmmmmmmmmcmmmmmmmmmI$I$I$I$I$I$I$I$I$I$I$I$I$I$IrMI$I$I$ImmmmcmmmmmmmmmmmImmmmm$mmmmmi&IoznA^ ?an>c " (P! Nq5ʦ_Ļ{5wnc[/v?fRԻk=Nj5~p[fqq~̨P^%6-5=hN[a=t_ vyk}Nesv:_]\|R\w:K*Lt3$[E0޳K!hŭe+SKAaiK .RzkC;c.}'joOhz&xCn2=&/ m1PYe\(du)\:e{]uNQQÕ^.QbMHj{/*3_ /_;.)YR>,˾hO^eT5'3;໤VrҶxru`a=ә}}5 >?Qf33M8l10\jψJgYa~3''XtM…{q,tw\v>lEni7ޛOZ:ƈ.ck}Cs _&÷p+^}ί_{dדw̬!dJ]3z{kE|>dN 5Ẳwi6q۸7'zzfk/O{"{tu7n\daݛg [s;zKs56ŔrQN>_ozגY_k v[26ĕ7xҎbl=F۳iwgegy:vpGe,IdH$.$Fn)mͶۛl#1Ʋǵ3Ѿo{dj-={sl=[7ƃ6g6m7ji[ ,/n׷6|Fn mvMbiNoomͩ,=Kk޼ ^W{e̱n{2Ϛǝ|[6f弭#6CKdI"TĴ$BI Prl0S 2IHD&|{cZ'l=.f{mmFgn>{>nɯ67o/Mezѻ9{[k֚ny0Z07W{{o=z\iEdmYͽyڂ:&/;{v,.]]@\`A$  @$$H@"ߧDHBRʚ~-C $"BB@$$ I!$՘ģg( EHHBBBH&MLS^s&s/ rIv.ʩRqϬa M0 S 0I,AHU`R5lHuCKMd`$@fH}fH}I$ى>ʪ!(I%X) ,H53U j&GэȂWj@Dj1 ( 4بfb(LDff0` =x¯*}&+1|m^}uyyR S&;PBC6ɈDE4,QT&&ޤj8L@4.,09 H I=B9TIL v,!$YXlABl! $RH-Q5 0$$@)$H,a $H\HH@%$?_A~ $́D.:.D!$ aM!Z+16Bk dkcm-HX SFSIP3T VhD՘qʱJє*4޽U `nL(`1`fe `( I ! TU$$-\uTսo$T42LvE&ᩆ 32@m %NZ%0Y $'@R#"Dd $Bn)&H,Tr YA[FѱWh!ҙ&˨lL"* lfU\`jl1%fyu6  @*DyԄ$0r.I$0aPH~]$G ,QUD3 }Xv .7W_κ.wW]Z rDđVHzPRE%r mywED(qGprp'T)w'.p]'8]qE'8:rTRpW ' (%GAwW%ȁ@rK'R( (C ! /]Xsu(89:8D蓸 tジ;:*J.N 냣8Dt :;-r)EGAG%rwu|I ( U$e8/IgfJ$eEKOte\d)Ewy{nο (?.(.$q (!.(:..N;8E"A p$"t"tt9 '"NtΈs:B .ŠH"'"NJ;p8w..:QC.rp\98;Y#"1R(hrCӤ ͣ&X8\`!mX0knz"ˢoc8I@QAE^8\s} {]nXe8n,oiq/jʰ!%)4r )&4I# G",S4%ytFPd Va݉5W&T!9A k*00&5RBU,qnU@!L H $$PK M4US=mDR\L, N7 ƪҠ"@% L+ @5:C&kZȪL4F($IbLF$iA̅Tr*B\*BI6̉mB,MP"I$ :Đ/@X %@d`Cd$ \*R\eP+{z*$U XB肌D ‚JdSj KJ)hт KoIEU ZQz͕eVF!\2ʥ\ڐR!dHB ^mB3eh۷pɝ@IC+ʺ{/cLAMfEb&cTfŋ&ޘRNXá4bĹpLJJS K6A(´"!3,j J!q B EY,MIr5F۰eUVOvea=?y!+$@1 d )$Cp$\RLQD" B HsLK@)3)Y$REXH 8#$G8!΀8CJ99tKI.ˬLLL/a$c$PA":89莤G"䎒:+;q~\w p_K:."w@7!R%$Z`ᠽ$)ƄJ`anb  &{Nj$K(äK65 Y U h'usyc9 rJ1 bI,C ?˄:((9s뎈w::'':8H@䐁''*B :NNG.rr;.qH(":rAI;]~K.BY.B* 4 ҢCad$P(db@0voW'+m4ɠJ#IUns+(!X)uAe"nE<΄D`@" g=MV`Ê;ő 0]Z®U\ 5@ւ%YHJHE`P]@@: vp)kQQ/,LHI3tW!TI$AG>4jb@Vz6HaI&FqT}6@ Y @! Ed@ 6̂UMFk 0$ F'RC""52Sa[0&B VA2.@J''" %<-v#ׅ710{ONw$! ,RN$Fs iA9j0 9ס&%EuN]LP6UE2$ H $UY Zm3E f $Ŧn-UV/31R@FC * Bh\DB`L"U&,3R(5P@EHMRTI\*Ia%+0l̢f)%دS)DB" sXA;\",P 4O=MG.^I7.ku{6ӟY"dF2Q$ @E@@3$ BBL $ Hd0-0I/QA`"`Ȱd0dZaRAAEY=%Hbd,˪ `Gx\˄o@.@^[%2K^Ȳ!WUL苫gp]w~U\qu]GQtruBa i)3l@ˠՠئI3 ա 04F 32:(@Y~vpYkM{>믏4HBhަ"΂EVŤ3{)ffJNL/ZvTϕ2_O.&3lX0Q%L9CN$Y!) YDKV}Jp!I2BS$I%*" l+0 (ȚXj K^C5@@B%n$ FADҹFI%EFD@B@JtKLnم̒F#AdFd0e Q;Fa!3?Onw6)Z__/Hߨغ UkHl"(D`g1d$4ٱ /dgD" &G ̤.]Bܻbk ɥlJaIųL,$ge&0XSnM& і5RP”j"3Id$TɁd&bgkTmkXH{-$" (" Qw}}}n>uՔVpm , 0jh5 @2ӅagJ;`1[v>CvܹҦr4\ PT b( /!4:[r|QHBS I&{ *( ZSs4(i6){,4h/)S35Q҉jH2fY(;R,+4D lA;-El4feC e۾1fr+w04˪֗6PM ְ B)"hl( 9T鮓QV43r#VdyaҬ84ڒ7U%0Ҍ"*!;LAB0Ep11L)0]@RKCX( 5Lg`EdF?QIjtK(FmZˊ3$\frʳͨ<5xU\6)H.0L;cE@H$Vt0$w>_ykioqפH$*vVE cL2Ԅ3j J@8J ,``D"T@z *,z|Wf @0:$ 4T*ZM1Y2U!I,ñ5H 4V@H3Fd4(AM62K7L:J fh%EhՒf g³ v)X@322^XIXAu$:LE$a2 ZVmQQLl !D,[ll̥hL3r kLD-E$af$)(02!N!$mB4 VZ @eP1ha2CkK2` DQ[ɥc-\Q_Xr,PVzHma!e$ DBf]:6"sFр 46E䶂)[FH#UMJa b%haE: ȐlhѮh !6%4|l|/WY<[l$DBDUSiane `,ȡa/K㾽mvM"QA]1ڐadH\]u^]|봠 Z$>CI3vjn4@BIFB &#b(.pNQHDsIu#GyD.9;(H:98D AYpq'* run=:Fo+:{}l_{9ʊ !S w rRNJIΓԒ "NG%D9rE㢓I"Kt%9A5whY =pb3M`Q3MƒAVB}9p[N_6=IyZ>>/{޼6R&Ph a! L $"&HZ2a` y nl, jԊӢ" 03f`̥5& L "X ѾqFn 3<|W7|v~>vn"7|]v_u{uwE;>:˻;|zC(``V ,돍^_Yi{n$žHad DdB( ERFJ$I@0dY9!J(sF3PI" Z(@mBi rIM\CnjFbkc"Q[@ץ?ED I-W._q|^A|>RȱVnrxsfIɞce -[3$%`RRNK$Rɳadђ,Lpd0d#F n`eֹ  -]1FE҃"z^-j0]z$a#yGa*F "\6L0Ң6B HF.%D\$٤IXhŝ0i:DP LKRIH[ AA(SM&`0IBC T0Hh6-D4T`8!2Su*E%,QL5St0,-gc &3MA(@䚨C$t 6h %(R4Q\,B eEE$$75&<̵VYDe^ٲ,=}4mjs實 K$ JE,(0ȩQQ& mjE! ̸[v2)%"BB$!d* (0*IAb#j |]}}xYZ} I,Цf1k(@FZHD,h%kAC rJEUF:tVV^9 myP7hf(ZNKI`)3-1M42!R $) W!}dQ$M6H غXASE$l@ҵkn lߔ{[}\Ovgg2t",f@b dFecSl-TRP̴ˆL֌BffBEDzߗ}>YC@MTՕ8I XQb&dHf M Aŗ(Y$a(LR&QJQnڢm֫;>mb&]e_b72KA$Eu,@SL(iί娎)$((dC٢F&0,b PH1F VM l+%R@ %1F1dHAA%!Y?h??1k>-ONeYtM($ 40:R4bL 0 A=?7R $UB25"m{ެU)De2 6H3P~4D$<1OԬ'o3&oKf 犺_M?ӌCܷ-|s}~H`ԀThVSdm\]e 1C;ۯ\_v^&!Ж`؃(  K,0Օ6lȧf1b 2R`*l`",QY& L-6h6RId:P]Sdms.H|*޴w^}%r.N9!89ӓ$J@$!\: H)N)prG q$䔹;% Ir: t%8N+N.4pQQd+ðcCpTcq9 L+K0[\%ٕ 47PFS{o8N:\T6&r%Lb Qisybm.l\sʹ8 {xl) t`Al C0bd,ΪDIJQt ,4Fԥ5UA (Q!5S7Ϟ*ڀd)NepefK5X2r20<4d) L<[/+lHXD׵&%ԣFcm R5`2&iЦH Fh!,̴T\ U uM:%.(RC#ClJ!jP ca{E *52! D!0 )˂*KbHe Bn"ZHAN)(H1oJ8pK͐zU@2eQi-e(,µ36p-J &*(0!2aA2)Y%FiK$QԵXMD٘c2HEA0!,yv"p'I/)}4jpzA]YE@$ B719D JB$inw^gIe_[}>/>y 8hB} Yܮ%}訹$⃮.BN($. CH "sp˜;" 9;wsNRtTtEw%w/+JAKnұeU#d;ja I,X`h[;BBa$BK T3&+΍f828X["`di!!KGJ "*s{g2•Mc(f#1ш Ndębd7-2܇"1 ]ʂiaT 28hˆ P 6$I@HPLIT(Ta!RF Dd2LD$d*630D. u10aYLC9Rѩ`IBfUgUKlҊ0`\ˑ.>U6KUUdkFfC-I6&,,̓Jɖ  )A0$`" ɉ5))4QIPJ2T EɴaFs \z!IBBA 8H TjhlKK行 *Ee&pQ}D'nB2qotl[KZ0L}ᾂlQ0&&VĆڗ&$*֬j2QFlNdmQ52Ab̢&bDv^fh\\RPG+>jY&b!z҂&N롢`b2 pf/βgĆ T7=S4RmT mKH ʍI,^DĩD){*3ӵXc2,M ԃع[2 8m,_E/e4X\6pB8bI*M!RHHP0$F0RI .I 6$) BM<qjӾcIaL7@]d3f:ĵ %$Xzع II!02{.AΩD,ɫUuT-@.TږnÑAT\jL)l+7$$%ЖBbɵ6j #b!ήki 2 ZYve-!UT/nЦaRdI!aeC5YDݤ0b6)C&ӭUʱqjn6x9rfg6U[槌 `| k7_e5}V}mF 1mvuR(Q!Ct6>5;+8K|_ex~yd)Vۮ %UVMW˭ӧ~^ϯ{޷m{$ɵ-n2ֲ̇=Z/;ɗk{׽{mϏ{nfk53mMmfVwԖ6;72lv[u"Ϟf{{_7i|,<=+ׯ:{ezvvڷv+ 6 qnˇ\n#W=oN^Y{vؗmmɬ׹bFmml^{[mFֵfKb3li3l4V|{fٲmimٹi^g{coz;M+{wn|&I{nrٛ{zOzNokēȶflb218eyZ͎|[>|_<,;>{|zv=7f'Vw6Lm^o[9+6͟5kJ)^=mMk2Y-˺w.v^-hoW˺;c#`dB ں;r˩t# 1dJ( Ȁȁ! Ґ 1X<! @:sW~vs:+{n:rwN֫[wZ\W.HD"D@B$G+@ - ˿ehu.W\W ŭ(yפLgjxOx*{ܿ˿LJx޷Au4AT~ ?ה'ۢwT9^_w}a}{ ]ᨩ"7KQ _(4½9:)%Af%,*Z}[xˎKJ}y`EtP g>:7٢!Ɖ,̯Ukldg.֋E햰lP`o؜ϙ|s<-fgx]0f}Ƈz.o{a~t}|ƍ^i\NlhN$FI#5Tg%vS|΄`K]FD-7)`xԞǑ@oYx(zZYWlq$oh ިZo>bd$5Le$By_l" e];9=m{?{_d Kuq.{^H.yky>S;'F_nv~]>;/'^!>)f+;`V1~_ ϯ|SՔutOdN-IOGssY>el+g>68moz)|W9`ϒpqsܞu6S(;(}^+a?v5Nϭ[r;Šy 7\wXs";6HJ +iE. }֯2pRIh;ZdTI 0_3^QF 44QkikÔЧR9I=7@s3 [\qd͕ؔ_Q "h6# [6.r +ƨ0@ VGzb$`ۧwbn6$ޢ-LC]`e Ƥ..1t ;lti!LGKr~(R,T 4C]'WJsyG3V~#?RYLQb @S'.D9$bXn\]N~37%We8?JqoC:^qg4h3ua#v&~oq:Bf$mv39}ڨ{&/0X 7DLi,xgju xAsDŁY#|+٬͛M(po7J =QROOnÛ+gzYI~ƚvj[Sx?ﭵ C"kGGu^&o4 ڑo.{YV8~I9'Pl]h2f\LTA$ PU"3lsbwǹ܎^woVEWb\uAېNtYtGӫ?)}nRo~7;"5)IÝ_ɭI֊r$HPrw~>_xq *H*^6Tl/rW~ӸwNUiܮS]c螔jm畉.!$5{Yϙ Ӣ_b* o'挒Y '+$qٺ%.]ğ{H$YPs{C+Mz򞼹> H!Z L|"Ȝ}M##sMSlOyqqM$W+ dF ?dE9 څ`B@{!f:l/_,搌f˔|}z.)$16Z@V4q_&@> P^Ҡ ` Hi>Y g{$;8s/|ܜBh$0 r8C2cióc~ck71\osZgڒSnA pKpZZ1p~= sky3DP(\"lF'aH#vfZ2?:"I@4;^Ƹ$RMBqVsvrM]C@: C={NJ]3~.<xzߞm>?w8^7=_olsax0o}ky77No[v:#Ŷ>w>{=濪91t/Vv0^B3μj&]eUbpiVY\|M)9>I<UStj\[[;JoM3M'rҵ뗷?NZ ֬n3Na X;M.Bō_9'c!trzuNGt㨎8ɩsOɯ{};9duU#ʮѯ*Xr_!OZMgf|jE93pՌXLͿ@{3x"D*J:ubQmHSkZ6vgQsQ9Q98wu&]{+mrR]i$ԝ.T\nr$ NI '-r9Q(s]e;O`i&(˰![vW'ww6?y]T-%4&gf`xئLL#E)$! PA@eى ?!d.yA^ѺR ta:Lb3@1`V:j( $[.kٻpEΠ9˝mV'8rYEN]j\RJ\;Bq8,:sۜTw ]w*R븺] uGrutW_Vx;*̐Z"*2##$/FTaI$dDŽAJ@X=~ ۼł]MsnӺ$9zݻm޽P.IwnDwZ^{>_U|W$?B@{wD<.v/tUqQ\7첪5ǘJѠNVf쪹 =fPRl3W\j?-<&iQp=+?"/@`mr納uEQ{)}rZ^[N};qJ槅Oy?OQ=+W,mwv)ܟև0o0D8<8U9ZM'_o+՟=VOxsRH_oƥ8]aPdQZWo7HM?ISwIk~_)Cz<2YAb}nR%cMQS5^;҅tsIl<$/wuϧv 5;88܆\Qm-/l v糤g$=?琐 R,HON$`HIҰ^V$1We~6[z $z6/!E gxl&I&ń 0 r @HB@:=}III! H@]}p3go,{͋@?W.@#W>D\MJtYә95yt4u2dN~  W^2#O!}vCKl?mM b$Ca$$IHHBr̒@O@$9Ƅ ,!sE! 2HS@@ @!rNgBBY 0HL, ~O  |}?7C&gŧek{s1K>;۠zy`a=ݯ}l ն&8z'lIi$N]  I$!, y ;Đ,BH\I :&dIJd ̒K88  $'I0@1$bd{ܝHzOAX{^ 0e1x!E>1\1'#weWWCAgtD%]ػ_ͥOG/૬{U3*ŝ>L_=i-54w]~kd:b=_2W;K1'(P!6$ :?ԟ?ߥz '2i!%+k QZ>6e]v`1 -c 3"O/Y-^hz<1|ktoo0Ir ,+bo¡ÞZU0t/gTۙkrbUKZ8]6Cщ>C^gaK9R7WH,SJO\ffZX~j;jw&ֶV<;5Y/}Ѕkt]=M '8yqzJ P~TO6i#MW󷭼64'6>'2~YfI澴׹z$ŔsJ, i4a"dVq(Ӱ62bUyaa]?L05QOo&z+@9 C$qeL?}ڿs>$k%oI30J>'}5x>GL"b@Hu]3bh6{?w;3ccl0#1Q&rlq(}i>C?E)KA& Qv;t@_GY,4h^}i-v N Qj72[%gX]t`ϓʐ4D<4R{7%ԲAsÝ2ágsIJ7,>LN_28*Sdh57#' POA7#U+oO_ɺxm ?{ש/<̌0yP&#Ћ?5t^H'QqG C$V,BPme6U3x=AOu<칼|#Izn7YMp0{J/dZn 6 Igq?ib"5tؤh?a+nƎ,f~Gfzv^wt^/yiJ?jqi-ﭿ_4F?rt=cwݝ04}N c^x{<*ϫdZ?O˨?\Ƈ|3wռk[O^{?o/?y?~q?/Ox>˩x}}c?o}<ߧ}~>4\;?pIqFj'$mU/3Ojֲ1x0{_xđju2ǯ1v(A4q`uTSя0m{?{g^kzyX޲RPj9(yOoU"0r?zغCdYYRI36 '`rۤE>v ~'gOoo;$ mO%6zl"!iԴ ?ꟖCɈw"^,LʭW]v9VO29McRc쳯I a?-3|={0 =Ω8L!͛ )|y`aaaCh2 !).B8 {49DaD$ N-$u!zIyw0R/^BI,@"@ ]:e&.-u[,^#SFXl {yZBHBRHq!I$ܰ@'?@ @SbQ{ON/ۺIi͊0_{8.K'Ki?W/?~$!>:BHv @$v$a$Q $ XS!Lg@YCd1%H,AdbJd}+cRLP@BAd R[`q=1$0`yS>טl!y  ?ϛ[nk݈$A[u$7li_fjqkCUYb?N,<6G{U+ax%VfV4xO;Q}}cن5nntwp1l#=o5)OW95)^'V_-k?=TS츛G=QŎ6Zy}${k^i_v~3٪W}8HG,YOB$h薓5mC} ՜|l.'g%ƶc/}GI9/:p*4 ~.2h@&eH !/􎆢T |;\ЫK~Jo4i@@! {ل O$r\<'߻CM7 ?{뙲mAO(d_#3N 9+VVT(Je$ڳA4x cW(>bw4ΧGΦU oʛl՝}qzDDEh*M51'-T9-rӍgռX]jx|nջ^'+iٲ+"vTo,]5GIٲykDbYF*;eqL.:_?Rhǚc;= fɢɎ#ٻ a@e;&@ " "D kt&!m&BNeHXzݤkPȈF'!`$*08E}I/3]^ r8^"gonJ}tLra~5;2MI(Kx/Msc'l% *D@+ Y IN K: ;#,J#$4v9.$FB"Ea{HK C+o./AF$cBJA ěIQ0#olzYXHLQ6}BYD#H1q̕o%ч:>w]$H$듻ˮr"B dHk5x\3m67uy!<# 6B"#FC{= 0kֈLk;b3rruEhec)NjQ';om!aI'<)DĀX#$r.ˮ2AuJ@B,"I]]rUwE]q\ $ aHH$.a*0"]ܝtrwrur]Iu9"@X$$ @++J쮐DaH 2wtwQGTI]ISRuNWN]G]%tՑ(I#$,FHAd,3mϕY6 ?f7-]'?=s/-\@ ަ%^c|., FB?5"2KzVJ P+I'~ ,I(a2g\}.ʯ+: "Ddߡ*B'I Iu<$R"I2Y$"z|G}7~yoID 6MC1ҰI}?q!M z~:Ͷ;rB%L _MN˸"T7K.Y2OG ?OZʏ9+֮mG^kT|g.48k4}Jג0No:9m$g ~tIWLH6YII}W:wJT%:*<[W:f5# kBN{^s[\ܓqvӛ\ֿT^&|(K3$I]l˅ .ɝFTݪ&ZJAU ]_i7kz>Wc=u?[{ 9`ILRE$+$'BBvhmb$'+ >oě<qр`6Mz..k˯Eǣѽaha/ .h3e-[|^@0uU$ 0=["|*m'Ds ~CU2SP[Dt1Q@HBe'^Bg-8bZFsb5;]3@BAֆVsk^*Z4c=?#!ұ3.LD**/֮:."F *kT)͙vdlk v}/_1L I톋ZǦx= l+lQh_C\Z2[9eFm$Px| O$'['}96M?J3o[pKX{sj*R~aRYmϲo*vm—|! &}Y!Nz$ bڧkE(w/±ȗnhz RD<$/Mymhe0a@dqTA BjLDTH"F2!T $uT "@ # *$'yz{,SڦEPk{|7)+X`N ŌU!Dd.goݦyC)Y& v?K`Hw#bTXrew gER]]v*y Wm XԱ՚D妸vvO-g{Oe*`b%7-Ha}T^Ӝ9ðdl>σ8|^Rkr'sgqEy,rS~'7$3˩:ˏvh1fVueT6]GV n("49oU+À%ϸjD1Nt#!H%cCA'nHψ=%SAZ(0YfdLxwasvÀh]O=n+on|[:H ˠ^kf yFYH2l+>B?ƸpZr[}iNkҒ`D%P' { HG+VDLV~{.XLZe1ʽbmy"?;&MWS;"/10ǩ7~r|궵z]/!|KuxϾw[PiqV.g `P]TwGCjvoE:ԂwDWxPZ8W=00wcW^.}XF,#OG>T_Mx8r/z_nVC/pu~!$77шXi90!24%Lf?S{B~z(I }%\Hfq5-oXo r-n'񿵬\}h .VЇ!nS~)'c{B9 eY(ȣGʡ6_П>j@ 1J@)@P$$ RB xw]y}X=^!7Њ}yv׿;xNJ1EaöM47<*$@ 2Ny1ʤId:w);fv)lp HAR=>'X2 98|$V$`$?ob&ZlD_ d Hjz9?ey`2?$ !^=I{!A1n-1s 2M747rx:Je\ΉñQG< ¾n~݄:?vm_bL<ԷHdı=|Y)gNL1|@, ۍDŽpx|#//_&?JLy2(̡:?y8֐ f@C2@.@w:Kэsey>h8Va/R5CJΣ禊nb&*#Qv,w[f ;b|t'4I2J@:s)uTN_@2t BΟ,yl@Iw$^s.H, |Ŵ-P|7+_?M#Kn^` BD("͝U=^賽O˾Dc Pl_}>[G/Z~P (C56`vz ͉d; !Y8M/t5޿лӐ{9F.?r;>!B$쒈gxѭQ1.Cex}^oO؏T[Uuj56OA?1_Gַa6g;Icr[ HS@ NVJT'E7m.)v{Ej>DG{OIxlgMR/7v;"-\GP ՟|wۨ8^}7"e {E~OTkS6gen}$[;BEz=\7r6Լ[h04?tz\:vZu-o=2Z Rit.|bTC,Uhu|u'_}T nsTcLUQ6os`: .ynq=sv]P~5_o#`Qܛ'LQuFB };>BAԴJ]VIJ`; #CP<& `~BW1!8 hDlF<,\ 0p@I-*g{?s T Liǐ"$ 2Щ[ZmfNnZ?bo:7ūX.|8jwtba#|g.sywki뉲v [+ULGjuzڳRup3j5kulv[nv:|wn@B a89 }%7iev:2 ˕3a!}%,7[TxR۶WV,9~_nTڣ/S8-N*w_˔scZsDi95 PAH$w,IeF1;u6 RDP7͘o[/pXo3o+uй¥Ȱ̱`ri<殫9K>yԙQ ̨鹏Cpf` X!F ( !u>_1q2xZx6YΈ#!W[3N܏v>c40We x:L/S!2pKS,ױ-z}3՘=6ϯoManFYcF7jΫc oQ$4Q&w6ȕO7Ϙ%XSqX*G0%nA$6@8 hRrs&rzegtwJ-I9)Iړ%H Ɂ)wPg:JO3q< 4&G*zaw;`vyсS4Y` 8O?,WK'DPC{3>mQ77 ֠ʿ7 S Lz FOHygW2u >KBpn֮b/V[dz"]8J{ʴ2y[:R<'<<١R=ΰmA-(coD@ab@1 ,;= 'Cn͵vh\b~۫E--t y6S{Gj xknS%W6qru;}x'_A7n{ru?]xrbcǞOE.MT}/ 0Δb60ȷf_>#& L@!h'0!w=눅gWw&c\$Hu`N r~o; 'YNu8̏E oE;ӅP !K)~DZZ+屍_q1>;֗_2+cTr}+~lO6Qkus:rf٠˾UUgS@! x0$SEHu2 B!+ս܎7Mܶ8t@=o|G(DZok-[y3Jg?Ϗ;ݿWt[v]lX$ Zy4U<חʠ1ͥLoK!vQ$Ğ_y)*{Qx'?"_1۟Rd.>깿Q0-U5%dkix^NAK}n3˙7uAO[^.O2-w%2s%!C Oꙷ+;3Ql IeV ΛZ!X+& z| * 6j ~2M06t/j{]ȁ5E4lӶ?蒦ި̈́)T3p42'^ vgW0G׭hgDgiI J/?ݺ#x2?gI2Gh607UJQiO{zzr?'}/XG0Πf`ƋaT -FǒUh?Y𷪹7p6=K]mn~δl¸$0An7XFfs&Nj8J?}sZ ~Bm'FUmBîYzɏwhդqfgz1K<.)P,,( q*s7å Tx cEsp;XKe|8 si>>R|hjgƫj-73ԫ46U0'nTԌhuJ׋FO탨pb9|FŏUYȀ lk1OJeҘeי%=qaa+7L}q3ᡌhCG-6 doSxq±~Da T>|BZVߜWCo?Õ5ȹ'w3*wgC''9!HBw{@:.'/}0?q@"`Ε]Lg؞U]D!BOGs_/ہ'N\v2]~>IRw 2*ъ3D퓃oD=H+hFmUO>Suc,\* w(u3?X;J^^*PR^"Znk'āRO/"~SF P_zdnrqK!5~{] gI)M10#*U0IxNܾ/TVzb_GIfGQEdwêGMmORpޞ|'~=yBbXfI;74fuʓm 8")bkdOꞬx^$; IW* c!RpgSO}357=Vާ /ڹ ,vpP;2pv h( qN~s*EW{ݾslF4m! k&Ww~]BR:uՋQl^=111aݫFޜن߯c{[MPm787lg)i'UHN&L! '̸}BAIADzԊ'a"2>5-; }OSuGT޲*]E@*2:̨Qb& K#S_Ri(拪26EqZ~fey_&g.yIjBڕd">|cIJji t&@DAܲJ(N^7rGam8o[l8'ƍ G4*cYQ];ŪyEf`R"EjqIG?!\w_8ʊDK/[o.weR9$0!@Y~z>wm>wQ9P@p`4Wz&W^Ïɗ(5܍Wl55vZ]eגMHEQXP-@NFg'WstTNaC%ʱSuE]T5R)5]`-z +ޖy%qrU\ B!jj šK7Gzt:jԿI B9_JNE M@J/OJ J:H`~hE^Y$G$k4Y|$څ0S7~NX]ul>,(A :S-懲#~}PJ$3n@ Y3ׇB2(Ϟ3-g?o|$A|gjO>kYoA YC2?w͵H"I !y@_^<} ^#>G~@~B||XϟH$Hqe~?䅫pa.]oܑf!8%(D88Z:,W_ }/@$Z $F!g|4rN 8VC XS}BlpW!ڷ=q[9)RCXt!ߞu6\ΜI(9l{>|)N|.{z 8rT ,..2dm C"5D_ {>Tǽ)`M0DD?%VB8'NOZ{:t3qgTr>m@C~Q4 ТcF"0m~35_pe@<4yO3ϡVcX*-3 ʃ%Q$M9<@< i a؈kUx"DHe2 s͟34L4hRsfV5vmvlwqF4h~_Gz{UeJ ďP%^YE""of:2,x9s'ϛ4G_N" z(̀%s*@A8|Rh T_SU6hA8U!t6ؼi^R+o(PT-^Ogvrp<n '̐a¦tA݌9ࣆcKւqS%cxݿP!  oi:z, 2xփa-L[yxU퀒tT;m Qpd p0 Gm+}[C* GkATRvXJ~7E9՞`kC#Dbb'׋f𑫑yN*ʟO] e]YŠT%C<][^NF7" 1VVJKHiK"?b2km hu=3its>fn-,3ʝ_oĊH꧘"@=QP2S6uW7b_:۵*0j= mq*sfaI1Q Nzn4d)ϧdMpkso@M^UGI۶4Z~OU4 5|mb{ؠZ`aa0 O^߅;y{*#r3#mftE䁙 )c*X49'@!7+& st0jCo @1a&/@[;8$Hp7~D^M#ذXEʘ2bg>].: l=](ŷ+j)]OI 溱Ƹ0$eVrr`9C@ -gwo|~_N&Ҍ -L?KGIV݇qbŏ/\=T펿7lCp¹>nNSruU{Ͻ2U67[̰"AK"52j$#@t/ӓ+'\CB}kڤtŖ%R8}n&Ȭ L0{vYe-ף.qx uϋ}7ZU~l,z*, 61>`"?2hrsZ78xqaeTW'v շ)XgT9Yf38ǔ*LJdLLʙDgOuTW'cTcbݲyu Oq=3CGGHH~%n \0!1MȉAGf0&}y(T= *#i{?1HT<ٶĩD8aɿ&bx7hgISշk?I='w 7pwz!I[HN^KU9p=:L䎮.. z#vHC 3:/a%u Ok|."T2 (䒚Wj%@UNHc*Yw'!haP*/6)x/0qhvy_*-ɝykWm @͞{wSg+j2 L^w H &2 t!'ֱ%|#ΪӂrߜAceZSrl0*%bR/OAoX?^%TWVv\9z|b0p)ff"[掶.-.q.:+D.2p2R#CDW.bX]-'ZpX ]Y$'h$:﻾ܰ}ݿڋ~?>܇9~y󼟹 ՕS^wKYQ֠YMS'pcLj~&kX0ݷϬ}Nm2?~x_']-5$H/ ZP,9+E•)ˏя6:W^}~7i8)׳LA\/KAlUAgVaXP@g!;9Cwns^ʭ[Z);uZnϚ9'wTKӧ9 qU0z'.z,cx(e޼q"dI9T y}^/_+pdx):~mZo]رa˘&W/~pUBDԦ1:):4teP UQ@uXRP,QDav3{+/c4u:v۝8jܺZG#=2-m/Ā?*%_Ro;h}wc3!YYT&!ڪآ1v[_.,,x+ r!h&uXog(idB@aϔFj U#s/2xP?'@9>Tyu=B>0mbigY籱M@So1լ뮺\Yʈmҷ;[cF4h"{1Ʒ҈͌K?]4y'4wkawL,%^% AQ}Ґ'Q$Sfr; iiͦ֔)iBƖ6\)SH70Za!MbRzNeZ[ÍpoonkhfUZ~mmmmmmmoάl 3on'gm'!]d֞ۗ!W, /7KF1GF:CE0/A!us̮.....-kkkm\cHWA Hiayged`vb,,R29/5dNt=bR|&C ŁM;BBBB5$$z `rd76Yc yy޵rdɓLaQXZҚeI]ikAIHѪ=[jZ,,|ӏ֭yIeuupSWW8S=qW])A~}v %% RXR҅% R JG@G6אtxQ&)0O,`k9>>Cؠd92  닕 ʚ4 $rHddHF%2um[ ![fKߟZkXZ7:֊eh5uuu}׎x5lB3>>mh^(#K>A@y^C)u Ghlx)1BN! P<`_[fA9 v SQujŹ[;X ?b&g啕E^(VV\IΊ1?SXՄ%UU`ZZZY*PppnvuM0OS)YX"ՎJ˫dk *SUUU@~ NCDf"bb&'\cBz5B~=̖|ø6Ϳd^qvvq_RhLmf&#Q,z Tyyyxmmst^v30pH"@F{ٿ,|IA$s_^~ԟJзpiZ5U JEU4To&K4SIIwKH˜::QvRnD, GJ %%,g`>?Cz+Qs!!_ s$.mU W#D{Tok@}c`P62 dQ)gzq?C'[찢ޫ|A+^jo/kߏɺ!ni/',mFM$w)/Ͽ91POg4Iʠ8NZ'W/08f^wxZ-zu|-sURxi91=JCa!e<0VP9Qv}z#wBɿ* Ka=Ƅ:$:U.R/HFb;znc%rCdY,WSgUNI뤩q@Z|s,$t7jRH1 ]v DC;<9WknnCk)B%qeahN=bqGvaK8H DaLW] ~ab_+}SAWOg7 -8癠$&ݓvbkpi`?01v?h4Y9L$}$f-oYS&K$mou@3?N H| c-@>@!x#A'Fs0Yg;}S~'yZ]0x'kCH!` $ {! $@@?Q;NO+roK(u~ٰN :lDR}$: ,v9o]4M(Ot,5Z!@%q #V)$㵨7t9I !&I @IrME< /3[l A \Jte<]?_3p X b @k4mt܍Tvmk©^8 9-yku:炧"4A_yCGUqdc_2LNL䔐I?+LdHi90e 0 0L^iWSQo;{uY<y&/E~ i+OnXvn,wrrz~*c{uV\UuQر`Qp~ B<##<#Ə/^P݊VOOH1]HR,E6wK@FqgX.u<ȵ<_E_frOxp@wB!d!ֆp-Kzl4]YtߧYSnxEEp<"h*\Z6w'ϊrj0C 8W"NPCzaY"-Xx3,+ד4= ;w  n 4H8d$xoGi"5"kif^_:4)eC*RŚ#X΁əݙ#2Ӡ5ѴYֲ͕!٭qޢxGlxG@aG(! @azݾ=Q}oR?&="Mս.DzѼ48{ -΢Nwgis7|.]"E #UuWqתx$-gu&wa$@t$$$4AHi) @ /! Ė]gGQdݣ7J\eutְ߯_=\J&zyfx$4[34fWz \G{   ,`/B0ȍ"!"A;p:I= 2Y0:g ̌kc=ɇ÷w%#&^[sR@ q7N!7?>̔,OiPQU*R>C>HH@ 7Q!(̢V6Q6U%3FWg[-,gunZdG}q!qp(t^(Y?|^sIlǶk/D@l84X"$"B&$"WƉ;73іn5"&T5ɓF,8wm#+Q]8lQK+>}qjrnbD-n(lWU`!݁!BfP|.Nk{%-rmnCېxWzI'Er++#Me'o +0OOd B̴LA* hy(/.\%\AH"Y߅$msxixirŹbZa#G+\Z:*R<ド@I[X8d#d!LZ9)y,{Rf"B("iX{","Ƌ\GF*[_c *jN7z&}v'C!!+5~Rlؘ_^]3Uia64@P P M2 11uuL;;wޕ̿)jZ}VIAUS)+vl4snf4؝.:G%[yahvHEaapQe󔬸 ?6 3LhE^t#><#B<#\_;l$c/.Xby$d3t{tx\m#yv|NJ=wf^Y^ob2YE#B8FɏTA#_AB4hDP8xVŢV(NLj p7 }*/y!A-ɻ:+{m얀f9.:*Otq[S9G$2CfɰQ윊.x m22zڒګmnnjH>,nS8BB)a&%y/>gZmdn_׻uUn&R<<`yJ73(),xdȻ:_67;mW0n;Q^LGE;ޭoow& mމW 6FKZ%=] ^y`? "|1<qY l&di}Gf8-|Mw5ͯB9Jdi3%)ƫ9):.TU5 0bw]~eE4E[%Y c7̞k:䗈{>_gZso|fHR}Q׶LnUUK8GPP#tn%Pdؖ[dOKעnpއ.i{݂S O- ykn˺u.l8yftu2*,Y v24UʯZi?e<#6RU*^\kz/O_Xi{rws~ 7- )|n47ow"D/w5psrÍ@ fJ&ď@K)E& fB_dHKi6`H'TpW+,2 l ^?٪ roz58hԫgeNԟv^sթ1mnT o! H|A pH$]^7[<1$#߱:6 Ss4C?#CTDADS?ߝ^c6_T1|s>g|pAh@ %GO{ucڇ~^b.|igEuR|x~[O>9oKYlx/_  [nI~ۻ-fSL˶mc-eolk<3˿pnvE^o^();//y^" ;/L' s&$:I=QMF V|<ܸ? x(femwKu8^~ܠl_qcogn]P{*5TLA"](ɞs #MG{eA xPw"J(}s_ΞQ :Ne$ Ñ *0Ŕ8xgS]9f2;^3,^ϙ=X_(.ɈAeᨙuvwHJ[bb 4 KWM?@WIA;Hru:@!a9[5hJ#-j_jL#M F?/lA?Loc98ngK)ߒ<ƼSԡahoQ?}lo~W}7FY 4 ?u86:H$_h(;zt^-ӝPi~} Sb6'Ƈ ?V}|vEn|8'SMyLLr}&ytf}3PҜ_MĄA>];4B^Ε@@n3'WLz=~T8/w&ZEKhy?Ϸ$ztLJñb 1QK;>Uj!%@@?d>rs&OiS鹍s_+\?=؞}\j#[ F[2Ž1i@#AJW-őJ"Yinuq_Ki븺|w-"( |HbMQ# 4$8T+6}\0~|q&@3w!K#/[ᦘ&1;)}>} ^ȆD._˺\>7Iѩ |]{<3uI;Dh$86\cx[)H.K}?;o(VQ1Z=6vtFGsKr#m~ڌoq,H t_q.9S&7r/*] oTNЀGN(TsP4!2Ԫ3mn$Y|K>Vl;ǾS_pƏ㊄l$1Gkbѳh¥!D/TL a SPX<]ޏ4pQ!sqTnԝSB HV1ϝ\5ϻ 36 }Lve;$?*u9+`"ЄX?fTzz,Vא) a*]1K+v9i.(T--:f qx)%'omG ̠f@!*ǩ:l [}~D[M_}id ϱbrঋq9PeayoDPY[s^zq_#y}|gLgR)%$}Hyb??p.P 4PO/ , 5 i$)c!bx1 cw~C?-ReɫsvogƖ1GU}Bߑ벇Vm|Cin|me]?sдP>/Tf]Q"n*r Mk-).g9t2$3]Wl}f~ӝaR$ QCkjo7~sn=9l5}׍,XQ` $X 蒤~]S`/!C P?!`!]{.bKKڏ6sڴ*$iN՟\gm{Wmm6=qdPC^#ao%AaAl)=$R$Dz=C/"B:KĠA"6b=IS+Cھedŧۜ" @ nK%V>C9O\yTls3\ f8]VXK+58~keu݇E|SAo(rZ3 cx@8.u{Q{_nʏY@}6ǃX_bI$e/'~\ E|cCDFh&d%L-:Ƥ=PEM埤sxHfGL *9e% g,s/3MFR  ̰j=ƎZ熅҈HL" :Ԃq&WR1,3?-<2Zpc=K*xl?ɶaW/`aRrܻOLO9rydSWjuy+!׭,ǎC(HOk)SQ9#T}ц10BmfU?rH(@flͿ9wKE,$rAN\pS>>z5_AzDZw6˕=nTT^@,Iͦm/QW:Gar)ͭiL񼙘|ˁZW c<\ Vȁ$- 3(2 lƱ |"K0/a*D "pȱ Dd]4!͓!DEl }/l u$%DF7,=ߙ HvqVɛ5R0`Qv*z HuG:U &Bx7 #K.aqt {HUTF+biUh[C$ULݿ8%giXh<+b٩"W>!w;e\)i٤[7us)+ xFҐ~dt7s;K!j%Q5;0S, }%?L8zm4>fy"a $&6ɶg3E F}BjdE8 Y Q*¹ {9RCezftMuh\@ְ[m`| j?S~bbLBc2L@+؊yS&ܹ"(*04|fJ dSFT@ Ǟ`^ߴbp7Nfno$vhDFY_ w80=8cVB]TH gh٫~@k+GSD"!lh͜&ȨC;(/>@ »Sozu3 Š Кq1z!K߯Կ~96ʺc- 2xOn /7dNXa 8otxt8~R$!qt${J$iݗS7~tOc|/'>.vi0$,4%)Ф5RdH k'~WzމCGw}"٢Eޮ2MM=M?V^=nVCSlIbRN;gt$XY/k}z&t'BɀNe D uS([x{Ni\d(rK6DkW{M3O̍|k?&mJ#+8Xɦh2';a?)%uLH>*fD򖹑OWS~n:q[)9jsk)ݑp'"(!U:{[g?܀wU p-aﻙIP$b(%&{F2'<Ŧ|{6oQo~l>S[]lm$?TCD}1E̟GU!"j鿆9z<ųm-b51QN@Xp=eVyڱZ",xZ$N>mRjk_[e s%2bGN=3zs?R9ܶ V3s9N,ȿ_hx|jz!RLI&dbMn}KXrʰYr̦[ʱ? !_-#xAM_=ݺ\ԟX5Ҕ .~揢Ke kLzN&h@b:HG|Sxx}4^]%!e UbZy`1j^< 0TNF2QCm16?4Rqr@\B)'#;^벱` `p$C hÉүm6;:S5&0D\ mC$2 TD`b G_ x> 'ܨN|sg Vm3{1$H&>ɥ)W4YZbS6s&%>mrZ&gm=Un_]3'UgWt.޺HsI*.#z.ԕ@C)&!S,\`WYQǰdLs6W},wzBIx4 B$"v ݗW_ݡ7ԙWÏdϻuX= bxɓ&IczjãmHNQutldIEmܱ |fn`w瓦ݷj-wX.@{OKSR8|ʞ;*I†/N/Ms3,U:-C-ġ-^2<;JgI]ZNpljmgNڞc<O[>W?vU߻yqs :)+E+ֻIеPzm=2RǓv6 $ ^λ}72JWCa(ޕ@78R681 xXW'g$ . \ `$Cg?gtMKb-TL/g!{?VLʦ߬L gq9膲Bz?z[[ļ p)~wo/ϋ|})j6^HL]ml?sT2EHHTJI9d,Ȱ$BBy^L#g1۔Q F9GDq TGM&}0cu/U8j- 0n$AtO PāF!v:tUD_cz˻Η?Cy! |a郪?qt>\c䫿tb}.e*pյʀ?ɔE-f\rp @Q?p| ,uzG~f譜w'~`@ ~rѨ6D MAzruexGhqe42F, 5ÄZW(8#&t8mvN|sWi =ny9vZMM.QP/,׾۟6Yg(&GsĚr"@,w=w9*IޡđҘ87VI3eߓe 'ku4m= QPJdZ[+17%#7ϧ+?0~=[" ! |AȱL ȆqcǓR3c((URD( yOsL4/*e eL)V7*ajP'P)m3nc wg:1: ,Pf0s~k0=؀7 #G ۭB !o>^k{~oxoy__2s:QI?7/3c03RcV 6 %AdFYQg]ErYv\$s~oh4<]1or-JBN4eQ6o*E@0c2F|ԈZSb;'sW];wZ C)ztkѽTUA>m-gt~C\6Թ>kgݚe P4;GkiM\nRW"^k1y=:3>/,TP! J vs$bham} +/ϗ|=Qp|mG 'ö,8҉8$E8d 7JJ: L%*ōsErzɓ)r#X-a/u&yB;!<<~#tPW{=yFEӐΓDXqpV{GUviW}2zE`( 1?'?*ԊTatOL|&= dbAYf%X`(lrE{o,n4 "6j!L)p W*`x~br~KˣS5:zPEuTS19 Oh?oڏxYRJJ8oF +tN/c!t7aL^hfߍQsVj'Ǭɰ5X( 8B`O 3ӫ۝%1*-er ?8B${=v#]&~<5"o7ģ9Xtp1k8G3d?% JAL](z {~Cg~mjc9^Za,8ҢCPB&rٻj68mT̏)l^RDHL *jZ6coOY"ow[qhXq)Us,JC;S5Qι (*S-WT(Oo}Ed`3mDv:tmP͠"E>dZ ;V+` ՛0o!08k .(@IײF'UD1T>P 9KEUq/KiURQlei(P G@8DYq́@ DQEL+Þz?^ߵ};%*HP|RO{_.(#-D`+Ylrq#;vO\6㪂D{)*?ĬR#S*IRڥt<vԜU!ԓiek"erŔ)yTpkɝ:5 E[Ts"ul'*_)ɱLpJc攊czkp%fcQϫ \2]U/y5̪*3|;|fyeYuYr#P5EOw:yi,> KN]Lcols9C9 "BPA$%̔ `0 ݞg<~;LcQ&[駨caM=oB/|8~)vP䯵[۔Ý!\<eMY&"D~dqraqQČ=9&Gmo*hO⯐fMF0ᵾ6Iuc!9o9Oc DH,!5b5ݴT @ ﰈ|8?:ϡ[[!}Ϲ 65@]t a2),6)!Mu 0\}nbT5%TrNhh`! ͗{g>%~=×Q܄U7MVYEuemvĆgP$}`(@̒0 Tu7߹~^U;u v:4b!=[YN&ei`́s+)AߔCƁȦ1D%Fx2H0E #fOX3xacd4m 0}WB>ȩv}sxyVK$gmBhOFgNLn =@W*f˫h|K?Cfِ?ȴ1o$6,GP);DoyLՙwC0P.|杀kJK93V$Uװ@rJJJ6c_"/~fo|nt=70@@V65wwD @XN&:B!#!\A& \APq+guï*^az74']D..Q^pŦj1!en Չ8/#k0X s#anBgыtN4s6VsQm;*s z }" F!(9M lx~>o+JCǏ* O<"R'_tA3of\@P7bVU~?=x;i~ʐՏTv~ЇdwûPՍgNy7ƺ%BAOHtg1|K cmH M`з=Uy0;<PٲImKZ(kwf_d慊( sLFDI3²0] .N~)?7WO7:^36 }es kxd@/*.}24qP^hPƺ$)-=+[RmByz4 WbDREʼnT8請r:o: bq$om2j=,"P< aLu$KukO+|k~%'B$ʅN?G$mrrL)*|H(\'BQ7V oމҸ7,N 6J13=+lIѬ?.>F)"'#E Gd!:mC\2\1~Ћ b'x:}l-c*˥OB{T DB}S9|O˔2*N󒳂5 ZS`:4_6p*8U)I̦RF4NY1!{Vj2<*= JH{ѩo0'<;7%g"5!y̳;<)~vWƞEI<:]wa1iFd5w[JiœiElJs=a7D:b%5m>yP0'ht:HGЁ"lm en>w W W=IK}g1/RgTFK#pDD5Rbv$anv6U@9HBH5Z| U6xcoNAZs2pPOL~yљ^XPuS'/%_o[62ߵ*m{ @D ۷R2~֟uV欨^[Zq;+jo‹mw+$6RTD%Tg}%:P`14TVП}Mԧwt O:2BBdʬF vuݽ]L(l01"E%)DC(a0FʴsMW׷h,ȪV.U8֣SAz?ug⚱ħǺ+hu2m]UA,-EDPTRW*6gkjG6"|LnV{>5BA/!ёw_n; ?<L ’>.;fxޟ}ܙr%hf^Bg_dDt ff eX-du;7d$>TcmSkoz0so9˧8C̬}ok,ީؖ=揄Ũ[q"ҷ>X(':\5"B !Cάy`EG*F_)٪l9}r13DJ'אy|:W6^4ը m}ji`y$1~vk@M:sWһWD_f[,רc7*è2t_D+3R9[HPY+#PΆ'xh1CkDJ(Nj*#TļH6GON]Q^Wb`©D}L"Tˏ3uI/tR,Qs?z'-pR;z>~85yk C0(8 mv@>wOC_O`E\P@[pL横4  ` BX(XBՒ sCtOϞ}:1$A$@~6>9K/ {_!p~nx~^rЄoD]j=!a}M ZRdImfZXR3;%YOanx0>'{$o[g|׭^7k~-/'4C02jntS03&&sfuF4zsuuPiڬvoU>/>/`beXRO~Ń&<Iл7eSSck;-n= 2AC@BoYv<kי;G0ʼΖUXzױRd% 9@ku(xv4@A_G=@Ö00 a/1;p';͂K@ {>`VO9݌==Ps ʅړrVE7cAtcAc2Fw\@p dXmi6 .4Q  i9t.z-R )4)>w?:ZI3~^1vO,Nղj'@āO!Ƕk/׷aY1忸u0pT). =& &Uh Y"+%sk;JjnC_j Ù{ 3GZ@#Ki& ,V5lnTb`~JTcID 2!S)V_y@mIo=0$At b'Eu)Wd#w`p M6[K\#"rX>}>z̙L`W-#dž2]fZWcWَ0@@1 @e - RdA vmbw$}[_v;qH#avH=FQ(緩)+Se!>mǸmƼ}_  yZZAkz=&gi(j6/,c;:$BK$Ze0Y`Y}׼_{El[S! ! D8A4ͪcVObToRA R GmH朊;rD\/ٽjPL\]ЩV*Ï7mzJ"ٿM Km2) 59HAjjlr&YF;Sz|Nm~?w<wSzN*ڶ &h  !|_#yXl1qq1r֊cKJi DѧՐ)TLMEeĉ|j7aFzٕ}vBb8{'41_<qv?x@<_/w|.-Ȓ0˜+As$~}nx$o>Pe"B9aEVȏ_5;Qz5~;njšݨa0D8!  97ŕU% Y'B(.⢧kVDtPX Y_6?>4RS)?ʚXʪVN ]}a :/>nk(0_oλk {-nnHK-9([omummr`QRv F$Z_՝?7#U"(_nL=UUӰAD@D@A<9ä$?w7=\G^ҟz}.TtC8W<͕5ysU&~a2͌lZp+g b\]|2-÷ĵ,'jVbqTcEg{<,oM!n~+r< at}MS u\|{Rι2ei8uF5~dڊj3c\-qJm )q/8)BD$)/8:?'w_g43Cw(@6B`h>W 8+ZI 맙;x)[9Xxb2O}ݙI~grܝ:)cbei`<b+lQD%r@CDA !CR~)rr.6%%1I_``)eyZ'c4$H 1D( c"ϜTPDuBՄQm{+ ڲU)j{G7B耜QRkDUd$Iq(@;]ЂAzl3|_ (YdZTI(J,;ptK$"]X:6T .dEJFS״Oqt]lsop3S{I>~)9u-l| M*lFU+Yr^ocNj.92dǗ.\sb"! őKRWewsW% )deZEE“K b ٢߂δf dA !'?.6Zc) wNۆE1oQƗmyZg7/9WwPUl|aExۃO>eN@7#rzx|O:q' C8#3UaqEEe43h#5 ZGw~f7>Fi32_lVN/^ËGOCng?jZ.NscmĦDMLѹ_~hwX/J^L?CG\΢+C?F_z>],0"٢G?_^,L;SclFSgoA sz(, kW%y}A\J~<$+RpC+OUxH F΀I<%52MrDHuAHE$/1/^%xY!͚oƍd-/__Qc\ ϚW" JRPCnД0$&;C>p|3&V_3'Ew`^[4mrr^fcX;pSЪԜBtcU0 ÓB|Y uu!AO1}Y”E* Y}sgP߼{@|l!ሁ#\ʿB{p%m8[:+SH|,(k}|A =ߌ<^2wx6Sob2UcN h}]L JWV>Gny&Uz6M׊Z[JrU|<ĩvҊ6 V!Zz%e? EA0PAWZX8bw̾GJ5r&"\ iޗI!1'ߋ]|vQyevUa)*. 5%w];ޫ>pF#NjAg%|lY|l^ǵB7Bڥ 5f=if$)!R֨%ڲx+E|m?a\D  ZC<,gL 1B 2S0?B)B*kSa`E9|_Kr=o!š>*(:U] /]O+ E%l"ɤ\rjRF5A\)(ٲPn2[-eI-.Ҙ#N8o וv2- |B81)JF5ɡ}zDiA4u |T\ٟ~qDwϟM}F(.;3nMX{Y'gf9Zxm,=OƒV]g׮.jH_OkK-Hdg۟8iky/SU{.K<kF|6wx- 転H;YtwgH)'=NɅ.V -r'YwT0jDnH,v P3+iz^>Ο17|IzMRN"ZٰWf(~ o:,aUߨ&RE [rL(.t) Xept$`ؕc3qh-;&iV)' >r a aSMlf6;Lg؆'/"]=?]뺿о4K(iUϛ9]KEG)ՒV Pc-' b0p\X:Q; ,`r 1Q~M&D%.NO g|Iȇ8=w/";ާNjYtgWmqpsܣ,y<\ s3SK F͠!\&s3NB{O =%NK2sUQLB.+0!޽BpaTB^ ɀ,e~7.;Pֆ"Ғ 罡Ue.+.VV&$@|@ [Kh$|?}r;jR$Ivf1( b?•I`C'P(q@p]AH񨤌9E>Y92c|pR}ۺ-%>u^`E kwuvNm՝TtT_ݻ:;;+~ J\wa-)J ])C/=>OVԥPMQjU"AvVc-z &sX H0MR0KE`"eti]QYEU6)yJ(:8Y?&0dۤ bC?jT:Rq7sMБV5cP[oYk,n#O[U{G1% XLZ(_ OPh qf(g ]-& C%%W ՐM0:;@B <8~#q:~|[gcJm)ނKӇ p}La$PJ !$Ò8g6ZM+˄֤!io\سYRrz2ɂ qxX.eG8i~?dtO3Y mOFEv8FZˡFc'7fNៜQ cI#!-D @=g ,8 ! \?]Dy%z^`8>jhq4n;0Dc|S|qȎv:I\3Wq_=2]ib}z2@ . 3S$n3Y +ap5T+(/ZE'f7[nI#.sܦ-[1;^)".KVQg23N߾s"6es Tj0!x+Y^:k7t3)ҕj@ԫK_|>G:ݿ&q 2a~_D$=7L?ގ0(b|?^u`)@~oHٿp{F$ n$% 0LbaI&DerR)Ȍ!&POiSxe([sq|4$R}/1`f` 2O˾.|/vmXu > &$d#Liay#nU o;&B?˒Oit%&ϖFLEvBUh:&# !Uneč x;Ae54]9x ҜY蹆#P'p$Sgi q&K;G'm:?ۻ B^q&8i4 f"H8!NHsZe |/@s#Hw j,20>/OavHoՎNYP<3R:jVƥP(\y6G\ Sqb 3^6+?H0y)0=~Ĕy>-Nra~;X Թ@iţzoGJ@Jpې@=uU }ƣg`s[ϔ33=AB Z˾oG0Y-цp{ݙu{eʔG3O>gGQ|-l ҅dr]5aI=`ї<)KqoO[=EkS;eOZuJQ_%vOQ/-su~Rn:åpVs 쫹UOR_޺ZQMV8RYC9a]wS_gֶ(_^| ?"Z/eFzOm \^Pyj?ogpC 7C>C>}10cǸ?_> 757(RZTD5=3..r?`-0UusP3Ӿt}/-B>*v>+BAP-_y ޽̻OA~.!("fζvww iU ewd}w5^IgUT|VrQwOa?ϽjLdh3R)9B;΢УCGШjljcbikvz ,ɷX)9II.w)9},NJ?]U7uArJhuiO5uF_5w}ꢨӯ^Ͳm7%niT~>cd-3&1r߂Z̊tM럟j{ux3\-ף:۰ozWo`^ _O=Qj/$a00dK#sݓ_,?  <}J7pD4(,?߬gz]*  Zӄiܫ4 H543K3 Ӌ̫Z)# :DFM{Gmz17iy\,{l̜νI&IJJK&%.u,rsXܵ;XyqKK^^^]^^^bbaRQMzNMH-BF/йJI܄DWhȗcc###!z%nEŸBEž(0EE9EeI#6쑱q#xmWLQዻ)(=(%%u`IIC0sݩdf)䤼Kog3rrrkk( \$$$d{-V&)(ATĦGY9*899:?j$L.2.r57^C\ߓn`٠2rRMUzgJDdݑD%"k#""#_x3E]hyL+*絕GY\mnfݦaaj^^^^]!$,^H|N^Ĭ0KKKLP\򿋷>$A5K>!qb}QvH.BR_~vZ }ڲ*O'UЁfzLS_3](,:ذP^X&|Yoɳ˧xt{,,q| cn~1=A>8#*-0NwM+%޴=X'Or sUZ\Χ7iMRR52ķ"]N:'D߶S_Tƌ2,j~ϣa?)U ?^l,.,vtvi捈6LnQԵgN؞: dRN6VOOW 1٣F$O'B0›0<Oxު꘰3-q Aɓܔx!9GG$k @f$@Ç  SkYͮn7;v MłUUc@a}?n~|DVi Gz?+߅? eg>SyOQl}>|l,?G8_zY)Ł\{I&;Vb.]}nh"3)X#SEެ[int^vLXfR|7WS1=Nwu'fkdzrϧvm" < _ū}wߵm֗YߧeיgGi_<+c[^\E=yM[vrGqG " ˒Whn4Y95T( $::I+5:ҥK%'r5W~ ةQfP)D D1G)<~p` t\ y)-Msg߳Ʊ_)@Q*HIHv(F/lS,D{@І(QZ%D6.k~<g3R(rVsk\BsJpq@M^Lޤj;&W}}c_=^WCowC{fuSWo%wEU Œ(+:>LOTZ\THĒ8C r#mƃȻDYnNk#+|Dl{P@l]r hl$zY?N0R(lUǍ< ׾ Ȁ# uc:D"^sc_&PRxHR,XRGݴ,ˤXB_ gcCgȽ!B3 !Bxqqq{{x={x?B!B@!B!/{{B!B!QEQEQ@!B{{}!B {{Ol2\߇?FۗmY߅ȀL})IS>*V'f>?z6ꙸ܀atR)oj>Iza~:2x|T|n8BPѮgh{}>Oz)}',M 5d:83)NdͲd  ,UT5ۃi^%tlץ<ߒiyZsf&?tC4O7Hx%ڰ2:2 N~?h&/ǖfT: *',s|U-éfqq$,VtEsK}hd5KV>0usi2Ԁ Ӊg܂W@{~77{q>g|\>o %^=}OzoH$͖ +L0cA@$Q1I `@W@~P y4IBn}ϩ[@Ti5UK};veCGWoσ-Zv r9]۬٦.A]OyB Y~ 6^~g<E$7q_; M{ &4u*Uٗo=[>25ǠrPo6N8x;PyJ~ i*h9\*&獉'5!1t2.R Qe.*440|a4-m:[{gfFcHDDE2ږe 3'hWD_r}d8~<A@Z O nJh+zwˠcBXبacc[W :>cL |eJ'/D[so5G-=cLUp=*'bVޥxSK|L/m?j 5/?v#?q@*WڱP- $io*U0 o@VD羔6@"Qg~40uٳ`B!lKW\={wAб˰b2ŋ]N!HK]'ֵYR}J#dI!?7έ(t+qKŚ O,l©X`C9w}x:1Y6VBk_ޮ|Yq{$B&M'rgƵd->#Y " 9H/6/wo`k@6}K*W.x:vUՌxXMբ޷AH-rBBKcҴKcGN gl&f2Bh{>mE;;֗Mpb8BZȂ6 CAo6,@}LT?T&C+h?6Je^>ObŚPW_$h[R@Y*d`֟YiDh\լe=s״c4zUت$t% lϿ^ x$=>Ƴ|{5ɮz62cQ s멡׏; *!NѢ;4t)\]/:E MҷKŪvr|76 iY˅DM2lAkUYΘCʹr^0z-a ~^im/3s4K9lo<8 @w.gpqj|/7`F1 B#+|hme>E QCX"C>_9c[fAθvlqpV.ի=|\&\mI9opo;k  N` xx<:һETow \ؒh8 Mljrϓ됛%낝Ux3\\"`*.`  wMM1Pof'6&-jN]A{WNɭ5m݋%٥:!,4P5J.RDXEtNY:0&pZg&jh=q}.joеk#õG+ (mEp#5Lx9ƙ9mh(HۍcsV>wDxOgÛnݾl g9^ϝηűM --91MmvoR3PfZ6*5TmG 1/@&s 8r3MCv]6u=s(d}r|$CKwkp$bG񇿿B" G% Z_{h[t$ܷ˸"ҙ }CV}3?[}?}rnZHQ?6D&5w<l[i+9Bc #t={7 >] xpnMꝻ|X 0@@3zfy}>CNpg1> JYvܜGϿrpܳ @>)9G+Dй-_X5mHZf4pxYlR:rƪDaJԳٵ %څ )Zx.ڠܜ\)# c %Բ낽dd `ANCaP[<l3I.=?4%6%7%^˜# ᷩTQtMWH1W䰤YAbW:^W?,hjFF,۵eZ*TY{[KmFj}+"6*ȕ}MfRqI34C4Z93P2ݓ_+ۛc5 _a1Ԇn/Vus[Ecw̦iN1!0`8`oXE ( KTNK]^uweRqqudb-,,^U~|lGgu?gUw=K'˓.,y2䞆Mj-VbɆ[-km6]g0Q>zгNRkypL;K@$.wIB׼*YLp)!]>qoz0{gH}ax|AfP[>["rȼ8 4C g[dgv,F YneL]DIo\vի +e\1oRVPf?A.4M s`j:6c ?W޻~̶1VRN0L kfc惐[Hy'`"ࡀ.B!\bhlt.O .&_t1D@1712.  Sf! x|[wx%-0?bŻdniм=1DLK[L+^n5µl½p澕fe[B֋++Ulv\~I`.}ln>Czm'2͟ϳaKfך꼔#aiQ53k۲|fRd3{~ZQcJTs Yb3ٳgjOs`ժTU kt5?ynNUTWGwo DG3ms2ùN1!؜[W\|Sc\&~h؃i |67;@CNz4lt#nr{vhm׎Fݲ>"]m+J ϬSy%Aw_o :Uh6:PWKR mlW ~*ٝJjg_k½Л?6̀HBݒ0'wo`T-]6\Bknբp--۶m;f̀^+'s%8Ш5~lAhhqp25sq06q1@D#|mF!?4?wՐ Vxp~7_8蓎=;~!20b<w1Ɨ p l\fx汎quq͏#mn0@3V6 ϵy/>?+NkN#9bq6gaX8X䰎K݌1# eɷ,~j>!1)}pv{.~Hݾ=߹w_SCp cӫ 'ʺiMlt2:hR{ާQ >OR]nLL='<톲pY8u[#\H#f͓XJص+WȾbvkvmTv{8HK2l(ݢ]Ze (ő&XncQICJXB(<?e7(W??*9-_pOs^J~<ͮ)Q١{|Q_|9} Č74 @} 5ȉ <6cڞ@tl'q]*TSĴJ%QVeC$T:yQM@zzP2F#BE>hDIrLrhit$@|cxTGbg( e}&{pt5ۇ77ڍWZ۴d(*gM#.Y>i Ć[uA>{:}ET$L%UnLv Xr%=}4{̇pM¾v ^RL*-@P#G.$AJ?kۍ躁X1c2c$7 "`;vH)=e(qcksiMŎKVY;#ݽn1Mܮg9U;K ϴ}%=[RiQu>BѩSsDN>!ۤy1Ob~OagDt*B:y= JGo Xz]I !DSfrqJC5&e=_?Oel^l6 tUf 'V* fNƖ^dmv46>be9[ΩazbrkB.wk!()U.Hy[*싓"am&M%5mn=؜<{-֤R&v)d,xuC ឩnU2M&1CDlxF LECA y1C!MyƯ^@R # B |??#FNf2J-F! ^b_Mm 3aFveUЭ [k^a-@ A"8a E!a>4En?De 'gg,|.[̏ߠPŽe\$4[U4_yg{VG-_CD%*gU?X<`~:Քyq_S5{0E!'ܬ܀"1@AhC`hsG蒪/]g{$D==Dn' hosƮ';AgΥhtI0&TJ_oE"ySKXHkiw&T S$Pʟ`ů/65MYP ,蝜+2a`E!6Õ}JiR.1ꜫGSi=~XL_K|lF]>ju7$])/𼭯oZ|زpdx' v:^E; 5RlLk`|u}m({_V%˵2@0  `@0Ka}N@h"$HtUq9YF񋳧ٔw_LWPo>"» m-$K',]Sb["r㞯VM3oQOQNyMZB5ԚKR%ir 8)uޯj1qc}~?tYA(5$ V٫Z dĚ-bQObr\s|1[zZ#*-V,xaŏ@7ޫ3-Ϥ;T)`q2 k" ߕ3~c/GZow<΢OɨRB,~_/_e~V\(Ώ]O|J~#8%'iёt+M@I[ӗ|Y,v6)P F!y-{u, '/ڢ8F#@:j+iqlʤknh8~~: 85?': #C9AVX"{$ oA,41;THzG%HhҀD8FDL?JxUax*&?&ZBi6Odb~}lOa س`@$ ПQa1vkØЩ} ?os3`-O@]|r,&,ò䵏Q_s-lqz.@KҾI%^⹽}($9Z9"~Uc̫7p an-ȩ,|xEGAnq 9+R VHEKD!a߮Q ШlI?%O6>;^-y"St'11&(]#Kԑ*K359^Z^ l.kk6icMߡsWؘ#9k岧A/mI+&E &e  eMk>A`V -{M/`Ф|wyE!4 MU^()TאkVYU&L+ɽ;7y1y@ mx,(8l`ji s۹W>ПzM;;2e] ĢRM6;s[g<4zWOZ4F\(@Zԧ4 [Xe[RUkTk-gLpPM`keیIx0̍牢vm= sD!nȺP7 }.W:>2w y6|lNOO|zz´TQ`61Ÿg+9+3<`Nq8)bN<ƾw7܄~+8FvL c <]{5)14Z=E]BcH=^vWDN![h\-0e<㘍 IJTjOS:%>c2r3.]iʋ(˟;y #m5vZcu F._U~88-=FۦrqrdgZ@PC0[pIѱܢs4;(l%6&mp #<'#%N]\o^짇b(Y쉯<0;63^97i}k;iS1%7nGN9h-[Sw5qԚNJTܗBw8fL=;ت W[sX\GBq;7BxNp*zTps-^p^5Ҷ 9z, ]^Ye/ *MLQWr 3ooGbZ{PwgmL\Ɠ:6o*ܮI`['A5!N4R(D~֠궽7V/EQ`pD kߨwys sӎg}ma8)&'Oa~_I!^$9vC/w)Y-mR!/*Gjg4 < ٦`6.:0yr1adk> we,Tv:o[#<Ě? 0ޥlvߩ[&}''y@3xq3?WD k&}*bWF/|R@9iRu7;DqMxRi-ڲ JX([,Qea"7mPd zq VR_9E)!O&OU)(~#Bpo-miɘ+q)R`ѢE`mR@433zV<.Mqq3"{WY '"g::Ҏj2 Ԗʎe{ ij'~]s/$2׏/葁R S:ն/\]ku{@e 2a'@,Yjc}q `xưTOt05^^ʂ\B9{7/XB$r7'wwԸ X.١j'fF(bd;v)J-SmDwzd`pL]xJ) )f-fٯvls)Ut  D4!ܼQ٪|z \sp(aY{8c9sW o(N3"ӵq*䴚}=֕ZR 6%@L 9&A PhѦKe7E#&)D`>&D=Jֵoŀ2:2k9NIQ6q Xʍ‰ D)t}L*Fl Iͨ)Ś3J gJ{E>j؊8Ug׈j*NL͢XwѧG+2 rFB4 I ]#ܷ|Lp8dSjF4:ko' 3_qp02GRw-`YF:%AQHA;,GBcLs3R0k*+"17‡heE>KH 5PA, ` TƵ@U@dh :ezeT^pH:}TY=oŞ5#s|վXA)| RSCjgl6:sqaxC&`{jYÙb.0(j%L+-_`R@1qɄI x?oBSU!UDH08;96#l#95.1B@Э5{eTG!*Be׎KhE H]c"-ZRs~R*/_--N;TA0^v ԤH+t(* gjB*\.Hئ5yޯBtBzBC}-/@oMBrF@iBͱ$1%{83geإFI%VB[s@#wQ$@neOB0?R;sMmLV6#4o68U#O &+eN٢2,ܧkl7 Oa-^na- ZexM-[o PÁu "}t'U*A:,nDdذbY=V1$BOx]mMh-0( L;Тj:,anj瞁)wpmմ bFPQe_RrI_z,)B%o謢@`W`h0iWv~ĜBx.TjAc`VKYt/rn!w9 I-+žV\1~䆍1~e_p_ֹƼGCP֘xo~D6߄C<-:_'rY8 &?֒Hd0"uxmn5ݬmu ?E_%.5˅Yj(i)(S$W۳iȜ,6O)IV#l\N~'tcf9dUSMJ,)鷬A%%]M7_1эQ<6 OǞը%jWZE:Cnm@ך|ZF&-Зj5Nax#93}d9Bp!l# Vv2^ RfQ4:#3An,fLZ{(5ֳ#C/?yp5ןDRTʫlM'1woJ'`=0&HQrDP$FY:WV *Oe[5Tyo#'ʤԮHb8d p*y._vMyJ2*ݡH+|a3Ȝդ_pav F~efr-={\%nOb2e >J}';LG"s5i 4}Q~Ś|bBżlN^kLSk?;kحa (~1"{h x|%i[&Φ_)`>G4;Hhj[&(Βp7ұ F5!'nJ6~6oݏqT},PޫfB4o[I F$|3fNyQV@qIr쾦˃QK8k 8t {e!md4TuE'#w]!\8j2ົ#+6iYSȊSM~%Lb8 ~6(͕Sz8D'y!Tyl(Յ$;k19[oG!e '[]zPW©W@'uwIDBFf94@_c̽sxp\ uFPrCՈ(3Jp %G$F`GgB7gUgqvn]gV28/|-ϙxa S*px[{=VU0ʪ ;1AY"G 4gn+B+Rԥfuy!R˽a(3˓7Peap9ԋA?~N>tr\øN jpx™h$zH E;K5#)\|YߞbN)a۟E*Uql-~QՑ*6W2kyef>A#i3RKmΎ0hZͤb|^0$ `9jõ v,w9+\<80G] OlօQjC[ebIi_k 5gAt=˻Ǽ_0M>h LbZKcq#Nʴ(s6X9q#ik]ɡ̓R2frbƦOpNc׍~eKbhBCp /VʨMrHt9[*qYD4ymsԂ̷t4&R=El] ȴ\㊏o}j Uݚ<$>p,x! ☡Fjuk, ^Ѓ@nڝl"cvq *jd nXٽXd u}&)0mh**Bn#e7L#R_`-[M~fOn/݅eQ?uw- %}k2k#i:Q ~u(ؕxqnEdKl ??p]*sumtszZ5+~, gS0fк+ QAeNoR0)@6++~rÑGDTS~9#/- ?˄&dOv@˛\쩨9tnr}[3L>ۤ͢4[Η3oPh df9 =_DKsK[9%Ye PVOx*Ml  ^VU=k~_zKǰx$yt(d.1Ƿ-4'IIKwSHEs{FAg%#~X_<8DRB̓a);Z6>eo33m|&^o/ŝJ;&=ak)ay71 .ӗ.$%sAMTV(kICJ.  s+u5(bkʱ IҡLFʿ~ ufJyL4?-~18Vd)w^&wvu̴ͺj _!BE@!VGL9c#א \}U"0Mnst3( ceZxoܬgꒆ554I8LoB@bFJ:h(oA}AtgBXGL&HQv9I>x .y Dku;Ueg Jʤ^ CN<j0798 7P0V8rfcp2*\Ab-w 7-LKAxyy uֳm?q\@"9%WuXR\ZnXj,bNKh#&쟢W[DSz-Գ qcu=kQ9]OnAsF%|~ Apqů|'I SZ IJMݫ&.V~JQ c"ـ l4UO2]3#Kz>@Ԓv>n&~r/kg@QfA$;(^6\QCa[e6 9 rNVlYB<_y&Q,yuFqN4OOr=YK/A_F`VS#x4I`qk>܂#8`ɨ/l*R.u䄞QPŢM^EٲDza,2,&] s`vɄ.<{7/>a]U4/IPL4i1TjoDäo^!y$gkud!^JK*ٽuYA_isV| `"77jP\,C$UB |& Tx`29*@HT;8M,akc-$" F1QyIA_ꑧgjhE y&7K}9FR  2u曢A@k1cYڽ_Uڃ K;dcT[Ji!8g,"-"ԸzEaҡ8~S(JZmelw?]ET~䒓OR}d}B?AJЅi S楹 4ѐ%HdaP-)-s¶1q] f/R2⬂Gn a6bN8:|O]91}nydO~=&bv>3 MOq>gbYODW6. -,Q;q*+1iʿtZ}e^V^T >-Ő0tr{wO̕MDT+P2S]SL=a6ok*r##3`"BL.楠V ](r٫5(GP:Qx"7hkt_F 28VqO73JcjI ӑ9!#F#\6I$G"Dc/S ` rƵF_e5Ep;d~M+RZuR` {W얦~qh\ѕ9I=Gm:5N 7^U0J@m`qn_L< i?k@bX0Sar*PP'~kKw;Rvvtv淹1GH#Z^p $A-lwMp=iWEeڦaM KŒi*de)bA^3m&VC-r VJQe Ȃ0l"ooҟCۃNG Tp&ۑQA~Ts͌Lzxϓ-%^#' ܆ݑE5\jFj=XJmO99Wv$oww BӳoT%ǹN F(6DNj|< WQ>gŠ5R|iD)`uF8K½Sḩx͔GU~FCo-d؉W_+72ъIeNcNZ3 IW ge] Q[$f#G6zVxO4(Qoj%Ļ+U; k}Gt|ti%YIFf^jTVٵrm-3i.MN`&p=q0 )T]qѱ >mm+&|!PSA: I9ͱ5^uC4w`cҐJG3T'+#*<}7W.v¥,f?Djv0)C9|]TCfm͊mWx h %OV<|EY ʖ']wqKokVxHdıA F82I( m,øO[K!.1ex'{~b(z̷ۡZaFy*c_^F(ɾ2MɣHCo.ټli?oVux;y*(4t+VY: k-]t b=2X{2w7^lܓV;7G߸$i˜q Ƥd 5 (;qQo|U{7Up W(a1S/V9b䥎k6ؤ;R ij0R0 y^Ʉ P',W\bW0k#R2;5MlcW`uv#.v:u^6pe ̗QUǺHbtNb%\/  :z4;ݑ+ >F6r` cECj]&>xoa]<_ZfYzY%A̐ 7R!BgJL!4k-~C޳3[r/(|땊x $Hza#J!1t8跦GT<^Zo:AsLfݯ>v%VXF@}wMM(F:f8(Lb[7ܭ<#R^J.Ҋ̏=bdXgs2{/7]cwq}|G2>u0cN+0C6r󙮖p .;1rV(i]qBJk/yɜ"9͸u(t@!]?jusJH,ӓ)17Mgi_贀v@{(ߚ5p|R?Asܥ性q$K.orlh<ݖ;}?!GG2 BM~!^l)FBY0gFg fm5P0:a[S']3 MHNpk^L'WcMܢeeůYcHbwq,YƧrCqPsǘ/U%PwL$F!.[ }U&FЄZ˞t5/ua)> \'S&ac9:Qa0Nx9z|Z2!jFҙ4tcPek>wDAqBYe&VMyC;ʡNSWRn zPb`&ԭBm`] yeEXʱXb%oq@3G|0 uVS V.g'%Ę? qN0Zޘn)nY#!; } T4"D~!ejA.a׭^AO_ vDEG3J"3A~Q1"Of&13ޞDFq{_=c1э;~~FmE[Kv6Ϣ/M~-X>4 pkh?YjyvŷsXA~3ߡF6adM'| pc!-{}+;`f λ"Ob^9z]<8~ b>9D4Geڲ*=tyszׄN:<yH<iegop\ 8)(F8>q8xuGկFC\vtMY!Ǚ(Ҳ!(B'w}Qn8fk{i } u^ w3~yUs*:NZж?,74!#= - jKC|ήl* P>:ml IEECl'@O!Am7 7֗޳܎sÖ&CⰔǮUsMJ׃gcź}?~V{W6Ԯ1~I7afOw+RVx_AAx+wj5#}wmTS١EՈtNuRӶ*1`]/CUI$lkfP+/].#zҀgf=Ec3[7HJg4{K7 Up`?܅_tSi(yI{?tjIk5+,ȦG"amG c!oI݆ጸN/cXZ[:.L/18 m:;ޞ3'gS";@a}Ҿtp_9Q=Rsw\  ϻ,#(?9r [x+;Q*LK]G#.> cK[Z I,gIgJ\LsK40M[~.Iؤ$Bk v[1}D<qL V^Cr!eipZ1V.tз'V3E9gS JGQ.UIG!oىen:{ջPOtAVq :n?ZwIR:-X h7oDA=f$SB5 GEa0 yPZ\TiG! ٬vH>ߐt&&wIz_0ewi7=,QJDLmϓ5h^ q&+r7flzxb)f Ў hU&O9cЖ&o"V8:=nF!">H|Dڹby3DR7Y`&0Ov]yٸ7&vaita8j4:fHp>Y=R5?D7vt82^fH%U OF\.sS#^"RP+ L#-#/ۥfE-^VUwV-w(2n{9>1#MC{X o|) !jSNWcL)$.uj֘=k<ۤni=g~HS[ DA-;8ϧhjmeïm|xE˳f+\ 7.'F3 N@ԭ{2|p(8O~d%9 Tзfn\L(;/.PN:d"9)>wP *RԒS oOwh0N=k~7"G@乛Dŋ ZT }&qkTH0ZI5DHrO0TghJY>*mQqQ p!/yg !àw1I#S'9J~CDfۥRC)J%،odFd! DWAQjb\ , $=:)AL̠. u2.'|+11{FW$~7fGoIUZLDHSydT2/H]6?siwX@G 9:S lN@ _|V1u׳X|QSv->r.Oȅk vztlݦ-%_o9ğ,slSuc S$T~0Cj 2fqi],wo+ï$ӹI"{ԧ-n\0o8V׼+TC2 WLuDO4M kDﳥeUE4|9Bh#Bˀ)Re\ܔq-nkOvv7=T|o&Fg Ldžr*4`87Y_/*mFnk4/ ZdAdmk/cX_+~~DaxA&W[gq=7 {+5( oAZD/|6ѣmO0;+˹_9Uv-X&17as@ P,vO+ !җ>]xpU+c]y^;:S YCSuՅ6hmoI6jjk.U>~>.(Lӈ-kDȝ{bz\W]L$Ӏإ֛}DCF0%}1OFo- g]O1M7P+1fNunʼ ;ΥVJδ8C~Eh!F&~m;"T Ɩ',†bo%ǸٌIވdD$" Ή$,yb|eD!KO(cwC9ʕ>( >DmZU,geg|LDG`z; x5zgL5%4\55HuaXGv*0޶$!xio A Ye330 ׆[F9hGS0$U3QY"z}s= b= ]= Ŷw@[31S<p/yy ؛c k&[^̘SY:-'|We3ϑo,ɘ_/aT̙?\;=ޕszA@›~c!XX\ƌI۞qD8vUyb#d܅RAaRD91m[:8 {jglojփ-˚lVDY!@ ҧxZ,YJUGA"Ή!Ӹ1ӞًMBf(v~\ m=qHyW:5ub#>6޹DT< d^Ɓprw,RHUJ٧lwk˒IR<"VsZ\l|2}pz`0)m[ggɥwꄴVoynD\Z'}qEr9&!'%oBxo):Q[tE'Qɖ߳b &#c)gM u@H V6ZhXɲXAa?0׶d5a­~<xW 9H#985> t^+jg|x|k5s[ⱙH ̶bJבn_?Ոt!U&cbdX}h}IbƜ!yu XH) ۥKzh0 qvB@< |6ܕ"(eQ7&O75r$m&whkyM8/+H TwAm` Z0B3"d(k*3hX:qG:uyxzX?)U"M }%~߿- `[|ר\0L3ŘI{і@v{fyLQqYD#|Fo#N_k$CdvUNҕMhXԊTuCtN@+xYdԬ"`ry-6E:5~Tn5Z&#F(yZ0Jnqnݎ< 7ەiU/!Z)Cg>dfe>(+?-p0-\ вsYDo=8@PfDnŌ"5-δ(M>*$A2#EoĽAVGHr*գƳD$20aaOeZ@b9]ED6~9ˊhWcCqlȣ$׷#g5lX W1w+ ׅwCN:%W_^"i@?8L̏ȰCr3;İ >ɅtLbqz6?'Z%yc͜D~Ė]>l ;M8G5 S%%a@\`,J^j2NYKvHZ ⚺7,w'FĀ;< ^pԁLׅ-Crd0fD{RERlT5Fx[:4 ;̭.=Id5+$}=ֳ>TZiG[tGIԸ n )_ jSӗ\/|%x,5±'Ɯ8\?e Q}6$7AJ i3>b$H2 QmsT2BC(>@՗Ox? ytw6:@vwl:{"1 G?[9Ѝ(|z?దtwKzؑ S=qu<T??9+T"+g"tޫUvsn U-%E!uwܩpxBEX@埔4Lh"m+<0JÑ1B*6Pq}+<^@~ӱv})t.`"ڿaL} IXw" 9٦zKFT~A>rfA 9Xi#~E& H.%C &#E3},4i!]f.R˜b@`W;p>3C5ZVw "/Jyop9QE(mj*s M8dz5[Zր 98#3r=h@,qb&sz@ h?1 {u[)8FF pޑTGZ'"gpU~E12KyἥgT4VްO2~EG NQ:X;i&p9y@, "lj'm!q|IR:M6˒fˎB nlH_"1;F IuP`-Z_Oo}Gâlpdz$$Tq:zX#_}1нT P4Z`oS9Y&cgN9:[Xc^`5HS5F;\ׇJelD.f8xys$Mb( `aS!HdΓ0Odp Bٱ9@+@̒JI>@)3v3x5Yc-W"Š٦jG2.Y3s@݀PK֖IL4cUp0nBK4(O T -ci\AV=QE[ w3\LͫIX15?*8=_9va G,A4($AS&*MY,#kg-@ef]3aYQ}kx^yXJQ,e9 jq`SN 9xSXK ! EN[&%:ܜU.H҆ $5Gl 9A`h&=i˅t} n֠JY y1AI ~(HK5+SzKb6R2S_SEN,!;/U#*Arg9'"僌AyMU@9)1e!j֮ d# f\t0eQy@"TR) AU_RP0TUbԙ= / .]pd3[l0 FzGviac ӟ)CeK"g)"s" 2 +LSߵhQ- =ԂV_:WM["Bը8~<$lxn-Գd`gk!3}++9Ïж%JC?I23,xcfBY閅o2="p+:}TY(l8ܺ_|k]k18{\;ގڕcsAwdpB>z]w4+jy8d =u7ma2LOc@xw6NvVo*t;2QZb ګ]ȗ_u@$ #n4Gs ",>8oAL!QG+_I>Zbáa5gYXk3;I<`[1u\pƛi,~sJכ(2/-`DA63&H0bA Ϥ%Bztϭu+w܂iS,c]qp~Ly?Ӻ^Ęq!S\h,}&)>cuo2W⅄% ĄV6ۘM)Nc{a6TAj?q`rqԥ˲7 6~A& 2q?q᠖}`* }E@5e<@i5a4190$Ry_3}Ouc9ܫ`޳.H[MQyXtGvrɰ0;DZt $jڗ,r+/LGSS[_n7%j8)\W06Ok]:hnu Urw9*OhR@bb[Tv&_*ƺ{:KHj(8{hoC6@:}~^3d yNAx[R[bDm%KP 1L"/HG3h[wڌ(]=ҠA g@4Z,*{WbPU3-*;~p~~cxbQ#aț{Ð@`J78|)!VB 4N# ڻ\]}pv' m&nNH  N `"Sf~׋:a@*ͨػ=KT(~ocb _As\ ygw%6{S]6LE:1H"' 7.0}@Nh4_hd9PAo*d&ZLcLaya+jQ>P{%bx[fQEcvNUT!MB!~d_b&)b)3R~C"r&n~_Nը&``֐s{ːqzZy"uQUHL$) PnW4j}BsCra C ߷8 Oܓj*BV}=+O--޶wC) a$UmOH֩RݿkPwIݙ˙y ґ4D;қǚvRcFz{7m#/eU s/l͙LyZʣ`Cosq唝 AOccrW  LM$ ̝IM2^_u 3ՙdTHh3-:v缇k]ADw^ƅluPx"d#~ |\< ״mdȓ:+ $n4"Ɣ.S6$X:gQPNhWNE* F WͨU 3 Գ'VHdlU%iv bU>J.z!4G2nL4@AvUb Q/I,/(OjW.tT[Y)GX"1\'Rռ [ gNK]J#cb{ C[E'l>e˰@XKkj|`^7<&0y1qYcd]|A0DT ,]J ʿ$a]W'Dc[rϟR_`ev9, h+ka3*2JMG7GĄ@J:L[`_ѩ5GŝBz' ӃéQ>Z RB7`yƋ]#Hlg9͆Z{сW<Dzbi.VȄq 8BCXa AeVNJ8qѧ 5̀iZXm#<(C3^C[dT'aFNMKǃVnGCQ:VŮۮ#[ 6ȕex kJ/w#p|^wEvzNDǸ}Nk+,"nqݔ*3jŒg4uT*Z0,FvI1mNPȂ~M!ű5z5Fr?Mg|ۖ9Cxc1nbU٩ -Jwr15S'7̔|oL%B\g55 ;Htd āZge,xwPX<jiCTm8pyJVO zdmDwV:%jO!5G8䵆fM&cRiJ`~>AlC1Ǡ2J9WV̀Ppq ='],rzuk`JG )T~9&>5NG=2kA|~U*pz4bUǭ,K!$34jWR#IJeK/hxd5͸R?}e>\ ߩյTtM%7CУ;PD D- ȍ7 -e[ᰥt9!#"} 䏜=LZ@n>vg^M%D,uQ}4k7V]bi f9(KD^C*oM>qSRr8Uuo̠F 9P ?yBtI?~s٬v^Y:eж2D*瓇ei[3פEŔa[Еx۲r&Lqq(ᄃ3=qZ2pE%Гr($&!0He g-Tr,*s,#3N1x8 bS_f#4Xid(b`SҦ&6i=w VRp=e::~/hYhH=5 ŵ}#ͬxe(p) HF?*C 8WF}ErD-LJaF赤eĕǨ~Sl)ňmn8@n羢tn0ωq4a3J ~HCN*Q{q cWwdGa Xq($kyUԄ)MU"1~o0 Ǩ%Q7  z!73𴯡Е)= a@|ml.00@ %u QC('Fݜ~[wB-'Q.[ NSBe$=&Rt"dصGQhr8U" 碻m{pû wLB.n dou -ÀR1s)vj$``3 \"IB}\3hVe}Tùs|g{&UiCNY͚0kd«k7\.?ns,*tE@*[#B3:.7 ヨ7#@oE 7ؠ"<||ȃN"*Mힷ;F ő 4 iNi gzb;{$r]A0gU [I__O)¢?f+otz PO s$W{e}K†jXOE3 ](!CB؅NVcBr'cX?wMbWPžKN*ͺX85 zM /}ݎǝDT%K\=Ǥ6ڑE?@ѷO+)TȺ`$ƪac?]#1ci 3KQzqy˲SJ+1!$2JPh6\o'm3|,D1ݪ'?fl)&, 4 qqy#|Fuci9P3MDQ鳢ZpvmAkP?* zN(u9ุ$m`K\:iZ(Y/ݮC2&ؿs=~n7{6~(To( @ GY(õ&}w7T9ILʚ)6#GBzjw&"VU"xi.;zzp;w,-;ONח;~*vm B5-CL^3ݎ>au3I1A+_ذ-(1m}c" &0J~:}. l=_[jU ɸ k>"K_(Pe(ׯ4Tjƨz>&ot.]419hxm:a䟁)/t) Ve}ajڷ;6yŋ~tpN^ga)5J qiG+xEROdSxW -i>tJ9 'I$cYS,2omN1[w-TI3jmEI!-pb0ڎtssessbs؀(㏇_qWlپ9Ts UkgBc3;O~ǐ`y/}hk$8笎_Pm-49ɵ)2n,\L2\K +P։"]|97|P;7KP3anùڻD {_,az2uaCc!m**:av&eK$ 1RM K*}q}\*CpϿ:oISr'rj~+-8zr0OiL1v{wnGbI[wx X@?.̶59{>s[zm'$ R|gކ(QWoP,N.\/Ulkt,3O)͈$ 6]x܈KU*u:f@{Hu2,!Ek!`%{:mki`!ƻO $: ^ rX4,}v儬vl/F Ȼ԰/Z1RȢ/^2HkƯgVn [b B6.Ec*bXJ+A'ٺީzCjB,i>{ۃ@Ͱphvd4 TT1}#fy˵ K4VuKnɶm_[$eЋܗsVuڵ\ 8], fkb`vip4p{-P:(BMF"r>sӦi2u|/U7Le/RB1NI.(Eص--3e BԄԬK#YNܴ1>tBJa:5Lw.ۋbg@<LX+n:Y;AYΕv_0 mYs!dTOO1w1vHx D= &uJ$zu3K(PH5=ԥP6?QcDpE\KݢyO7'$<{xX{q/]l҂6^r;RL)h}@e"L%R6>ݼ[Ǡ !,J>swr5ᓂJe5dZ/.WNN%hZ~PrNG(B>8q$riuL.R/RR3M +T}{AiA>ٞflS| ߑ ;= xW։MS=K7 gKtg L:r=zOi2叒>u@4EߝFk׆DHI]҉_-U]X:'64J/"ǰyb'Ws4oO .p+2IOWg(Cl~C֣kmujrdE]3 š1R+ȮʴL &N[s& ""E@LIyOJߌLٔFvF)Ǜ3Qv;2kؠQB4Ȕ"Pvy\8$3OC\b&3AhӅg(cA Cئ:>PsG \%բ|lmg\R MXYSK 9TɼI@`&\M:/8x)Xj2Fc_DG uI[.J }+`R }5Tl (&QĒ+q>;*H0ltŸԤ%Ƽ쟿HDFSde/`{6I'.ɷռv]'G$TuO e:<$E9О-k;pÙErDV/Hێ .XVJ3ҮiR!cbBlШ5(ux  2)(59|b߄7w24_|-C޵,{0|ld| 4L{eBoQv\9$ȘTWo?g9ygYܒ:<M YT мU<<#L!x" >H51q(Ot2eϔ1vD<77dw\-} k&%.0qk3G/G 6G4)9{ސW(B˖Wq祾"+3bPk $B=E{v7?h6h35.-fˆ-- 6KY.L?M)QFeew"yj2 zjiTP HӔ됺z,S9;p5%(}KSǚN'pe)]R(|lסJ%> u3 *jG |ࡌd䩀 CJ="Kr=Gs;nsX2Nj*J߂xGqj,D޸YLPHk)|V8NV~\s;1#OkfS*%;4Ks%p@"E,KgsLeB.|'~cHw1x %leGg(39WP|u}R@{{Is4G+e{Cak O:a~y lDIONTݸ 5i3r+n/Sa#"M~iEv`(N* GjMHm#X" Wwqz) ='N.5Rl*2WZ@)[]o"~vfh/T M;%9ޞt"&.Z YH) 7i6"ٚ1f6Bc_ 3( 8Ɖ 32 I:7d )=gEHs͚%l֏bP,9#YCe7-qJ"BWTf3K)7>ꓮx@wkj=GC'ҍ99#;X[ά zH|XdfL$ `YidRiyvz8OŐ ^F ҃2wiR!7J;6X~?cOhq_HUH7K/K0`>q# ["zE6KY;X#7̮G4﹩u|h|YLNA~6AD{J dHUԧ7֌p\~e%KPy aD|b me|n)|/WͲd N'.=1M!}| AAXlAwF,Q{y-De N+qc^V+\Rm7Ifo6Kdi&)ɒ  m"hQ,ߠrqgO8?W;iJIkCSlBRl#åRPy<żP\r<@N;a?x"xD?|Tpaki_zw_o(ޅG#i8v̟zD[_@ m≃vξ\Ir7|@&(epmJpAK>)H'+0lj5q9pgLOeoCٶ&1hyԺ"0l_ *ZZ8A#wX_+_i.9+Fd[x YWilSq{N ~=y5JrXY"*}lrß|c;bĈqY(?2WARbBogwcT q8''҇D4qz Y&T~W\ԔCE,1Z[~O(#T:vWNdqөW xCX J/j`LMQPuF]c^#+Wpn]VLПrP#L.zU:M *7"{P&/rop!^6"Op?vԞ茈ޛ9.6YDd4.: ,I Z -%PLjΈLPvrb!ZPX0fnx2d?ACAZ\_ |Z#mH-% &%~/"/e` P IRtO叺nVhj`0Tsm2=zP%2%նjyzIM]<јag`ۇM,H}vwU!#<9 Qej~IϪTX_ǶP{6C]N#I?%+Ry- x%3(*d莹zu]iyO= ?LHʆ$D6 fݨ䒭onyt "I.P#_77o|?Qr@lg\Sl~]9κ36W%J)+;yGZ$ul^VI?PH}-vw8#/Ps {tp ls@R l䩰+YQVިCgގ%Ѽ'd;UOk1; Th 9 bd)WV:q[X`/Z7$!YPoТ(2 aSH3}n]Lwj)w*֊#} **1uy]OzB׹Oz>J*L=qMIׅLbuNK8;yN,o RVzbVvsZ$ۥ. L)M922*bKEF Eܲ !>lY2YzxS0bqId3+D2Wj8+Ѐe C-.)aSeς ѫ#lkVœzG!h_hwqR}npM1IaAg3u2љ I`_ZЌļib@G~H?iSDMGPF$"LZU2DX [@A~] H{k ë}צKIigGX)H6T%\D*fu1=2wb&@"p\@& k$-]߻LP "Iڷ"-@[e-ң+K*T +JD#qN Q4)Lh U%$r?ШλYz}uJe)4^ZbtP3X EYãbV߻Q;ABE:n-)LV/M4d}uLVHZޘ6!iL|c+yԀ =bit:Y A^kvյ#/R±e24*H>p`%X9Jk˷WK"f1\8R!JTmUoдCB4An$5vGXl"eL8~D$Q7$T/פ#wyؾ@S1m\,~{Zig%T'IƱ~E5J &߹̣B6qhN\^$zO┸$9,DZ9wO7O-}czGL4"_F9AP}f U9jGP"o3rb!Gur7E3WoX+X'Eh6| sGR 8jyp:\fqڮvw@cujAӮmpطHf85F#mTEvT0]lU]5 }L6KMr=hzc@嵸!ocSfR PxBiȪ}} k=#Ժbp#y;q]H,-x./o_2v^zi'gmk#vC@ʼw[=V$0xrkw@R&>]/(,Ѹ9Dos1tqchQZ1ثyOat42+ԌP#90Ϸ{Dj+0 8{ 0!,LvӒxքkOMwqQ+܄^yZ36421 OC/Jƪ kiUIpt=Xh#.> f8aѾ! SV6\b7K|d/` 3BH 1Ͱ`qf : ]ZCPiR,ո pVx'CUT(f?*j{fK9: gO޵}Vcw0GEg .DNfɺ``-`ƕ6- 󭝿;X;@Ց,7D|Id;BzCmX\VP*c(ZD'DI,Sw_-kH$FfbqBx`gk7 "$~!ˉ\1'>2Z؆ર`^?zxAdL޿T0L옖lNfiw K]RU"P=˧QR< zVZ)IGR!<&S?&4?vyaZYM kG=hV3瓝 v8?b>%h\O]Aʴr&JV4~+ \X4אS᣿QҀc~F|ǒO[p+mgeYE M%?A*ռCrH8׽R9EQ:]1cAGD)~rcޥ+?0D\z\ev-Y9 j'q0~[BUcͦU= K-=@zUl? Bqǀ=c9-^Wq# gHp `yv'F5)VB#My}5o86fhLr>gd\E!{j6֨_-xJ7 E/t_QƜ9DM7"TkUj ՗niҝbZQ({"-kĈO zE㍄»tjy¢yfXgWM*i(-u3R[}J+) *~|C4[Ս%}G %ݙc3v:Q6wОiJeƣmpnRs4-oS;o"*vy: {ۣa?% Y (m[)}[؄ #]jYŲk`a1Ds&c/䁐Ȇs͂ IZ^cp4Z챭:m*>JK`r)[MMCwbJoWweU1 ˗(~ӊ1.&.~BeV5**Z{^JDZJ .y" 2OMqĈ;S`$<q,# G߆WFYAY'4uE>;lŌ1LRd~/{H޲MɍG& v7=u)ID"Tξ7{ R-C!ae~L:TМ<(CN9OLg)]!9Iv{nbFδk&et$l$:6DR R?Q3ʛͦ 3gWO Z_z7㱛*+hfx )eg1]$zp10EjLr 4DX|7:B0H&eQ/o,q{i?^] 16/-1+a=GE,52l F<3q[JvIͿiiPNU"qpU<}<#'8G[UCx@7=0-L'䪊_ Wv)Yzo9mp)I^K~Z-'s`MP )4?XlЇy[2ͫ Łi@##b~LMf#3CN.|QnSm:-JAw-1Zwc0@oоď3ǧBTwAlAײWC\orN1>Ә3K} |IQaPbf;'*{[H{(+1uYdG 1؃$dTs$g(R^Kn6m9UVe tm fJ#n*ގéڭW;TSIaO'EXsƓօc:im-z#aqT*;6пC49OKUR&"ʝYT|˱,ڮ*ЋXrjA{sڭas,5MSYt-$npS1Qԕ༂N&~C0fhtLBAԯvc*7 &9bpyև8c.Xq# !q㋧d cgg: $>Őeq MMg.Nq`6's\'Q?ѵYF~ܟ-&,92:sQu,CW҂(i`kޭ)j"XdST%@+ F㘆iSi{qol^1~񓋺p spwombolxSZdkMj9'2PO٢ڝ)ts-JL,F3(sXuQ𽀂 {FMî8X5G='㶍Q?AuP0۴P&ȩg UWr=}VFg ^ )ө$x\m jX2xiU4t!GEg7~3U%&A;lƢtv}Ґ$YK,d zz*-_ T06 "< _YX5-*SƔ* dO&*p_ɯ>n`'}4w/ǹc7 )D6t cu׻.ņ"Yg>+ovٕnJZSp:-㨷FgJWR*T3נKԍp^?͑>'ݙYڏ wSvYnI=;zB%5]+զibI=X9BfBQ'S햂枌B.%6S=lf !8>"uzh ׯV^֩Y ,n KnYqVR,`ĕt=2,zshO #3:ӤZp ih?:I?}#J}GS KF]A;nCL=o.~8Ab^ldP3\0lb4; "s7}6*a&p1`\zt[@p[x{D(4>s6p}_.}z-$nw DTlm6343rG=K$p?ŕ[bY8S?v`\'x狢j1H ٤=s]t%A63e$-Kr6"h$5FTsNqMf ) hFo!M~h 2)=po ŔR>pJ"eh^x1fMk~ewo i=H ~h)szjUI|cIiF-c`Vك9MhJeq'lgM yd'& ~^()-Nj.L߄F,P{Ef2;*n " ΧE\DF6#t鯱yYt|٠[4"L.XO_Mb`!W*{ Mu 𩳪ZXLAQ/:ir,׳_.q(ٙ3Qt^mʄ_rF:剕YgO5ϩ%g }>Ȫv]MJ84H@}]wת%϶8qGeD@@`2eUVGs`1&NS1S<gg 7_'U,ݖr֜8]})kiBN}?+=訥Di%S][ɬG]TVd~ntiPx!y c>9o} $-HOsG!-/]h*v=k.uLT\w5Ojfe],rcܔ  /\#t,5i[o`rk?t3 <0 9 s5f3J$H+u.~?!}FqIA,26nҖΪGk~@I N<-OVB[ L-BH.'ٲ`'SO@3sj3,ޡœaa3pGHS1$U~-¤D3"A3I(canqO,QH夌r_Gw)Gն.~9J)dGU9j?׈AGxmCm h66u*Q6fZDNl BX !т#F0Bz2֟9)Z[/%[ToBX B=82ߵqv8"C>t'R%5 5U_Y553?orc0Ӵ!Uv ^~J,Spa|~LncC#oՍaoHpc7KZ?kuC%XgzԙZܠh툗{6e~gKԍy<XR .ʭf/ 1$J 6_&PDŽ1SG TR_uK|$kĬvV3JQ'q&D]˘=\~Pނߍ"KE@No)TAaI9nh@<^5n).SԩUbTJg*ǝ2 Z*s资'pʷ|d*nWC<z1(P7BY|yx/ݐ}̳$喁rQ,~ZD]◕9w{I~l?H9x0 )Ԁ#YS>(:ٵK/?`aǸѪLW0:!IĎ C_s!3rGx~=]ldRP=^ݝa]}sBadpK&Kq VSd?6hUf=dF؀upP)n*<&vu!'|Xb?#_v25LabSO*0*u;F)Bل /nG@e2_w^O=Ѿ/ldd!QLw|jq՚!4G%fc+Ƚl%|/E9Ow }mHby}l5Y^`kpR ,ye[\\SF(JQx~;h'ot6ǩLuQtgsmpTԵ1_= =單q[pnG\5>GIo9A嘂o]ɴ–E* שU/÷*hk#;uo9WJO3} ̪ .m|% XY7z:ym],WZ9 ʸ크 ڒg.Z}Oj\[ ;3}H?.>/Yg.B1Kt?O·;걎"ciZ!0n\:JVp굣HH@ha[IaOpHibu݇&H*6J5dmR<( 7X8`wފ&Tw* ,:/?Ys9h.Re2wY&|$l.yh"}WUzµ9c+VF7oJCY!oEwp'V7 mbU\kseGM 2uU4 i^T٭QI(u7L}=3-JqSMkZWqT˧1-UNG/YR#_):N2nccQ7ɇ[ϋq)z[d%|cIZp; ᕢ\z;cL3^dc'@F8l<2˻2T!XUэ, <{ t &t(nQ  tLzH3ÿC0ºN]DQ(}^H.r!SC76?9[!-)!E:ӕqf0ui\8E^vw sxCVh|:bmc},S:Cݡ]s;=NJuk9Vr!$.s@{1<$6?WxV&JW gU%0Pe83ek@qbb/h)E eM6GĀ h&}Z^XGS.h?%[&K8tS 6!wxh>/%XHn_+dK[M:8Y%_93GYCS2H kpsCnPm1U=rpf{|s|!ٝ8@>0z̒g oӀdcB"FTzXφ "‚$5Api\A8{Bÿ́5 `в.]&U{}?_! Ǖ'KVWoKjE=9ƷTtvFu{b.(̺Hk)[g#%.o@Ej. [̉f߶pI.H;+KNJ٦;]o! ,Ի"Caц$w@LiU6|'b^:Q c@rR1z<,3]/БgL@pE2,c?5+E-,+(|k:egyĴ!\4Nw&okr!\Xm.\{9oΌC8gJ zcey7pOv񀛩&礇=P>k"27*0&կ\S ))ZRPkuPE~>ytw|=U>&-em%-xCobBuEwB$]pu!T- (rKUOIKJ_'|c<-_ƻC; &M|JC@ڳQ[tKmz|(rCofN')]}w5[Mb*o¹ wa `sgK8fazbFL̰zu9^vHn2 0)SKMC,&efa Iߛa1#)CB/&|22;Z0=d^ɔNʦ ֟ze:YJXj,oMHc%fҙo`˄цL( khm% zi!AUL\[CA:<'X>"Dدr岜TF%Z}l#y3VR֩nݗR] hk2o}8>)}_έ?se~^qٌr4 !zOvR 7#)9rr5LNvh+Ƕ4!Jy{F]حb^;&<i|grQ>J~g ,@UFYQ,U.Am=֯ȏn]A'}9STa6' +wdH'ȕxMԫHj.쟘x"McRpq)ch=47˲EBk&8t,*oigҶ6 m\(&"lH2wn`рRL41XXz c!B"R_Z4~Nt\r  Z>g`#9,ЁhqqJvv-+8<~"Z?+[8ΎіbA`Ɏl I"+Toq{5qjLe`!e9ÄdH$8p%!n3 Kr( M0OAQțR$Z),S3a?t^^x?°p{Ϧߟ(A;5 TCDp(j>:sṾ.ŏ|D0bc?B+$=U TqyG =*`.V`1n𩊌HgJ'HϯY[% V\$Lqs an:W?&Wyb޵<YƓðaES1m٨Ꝏ<LJD)5*5Pfa75Rhlj$J0KfT@6l獔^V`T{)G͈m>Є_nlv>3?"@ 5ﭥr/Çu2l"Wf<==B c8:P;>$"֊e^"8WθJ6^1=O~=%6XU.zV^9)JB@C]T߯ LrpgvXc&, ].GGܩh=4X(Tє Ó8hFb)A}eI]\oCKtT  z. 1Y6<Wx w_i1 NY&ZWN/N|n+ }o飀  R}@y<GFh`D  Z g\+]?_"iOI {ؙjuI{.YʄQulo'$qaVi 30(+M@s& uU]>?8u&wL0;6x1<Ӄirh:y$_UWU$_(c_S\e-uw 8F8K_{Ck"$cg?ƪqߞ-F"@Jhܲ+!FFS wx. N hB$ hc/(Ȯ$dR-0a'B-\8+ΏO=~Y4!\,m$Y.uUoo/{ޘ]c L 72O].{( މgi07/B>BXCw6 Nc1k q(\!h[k$bh JYQѩfah:ǖ%r$1V1߷Q+y \d,:aXtf7v&<C#f&hxhT'9 Sݬʪp}%V^>b*.:< Q_yӋp0 C~}2vu͡D~j[B6"c&g$|eڞe2j"FfNy،1exVվuqv?NjXBĞ^uLu\X=ϰ4z"pC2";ʎI@`^nȬ p I_DL=ୃ dOfAk I,6jb7vF]^pI# ȥNCo'}Y'VX{[2̨ؒ?P+9 nΙ Hcq먲 Yg#ֶ펲cL]^4(`{T Vv#b_δd@uKEqA_+M]-7' dP`SrxȢ0b:C;CZe,s`i j$8!l^o\td 8:׌絪4:{.VbmGZW6}4 4*'Xmm,1P dT7iDq|ZɳGf;vʹRsqDԿCK"0A hUoByt [0XK.tK~끞Z\E_yfUw$F57g^dco'~SN3pOm>OL4UHHl>#lxu cT<O^ jcdj2|w i<@N]ryGM4#!~\ =9dR2\֋%yKEQA.@^(6b>MFUol8g7p wp$hQ$`|3=yST})IKxpR)9{ (( ֔UhaC ^m[hU,bqĸ{wF[#uUyʩ#q4m6g2"?^ѿ>ؚƠ]FlI'qǵm!mkl)ˤU1z?%4c1v4>P(;Yg2qWAaF}=F,BM: ;OicQpMu*[{V(Gz M0֘.AȾ3iU[(&Yc)9 3 UjLiG0 ;allon2ġGUl>zϺ 6yRKcJY_$U5`|v4F(HCw7KwtjZ"hdqj[gM @_7IauMbh7\gګ  IiXz*M%V$ dK^P?#47cO9qc^Enih%4_}b _B[sR2'fˬ6>:q^4[Tr,W >NJUI'n;,fB֪!vzfH!KsP7P=>3 * ZF7e@_E`~IZ,37^ƂoR J)T;y~Gf]^?ß8#c @k[Y2@gyEK3ơP&0kF (DyN+0sP;=+_<@jJr&l^t[E=$A3lc'3N@٫`<7+X)O!:UCmgd1ikoI/I >Y 5R#McAxy<#a_po$y˜96KɾU1ƩȯhdgL6,laWw#ըw*NØܓ/] 8|(dJb2( ֓ owvuοκ(vK6R'|,QɁÒłWȬZ MVd<9wcCq[S?z+mF%hLl̑VVXNjc!||^n @T|oPWش#8#"߇|țmO]qRvwX13y߉"g`V0Tqȅ7crJI5 ^JD~=P|<x"cg_lp/uoЈ6w\2x_O&̄ȁAoƊP"tpqߖ+k%vQR2s'w2?Q#+ˣ*Gڲ; k=Jh >K =&'WA <)4c"p|j!)[ʤ)OF1%F̑o,V'eR:#/h(u T FRpmJ!&A2v +uӋQ[c'\{P$h;SBRP=$= [Xʍi,&YD ˠz}úAqGș>ir>9Œp*3M`5 Ft>=.i5 Wc LU_*7[vB շ+y:ZoDŽ΂sGí4 6?;- R/N 2uaun+WˁߗK7p3nWAHnăƠȋԴPVhf}yW !;` M6R4+G2-0n\DAifL]oZIj!%UaVd:Yo*0l %ubhmrTwoNh2 !jLcf;q?1&HPs>)s~ՖFwh6 _q>閣?y]+pq8s WAΛWΣ!9  [8Eһ|vtE|լش[Р|Pbl#y"]qɯ>Ŭ|G(n)Cۆgt)Iޭ*Q<=L*rNfD ZQiGK@y


s1H[vqKc-EJ+zVH H-.!Rc@W$?ޅ5i_K&c.n~޶I풛329UHAtV٩xh% D4"lI(ڹqw^'NIJ/2XsH*o _-&\~L6ç( ,a rWMyid8 /im5({~Tu^DSՔ׫꒥R'BtL&suR)?1Y?E@Wc 4 RCzhɨ/<0_7 %@(*_pv2UNi)_sQ˙V 7g5Nzp%Bх áķAUqOO8> 'î]<'amJwxGdMO]*Ҏ@JxEӚ| 6b<̓IZ@N3qWq@ OBjIg@!%Ě܌ϳRX ![vXR9^ŏ_U*uKJ'|5Ăctb%ߔFKSc2̔}$ )ubBR[FƔL`qlAPhͻRӚ=Qn;FCxf=B\: k$ %!l;kh"K@cf2qA[㎠LXG0&*}0GcK0}zyE^dzKQ(&M2l]Ki42w_C$n:+ AfUp%\~,\CɰG8g;)Ϝ\bw`[GEBQc~@/u/qi۷m.pk)hDҷ#$ˍs;d<Z rj>,2B0ycƱA&ߩ.,v؟V(͝yu;0bh9` Q,ʣn|Gr0[ q M àߡI`g1s=hټ\S\ B~ۘd#n٨ї=@ sR(X _WKb`'d]O#%N8R<_'`wvmKD<זJ%X\ϗiEuUuSK.2T`>G0#oO;CDܫc՘I @ ?q̗3o5`(f ?MJBe塠`<$;OOJĤ,"[ 0b'[a,Ĺ\/.WzYO4[\ڳMB{Lg"jDCPL:8rH|rWыk䯲vi -[^8W} %N!'6HV 7"Cچ: >hfXOvDS &iG̉xɯݲOT t)q@ bʡ;8LN4BzE7*瀉rX? q< +xyrl0\\Q<<}b3n(g']0D*LJnUO5vi=ޞ,2RݳJ1qܧ)W16|R[E`e0gܤwlv&g{HOS݋(Rmaqt~~y +`T~+ԄT+pQY^Eúc_(Ӏw߻-߅>P`E 0/9P箠60vX;] h >07G L|NfnOO-4NQ:`L;/w[Q}[i뗛20[C  b8Fl_ 7?l!/06uhO05c4y}%˧h2:_D2*lDՕ$.2 Ɍc.*biCo/W#ix2E}2Bܢm뒾+5ân`_퐿p/>2?.uYo"!RW߱t !nqǃ-:jX8czbP_-*J9ǀ`G/|RQ{Y5'aj8B2٣=cpK@OcE];>XK9dFVS'do;QMD} /aȱ,^SfHwDƉf[G8*C@p)d Bk/S p ZKX.~9!*Ek/@S7b]ajrTJ˼3pFPPTJ0lJ{_Wn)۹&SٿIlQf+ʽ3}zÍm8 _UU*_6{~?/"Ww]H7=6Hxc1tv]>dlq@(oXSLh_蛋AI-#Eٙq-x=HY}]\9{eCH8FpW$njz7rLVFB-hc39!4, ç7V +ɁDky3EZؚ],)F+᭬~HOp@gy=1uƪm^@Wfрշ~ L+@cC!m3 I5&Cu^(z{m[@kTfLiږw2vtY䫡'|y`ϗQFi>DuF+w|m2P->o'nʟѼxiųetZx/WpIf#@}{>WȈh̹侫} cFՙ MDI Ӱq!rcΉIs)(N/eȘ \\YQbNW]Cl/ND9+? /32+%?gہBgJjig`~j7|˒1e:=iܐdK*ΆP֨ԛ {5FN8dVB߳ȇF0[? mb8n/*۬n~so{=C,B=?TɣsQڎ~i3kMkgQMB3MpRpA$Ra6 yw@Cto{퇯lٸr1(=.tpzB=К1D`Uk8LaUߩ;?_o+%L x숨sŸցy4E)XY{-:R N7rVGv[y{yMk˯ImGJ8kQ2chz[0t:oER^1'zߎBK=-SMBv|;VE<)@g@ﲱr*L0T^xYyc6FX4w|GUU9i]D=oMo:8}=2d4uy.XA9)J5Hk1o](puՅJLǡ7>JOO5BAb8ڌF[k$ŮUѽHIJa$D(jZypCU֥sDL*0e%r3 oԲRRU A(昵8H(Р~@?S{FR8y¾bg߅\`Txs0W^?r4&F)wA>F<|VXH!ǦΟLv}I7j(ǁc:gIܶҙ{h`.{y]]ݩLp>y-q4e8̫۬7C7EcYꜮ}jVP e`iOZ}E.rse9"t#Spz6M^O%txzr6.4ۿizr1nݮÒ&N~M3~ss)= ǟv0E} a7˂4L^=`Ijsy wo5tLZuIeQZg)$@=_  ;k[[ 00[r Oj콷ix sf=̝d;([0d2/S 9:RGgcF5I9<L k.]~YElVri>mMvcDg “V~nn)?i]? ^ _k'+xTZ3q< !HowI`LIn^N& lݤ=:bJσJUn?Ig{BNߖڹAln0(Z*nn7l ^`^\)t!$ `!RMuzFɅC,E;ݗzy;eD?g5hᾨy/.ڣ1 †-rr7g iY5(Xdo\v )/FhHUWbbMqtoQ*Mqk24Zݮrb{m{PtJ3l֜!N*X*/KD|)5@#>r`cPtZ5lA}imm>0+v$ O+J'׷e@98W)!n=NSh]ۏ]Zs/UdzRJ!:7ۈ813Z,m8_l6~@ u`-@ܷ9RSd8Mʴ./N?*`q\[_lxO^06dMG BG "ryɨT䯷/YyaOHwoҢ]/_@\^[7KG=G< Q.c9}+))) ]%ul<lPMRwrO !Hw$N{%)am-c{e;?%tXЂw烷9?r9^//o9l,;3qM&- #')UU)箌$GEu1?lTFs3TWtU_Mq5!X*s]O70A„IMY%Oåk?/qZ,Ҹ/[xĔ)yUTdۋbnRqK;5gtIA]RZ4z~zZ&&G \F Y$+g)P=Դ,==eO6?'&aOM8J,iP  X-6,J0Ұ.${{lpOFG }qj)o;._;D+< s^p2!#="0ߨ X.kBY$&7-V!)A1X ==p۽KFB7ZD;f\@ ^'fARJzNqb$;,atff%ޟ/܊xO"yTE~`#n\-Sjӫp>h51.N1V1sBrpxQdX'pY_( ~qUk/#.f͓fykWi:hpUwQ8Myc# Iًg67}u2,,kO+Pwz iA~mk^$ @JXZUÕ7[}'_W_,YF'h\p.)9=\()I5^.tuRl+:}Zw{ټy։sXyōGpm|$y"Gäsm-+7<t!W|euz 4S?Z 's3J*c'qp.nR؛B0{!Htke%g)#RW,/w/Y0jPq%Xt?v[ T &=o`]ZSCŧY8~rހtzpG3KRQb}ߍ;U|A, Yqi有di_Th}:FgxqMEt_r#)n cE/㱢n]@f"7LJ!rCZ{4rl,;2 7YЊFD~<^ ocC2J,pD%ǯk>?u0!V[ S;r{LT򄯣`2,V7:IJ*d,>r9~xl{'n_:GlGl+g32.^;ݡ O_{t T$yQjfʒ>YP9AXPh? ZDh)>HBjA~&T ɟ_Nc0YyFƷT,ZVf4C0"%!Te\6,DU1\^~*[`~5g:zr,p_^BT8N֛i 嬖F^YyI?a$3K*jiԽ)g~U,:4NWP(Qf[ qFM̫t/ce_x YȈ06>^.U˅Ǯ7 IZ \l;?x'h%In沶xujstGܵLoR4,E8s1ܧP )Zm ͝㣿(1؂|[Nzyid]̫CG|t_*bD9zqf|LPd@ܜtÖ벒)&OZ=bKCB1K137(( إKL lmh2F ^X]6"r;kӏ/lxGG|3yq%pn Ā}erϸW( htD_3Ѿi&~جT̖菥ism jD}1#^o^0Hn6;/O\:!x6B@Q$3TQ0!N]жB|YHzAl.K  ?f/Fe3Jh4A$3qǚ:ķ\nF9H}jXC_%{ Z+1`oY%ӰsR^Sã]ߌmGDRtR^RKiwB DG` ʗs &}/RVzb>KD<χ9!{s+`+4wB$REVEl~1!ҪY6@"#ڃ,ʈJ:r $nܰB2Ô/`z<,P9VT"widA"u2>D }Nlq6oɋ*`4LIz;ʓJ}"P4+ʘAgy^vD(RZHB~gk-E-e~M"Pܣ]Hϭx:WeÝQ ~)i_6(U㶓wpIĀ(teGE:j0%.bO'/h,MYrk#) ʇfڱn;#. -//u ߷Q1y_xg6um3yW&:mpXKWX _>d8#Vyjej(Gٷ\ާO]iUS:ZU Ɇh]?+w·6w_~zA0Ӫl=>Y81Qoϛi@z䞝 m;1֐*Bx>SM+KB*lcNWrx\sޤKw&݊~ᣕ\ ~]^VsO%'!f'e5/Uve,R[R 42T >bR&TD$rϋS*J GMcfNxF "HL%%z-GE̓=P%U)@?'QK_~R)jYGMk5 Lh_+@+H(Q";kIQpștONY %@D|URwį;p"&*@j{>:Iu}dɅ]P]*37пo}_@ 2K 9ζkSGbeI| fLOwwI\NޮxT@[P{ Z\qLYyp_Ĥ@a so7c!5M&ڎ߽Ef[3Ҕl.M.Iedg&&`U6"]eQ]P^n,Fq{),C&ht0B䨹$-lV,[鄩9{xIPQҕlWcQ\(pqE莲91n\ >kX[2G'yXecX>jU՜i uzx܉ W[[+NEHD_6^4UE[ -VCO-{VRmǦsbۍ^خٶz L+&nKU;;.zDMMe=u&;sXl_ Z3(QGϗӸ-Zg-*[zL',N$y#Ԋ6(~hUz_q^|Kx;o WJA^Í܎dfPդ/Z|my)yƯ[|-luEcGQJʺ!2MjZT f3/k+?zs 'Y;r̺;J]wZ=TMd|Df&-'w5zˈJE6ѧwZri韒nrZ)K[@@ɧ4šhe )I9vPFQIx7ϩacm[ƤA;-gh&4'4y, V3kE_u34j+@> qyڭبXikZzw*Z?lc Gw {MŅ[]df/1S4@!Eelދ/\\ ۽~j7AM}Y6ܤU@VjnvŦ^x in5oylد*WÏ,Cq'xT/ 7 g}&L_FB.>^r*Iu%( 0nqI~Bvq):;_wPX@yxhv۳[&> ok'pFRQcCGӦlm=<"Ū/X^y͈ø#h5.hR8o/:¿enYk&w iw,)msJ\~11ek'* M K}+e)ćYq^,_,3U4v}\Wٸ.:ї_KGP7/|q:On{?} )J{>223u{E>=W: reֆ񭞾ha }kMАw {1.쩑(g-}Δ|h-yn|կ/'R?b]U/7Dr~yٌy g[>̹P@mP]]TgӢ{q ^54n.w`s)-gK]j@{ΡФمs=CK'4\s/S݌z~/RrߦǃO!;U5CobFH(XSUs4um?h}{/+: N~PQцVKYvQ>SԘib7e-tjz8^FN_0z^ -eylwO4 BqA$PG( VwM~•Sb3ں~AeuƙFC]㖪H,sƌZA=/$r܇):S3e:;zwO]@2ՉLUY\̯;ΠHAcv֕:ΊF$/cFlO[9?l:q g,3T֯𵖖V Qi4z]6MK'iv*PVv` 4mB`A)5U!Tg_/SN\m'[Vq{k#ov^v,O>)1s[%˪b,[)!m8qaKs?k[g@m6 Sm?O^\;C'ËAi=>Zӧ}K{5yRĩYQÔԚ.کZwOd_O)PMNccNW1a|vًZɓn2rwO늛@aq-Cȳ0vh٤2S6XVZ5/)װ7Y[ݰ6[ƼAJDeuX_{wfϮ/*!=qM#26F4˩cj>YT_vw`?⨷o~w2r#aOQd<~N?/jw--6/;R+ >U[l5py [dFuZ Z1]g4=e4% )&:2)gKNFIBfS"UI fI"Fyò'S5qfpUЋG)sfbj}  5Fϯ*55nB+wq+͕#e{)a[Il.m:Tc\kᵔIGxUVKjŗƧiV³kXq\s}*ߣء':ث,iW̞rz}:b_GˍȺe¹]r~cG*~HoLP%{6{VG{qcVS=W]䉋S= =Z E&Y# =87DtGJ[6\JFGnpE~RTN yWt9 e! xKgt;?l5UG b P2CڋS/ diQ%7/>5ݍ %)dggBڥ=kҟx8^fMa*vVFKw'%V|Lny&H50u}x-:hT] 6lWtn{05ݝ<~=ܵ5Zͽ0sWJuۖ?vtIiXլҵg_2}le:f+Ud)3wč=<)COK?ʮ:0VhM4A^-iz?3Rk[~Ni:bk1)x7 {Z/(ؿcmwWk`1g}hw 72ưp1r21[kk|lphk6> Sovq   dY'kk۫[kn\{f˹: ]lݑ&Oʻ{pD/llc V\]__塃|Iug~sG;<:MlӞ7-\Y/6/[ .흋Rr6n\r˖ Fpqywwz;W]I!6vο.+p`d͜l;q00`zY{]fjes5p]Խ~k׎qw0-rmeׯb3jZiTg݈}ރ6 X;ON\3mY5m܇oJKN~Váq11+bh.,͚6dhjvnVӰ+qg̍KsW.\r˕Rƕ*q ~Rb{*O<ݻv?;V`ݻvs7.\ݻƵ޽ עܩr,ܱ5kN4lٲƞ9ms[z敻vۧm'+8o]3O"Lm=;:o% vSn 0p`̣ ۣyxpM׵6xEmԑc?DwjԇӥƣB|SA?L&OF}nVz49؎\hk_%-~׹w_n8 ̼tx;4l#'kC[w-^^NOWauZs* X@79p`8."T/cf~JiDT.j8ܵ݁a}tflPYqȕ_NeA̯_c%RA:3Vϯ [|#p?K6}b#hթy`-慶lR8FsRފگ".ͫUmlj Ro^/X[JF/CAq{"G {MXp ^F836Y 4q.-`r˖68!z-AÁ*8vո{M1ᩌ;jܱn ~t=dE:Yp+m:ŋ97.ca}zU:zz{*ޥwz*zlrrN:ֺ;[Zޯ9^>;VZ `׹˴B~EzuL0Ge[ ;Z5"I{'TXj,X*1aԞYũV$: :nGL(С>sSqN]4s(ƷvfJ2Tz\TS4+ѧУF11sNǟCeA}w3 Tv5 {{zflxu9z:: ՉTyũP9uiTfZjqNj^Ef[EvON4wӧQ&>4F.e=4Juu+*skivu53,iUCkՠVץ>Gn<.ыwh~|_97 Z #+S`9RYG.p\=n|$ڳ{W + ik_O6q*vRIqߗ0,:Jd;Zi`KZ[%xZ=r0l`\{KugG~q4j~/a;J}*= m񾋏1E/oƃ{J@h 6#%KgM5GOoVc„LHyL<~8~D;,/~P;Fߦk_x~ǡ|ӈH$$P043,dE2DxС.#I휥3zM |iRV46~f_e/7o+QbŇzgڧIz! ;S\Au8JAsBw@MaKc^ܗV'f@j]r#b@ms8꘷ذKrh=*bGѣ`̛)1!3RV(wzlOп}ձ> X!ݷ0ÒU (X\#"bL r\Ƀǩ4f2T=[3\^.Wh9jr +keC蘹%Ұ# /ň0ONEjŁVr6fDww6Dk!gQ}u5NUZ鶧 V+!ʌNQl@ P9'?:)`{WʄhXlڶ|oѨ]bc"  A @*d,?MҽϪ#=,tɲnԄ;C!UͿcP~|73R%6djIh$sHDAMCZ@WaʁVfgi(w">)qVO(σ^z+&+~(9ԆXOroV,Âg*+@+vG5Lzqfh9 {!,dCSu}|e&nz>l}f6ŲxUC6[k-\M| FkSYN }kl*p "BgG}Wцd*AI@_hXb 2{!Lp+oajrS%t@ 5 )m6\!iQu|^v;W0)@,J!JW v'M?-6a'BZ ؂G&l{ܱqާN f$WM\H#\`+ʇ30P9 Wc t^TZY pc,w[䴚bt;{Ks6;߳HxsW~$dbyQ lm&Ɋn- D +Q8>H1tb?$ hW2$twDm9!P=)AG =9* @`?W1)5 n^aIR fzڪdp:Nv(Bp6u}5rC @S8XX!*j ٙtmDH )ض8$ywwHZq^qW2e~:對[ZIVuG/_,,@w](]C0!Vm$Bi z5rr=[]Z\Kct==r :LJr;XaH_!UG{?%Տ{au=n&{35 >tHJ7h=0A7WоҸ?q.0.=GBrN101Ivg0ܘi$Y˲?I#mkjûLVm E& D Y $k5trQ4Rdlxhu$IRҶrB"6$ }26t@CNHHRY7/>d"hȂ`?!ڢ0,x@`>ai  -spz-߾A,jfVØz7Ӧt1› @؈"7LH Hm6D@G۰ Yc?˪x"#l)2ttW4"e1j` CY{w{Ҹ30QDFW|;~_8ز*WwTY"q=I3,4RY Rfs) ɶUYR_uK6Nu~k'+N!)(i?/?`&)-b⧂Jp 8 H\L1՝7痢/k־~BL$% t 羃򟳇NXzw%q'>pݽqQ݂švEؤQI\*+4A"UG I8@Z)ʹ9:B֍Y@"cf8O2Nvs^-Z3h Lѭ#Mrq#FҜAyLBB &zT4c"K[X?{uNN&^7hL/ypnLDs(gwVd46-4EtEۤgK/ p=Ix& Gӑ~EI $ߠ@H+ʶa됣{PP8ir<|{ktQ/]b4Pi14)GwjbttSwV5qO K=#>ʩs7ꞹ1D XF%) \8ޝ;}"k"C(Rp|՟akW`i>Z=fS_)GwYPQqʝ|5T#G¡0BiD `[Hq#㪯E0OC_þgh>6Jйm+T;"Zwfs+I3'#ЦPf36qeevعj {7g `3woȓ@;GgS ɅOQ=?"*=(zx@B"宦')PBR+‹ޝ޵7 l >NFI]At{::^-hM,jN+0ruӈ'ap!L>2Ud9[L ;[=-:_5`:"7 j[')ĭBS?FX^#9B5ԈÈI!c#Yv"9Q[>v< pj%D5փ`O3 JB뇅W {8ΞYhEF7Tf F;/@]SБP<_%45Kl`Lnǝ/|#Ή ErpKV* df+93XAhx Y2r!NRPd54hC|Cueܕ1u$ft D[Cd<1n4@hpm 9 2IE-/_ C|_bU_=y | Ji[@Vǭ(@6Pb?3tftm/` #A `iV>t+K)("]$v5!0*~έ^a 2!Bđ{H"a0"vrPV嶕VF\ Bkt0DCfr%Ͻe${Ėڔ)]+cO<IBh`wM!9_yiӛ?[( }A.:Mpy9k=_Jq:v VKh#WPV}dm.oiu[5f[ꏔ%B`IUN*rr!%iz}7J ޹URH욤3YmF{p?1+A7UJgq%Kasuz%$W˕g)NVXT0e VI |ԍMj Q) (8q3WijڀHv:DuO)xL#*%DUW~DX0BcJ?t1WQiL̜n{Ik6e~0>/77wE!XLܮ`-zñf93&],3OXgnMQ Ƶ-G6z!fB你.?4'Ç7DDDDz.{i?>UOoxJ|̓UFS?}ʺ#[_X*!m!>MHn ˻EAX81E;IԢ"kkT2N %u&K"H"DBْFF{1S=+ubn_muq\=;fcR4gs͊2fR[F,F~:}Wx fȾC52,{𽞮So2ptJ2V^w-JŻOreZhį#y*! m8~ߺ*5x>i@s?q=e%1˞.ǩ_6~f}yҮ$-- B !7g U ))s?7 ֵUo.+5呞*(TXy]]*DE1!BTzmLs"8W[KC;C \9F]2̡BS)mg6wv:,h,„XS*_]>Ӹ2ܯeY>G}-?{Oi׈F=CIy_٬0㳲8{1&jTIB>&^ |f,Tg<7aVhP$yNṴ#3Ru^s[ =*qeXyoY_l9ɭGA-iQd`$%NuA4~W)Mj~tFӞ}Ԇy(~JhiPq J9Nf.ԾJM'}d—t*Ti H̓FO$dEPԕ$fasߵF']?A78ʫLFVsz)s2Y|8+15T?XÎ@-ǂ:ﱋ99LCEK h&jOzYP>HÈ:=AA.Fi#炙~%G_@`9h}]vvOwh\}kVY80 ƸzZ)=6؅1 "bPejw[?Gҕ{gfv*hȦhDĖlxo?:btWƕ(bR1H6M൉vE, ZZXG8 SV5upl N3ToqkGie6=|@qEU?LQ,:>Y$p?<(zG Q?*f * ;"+GaFɂC\J姼RI1 Fpt,5LNY ҝzaТ[^w*;3!5b:#T:Q_ļ/A399-O$ۊ1+, &޾{5DÍyRv-2@Tq@84I3'8֘꼗mno;*'*ein~>k3#ֳ^? h!eT_.8h!y@@6TvܣS.cZ+C7l%`7`&)JWRY,V- e2eT=~=?uNx1d#2t bpSU @!.@vP5,L@[c3d;7~$cZi!}yo}{Wƽ&QXXk ~k!wxNBRD:xo+^N=Sq|u#`>:oJwEh=H  $Rt 2u P‘WE~r+t8*7Na{hbu6XL,2|w &V:Q2?ˏncXy΍鑰IYJ?YgW~Qb$F`I8ezncƇ}͎:cSWϊ#}YD}?d1$$?++$xHt&-YwG\/_4v0dTF(2SPGrIkTJPc7)F464UlfňweƒS6s|81GL%18Q(XWץ2 \=2,~6Y@e 1Pao>ocL "e{wTrid2yꤤ}6Ao7]~5Mǹ6LlmْM(f zEY(#6 ^חW8+zIϿFo˾_#+]1+e} ;5^fy Q?m+ҝdZ>w5l  d;$>SY^{׳6\OZ-HV $J;gSh)-/=߭=/Wss~N `u RMb@}c{sÝMNK7!.NZN> C%(尡|)建&lB =&idx&T`IA'r3ѷ^+8P圶6&Lm\87rB/v/?uT- ^,[~Q08@ۭ/m<mX(0'!KﮟnrX̉oo庾NJdvq @ :An<~^ڽ2@\L(upFDj{"HjF4MHm>Yg <69]  z-חz3z]Z/س_>_|7? f\4\'apo82-nl}-w>ל)hFXy:9Ay!<\Ȉr cX3]eңBFSi]\cuߧrpO1ETJ- (h8t UC GNDI1~ð*#{ 0xԀF]rhIܣqa Q)E~S7LCNuG(S\p3^m?u螆t0޿i<ޡg7O5,89^E!ʖQA8QJyiw7=d$@CyFi)r8L~IUD5vX`E1dQgoy 9 WItH"׎?G̹6_wsMnZ17DB"#zYYnZW~O^g~i3ʻ}o.ۯ׀L"BB>X}EwQ@ަdIďQLXuw筿pl*b _-Nɒ5%*NZ(gڬkD7cs~*2d;7|k{}zn}6"Ro+{XlSe8|S/۴kmBVH,7ǃ6ONZ_)7ŁSsDBٌU5Q¾f0r|lI\˓9|ga&NnacAPc'Dw9:v(_lwLk‚"""OrwoƐʗ3>ߗ4ni){\ Qx}ci)ߦwqI@?w ?=ڄwqk+ixc Xt0͓+T)?nۑ40 +|k=-H FЕ TMdsԟEjHΨYd6=Ec=Ooym.zfV~9ˤֵ'uS& =L(T{ 'U.d-*>&FrDҺzU9dQ?'k*\kd$`g%2, `SHRHj0m)~{G =#<عCU"r?Qb&NO1È0.=I4E!kzvY/JY])/,gPDRD$PH%xxvtRAH@!.6櫯V=|lvn.U4#M Ceiʟܓ\0X !hHw Lw⠮H"0ֈ)I=}Ջײ!o~ ? o-FDtd3#;65 =uL(:%Y~,Y "+d QD_7|b*YAGzEc,@+0P+ gtoka~>X M{+뜧ΦSJ&HVJ1=Y"j3 2FE)39dVPeh$UR$TWUk9 8bLWf,rl[7&9Dsmys2~=ot=ED!#(KCAw}Ϸj =^B-?dޯS1_7}j`>ǫӁm2W(T4HF 5]t*_a3ާJ~!6vlRn+_㻅#O>F.@5XX9-sRu}'8i1|;fvo1%,ò/U^vBg?#CYuÓ}"рr8#T TW5({cf;{Z?ǃ5M4  {|c*RW([kBxt/t$` @ <02x0T$RJ"R'i=O{#xRk5hQG%=ʨ' i+_1oI"mYBxͭFyu~/_u 0i@0{ 17&\<6Obi:l>>E2l~Bs٦?ӉaP+u=Vn^suDL9상y׳P"@ p!\B:`ds% !L) p.Tyt!6+ҽW L&/qUb/U.pq.iTX>`|2xʼX\& BMcM`IYe-o 4k)inw)w) H)RB36ŷEߏj]|7Cp4U+@1+/s@@j4;D[h_H@Je ;n<+be *Sm'z$_)lZiash4X' 1+,}A}>W?cQ3zEj<4^GҥS_/qs܃)gZ uhMv W*7Ƽ`A˒6AO5a#d, t 6lٓ #sc^ies2bڜnJ5:|z)w>"Ч"8]_z!4S tL*gC-L6߳OfӏMr-,KA^A/+f-Vjx@:ʐ0g/*դfB{ TnwŢ ?jStiWB*!_m~gv6wGA\"vv; o;<>ߤ?υ&{>JU+p}H섒{w4I2$é{cr\uɀLʜՊ\ŏ?{/JJi4v͋[mgYk۴s3^un:Β=3˼ݝu{ڛ^zq C! f` n|VCjo׻~col}g*aCMFJJ *ꞁ)W!X-igp7 R0A4Ez! Gjx@X8A:t_/>[ݬ 6CQD}oQ  "]w#5qh8 V6}c<4\,Y"ȸ/6`y Q]YE-^9ņ.0H}z8H%o(Л $\G}^) 9j N~4XTtB؅(!GDKK'6^>+uuF085 vտiy>޲ݳg<>B77?&1pa0]jc !@đߊMQxfuZlgQ翩XXTޜ.40d.[ 23a2Fe`K%~$edXp# ròkՋIR 8ƫFg~. s'xo9_=# !Cҙ0;{8<<#$H$(*pv\5=zr?T %2V9_tP}_/iwT22F,` XpWΟfLgcg` XH'L-ow[]Gl?ck^w Aߨ@f%/֍_F#}82'9&6JoB4=GDGݶj2BqdejOgjpHN3ļ㿥MnLr Q'Tt_FH&TAN!s H ]O,`iX=ޠmtG&RbTBu~!Sc$Uw7D~垖!a:UϬ+zԋk&ev9uF-u` Vѭ~ WQ8~U@~ڥe=-MM}gs d$:|K:B ro8]0ML@r92!pMGݵĝ1[qu_vwM6 lst2lS !b~g^71BHSgXH{k|칾D}߲w;њ}>ѽm@LB`X).T}+BMώHZ0)D/\6,!|p䚲N mSz5?۬D/Sa .1iQ;a$jt=amt/ 0Gqd?a~wDd(JK%!2{:<~HX m@(QD ~quHG M~b*IL0%_`;{QW(~} %uh:%ΦTT]toKN@"*m9yQ| oPlȜ\;gSÕBC}b9]G=QMW33WK~lq.ٜ` gMcdQeOǙsU[}S{D=gX2QYzaH,#u8e 12rꞑ$:¦.<@mQh]Θ#qwtӔp;͕zf<'A*C@R[sq*7@r!{ :=T NJ0y]~gMO,4U{ٔWz])Ǹ*d>ϊ?,NoZfI>SV,>vz8{!N{"p O$% l糍{][kofdk'_bl:V>~-Z't!Q.I_~'wV^ofEdBT%-&{+4^2dѾw <}FEe`iUz&|Sw>w|{O2p^-o#u:?>pFFTf/_ +iqW%owpCK NRw_*;ű1sE+H^??kgDzҊ,"w,GcuZAu/cL|4wOso,Z䩮`ҷiQ,B Uz $OgXxMzHkۤԏOV+a?jjxTY6`mYo_I_]uȗflܿ*JW\.6( !nYW;ܱSxeS{Ѿ5ŠgT@BDVkVyzLrt?^\P+#{7mk>pR-{=2hH?0>uf#JcZ}9'K(nFN?8MHԔkUUATBB BP" }N&WF%jxgOkv )jbWdAȳب^ٍ],0 bͥ n,0$G'l`2s;JC 5"&G[GR@4>3q6@~!I֯Y =[#$1W5!9D$o2!)OON06I'v;]]7(Zz.w}#N9/˼{Dmruq5/vߤ$?m$? Iϴ´(YBnnŻaui > 0?UvVqTg7 6^\ȖڞѠMsiݵ  dņ\5Q-Twl/$ǔDq (G@޼pcS=Wam̖ V!8v'mgcB|޲<2,?n'wZ^f:O;H~ug٦ݠTP& n<\&l7+:6M%HņdA{c*Q"O—BɶAM0\.6ЏQPG& b.ʢB⪡׶H K(9jF8h"H(L4P1(Y#=L(H$GB@GvT3`TAbd22 ҩa#(IA.0D d:eLIc zȓ&Ҡ "H$ d0r0=v?)t0㺲s*b@Og%Ԧp~^yq)zg<}S A$O&PU\1l1}}f뭳QZз;a/%_v}D;|GnS@ъ~)gۺ{ c 4{U8[\XesH?$Ws5 `.h@D A)/2Y36W F4,NJ]&sETXbhSC#JptUqAk+P/)%8J>,܊ۈ)VCy\m\gH;E=ݘڊ^W1p@"Z5z(F`DUЊ}xy)/$Xg5{ݩ|O:ౖ{?p{;ͮ{gܵR6-}=ZYLb Rw}tv4Ҕ]weKC]C[.f5F?#ퟫ@{#Ԃ$[I,=6_ f3hM6QyҺIsƅB(HRլUp{rJnDJ's@9FT VX)1)d/0Q7Dη7:xq'T8bLH{!``Jf%͚Ec7IMNOLZ[a2]C+`x<44ʻd eKSc#tn _4S[zHžJ0H/}w~@nrCx";9ؘKbȇG. = z+5Jp-lD8 $h䷋e^R9kyyp@̳õy(HCŊoL lƁ\*?[5+n}ƪ=kozկ=)]}gMˢ_+TC阱g<-]_,-FD Em:]](NlCޛ͠EƋݢ-})4}m'?&ٯ1}~WǿwkR|.sbYơ%$=!)B)B +]>g,_:iͿ_?sD GDY:}Y Th/JՎE0)aQkʍ{ N%q)1쎶NjI&s-a:/{_g{w﾿o3Ngcw-n$PqsOB`͂kvmg>\joiKNk![T$u>lRz_3G!"ZھM^\Ne-5zĺ+nwMG{c!M{H9F{DOc?3*2ʐc[p~)!\H299UirՖhXjCX*ui V,@xrJ4Ɂ̩ =)B_cu}CTL Ȼ4fE#'TUU6Hh#w>c3o~}=}@JĔWD8 bk_mVۜ&Slx{m OfwTE'ǣ),9Ǎ_ 5_2bvr> ]LEDqԤxO)B"$REF|sΌc53ʄȘm7drfT)N je;`EaR{ݎZo֗*Doym4yoՒK"ja?g+Mf帜V+]*`cUd(P J qnApqs6C*C2 X3q)wO1y이O{Gv]i@T6fvPٔueKp C /4!&JX}_>fOMӇʟ`y,Bo_Kcl[YSfo>!eUQԁ}e\) $'!@ҁ$=Ŕ{'|37 K>?h! X6^3O 0bޣtXS3w}VmK\¨~ ƽc—Y(vA[OuzƋUtĪk!p'AAb+G.Mbӂ1^CsuCt'B"9o#cwd)k4n}I݁NIޓ$y9J9mɅ!Q7Q g8$t}G)鵝u;s8%%О_NTg_Aч57;E@A+QrIչ{0NdffSMR@6omr6J:nqHMmbH(nuu5EIFMs:๙0AyL|Ncؗu{Sy&oCo|*h˟KMŰHzW?`Y+]67'7D`E@-O =t渪m\UـuİiBbZfyn.;csY:k]&,Iw3۸ K~ߋZ]bwvɞrOsqsYp"qaTO7)g"CROJTCkvbH}+ aErE%lB|n`w QOCv{oɇ 'olӽ3t_mnzZwqP鶴8T`a5ht &2lxI#D8\ D#sfɸE4`HL®@mRɡ 2H8Hdm {nKq!AGLwpuustKM3"noUW(]wKvLF/g!yo79g WBX~55Bf.*=F_Xr^K29T^W#g "ț$Rㄩ8S[mNt=O˗mxo:kyRvUͿqt82 R+–…-zJ:Rw!RGk U H 2\Wf^3yxS֯ Oe m6Wk|2r;cj+ϼg "2AOBq2nsjw=_$z~\½@:fVL#|% P q!8 DyC(rge$DTeeۿǁAEk,{[ b:T!_SX1M̄(`08L F"=Q=~ 0h8|*7J_Ϧ`ce~  9 TB g"1<?Z lqs=p+޷k Cr# n)fU!zDIV]1&^dYԔA+1w;# ? O Pwja]'FdA M!ү2'1a.)0SdG+)b'Pn0LS5|Tf1d@1 @>!ST7,"װlx :M  [Ξ[RX鸵l+,\LOw}xr7Hp!δmge~bNγ:ﳯ;'eYS]G^3M2r ",~G}?~30<,'cmy8Ēje+PHq2aG@U t2=u$$ 0&~z6 uQQPS=5I. ,'4UfzZ(ͯkSGF,VbE(VW9D#l:n}%4A.GZIyGr9]^-XwZXeްvu]#KC5px^=5Ǚ5;ܒ ֞G'my jz/GEI>X}!GY)6A}Wm`O?N_A 4FR_{|Mճo(.@*Rq$cdX=+mt15bW=iExʔpt1?u*jp`D[;2yD $Ib#5-KtYSl :ud0-ňYG=JbL 1psb̥筞 z Gxa4j)D"MYȰF36HlI/\ceU$Tҝ̟eXWFf蕛$Q1,D@G[ <O>+>#h_QoD07* wj7 posx  I'A;֏<߅Ozӏ.4ǯYI)e 0EI^AJY.2,%qF䀫gߒQ$ޖJ|_C~WUI]8NH Nˆ;ȢZW8);3"gߘQ64薠oDi;KlZ]~宜&pɰl@T >̎` JQTiT|Ow7Cڶ]{=fk_&S5.`g_EZOk"20m@1k>=qtg%~ԅ` 2&ψsQ$kbfP`IA`mC$è9F׆EOx M:QĄ\ ;˞`‹Y*(A l9 , #~s#:\/Pبad$js'm}) Lfj3wluuYmUG(c?pVL `eH{ <]JV aew, b2+ );=a_~?w?{|/=[9;ڡ˩ ޝ5UnjKeA#"HDxW#:]gL#~>iP]"{?@#yQ4w$;1~޹gt«ʕl'P@'nb @DFO OC{%#=z< tbefN/ fl =2|vN#$X3}$$0qU@:G0QO`{rƿ'g0|ʤkʓnu@A~ί:=^~fBJR.a^GM,&&i5V&~r +V1]TVk]x5nVDaZ:Wc*9Ndn_2}b/]},ώ%i[ԬmWm:6 3Gܻgr?3ǕwD1 ݃ɭX F I}!BiUt\8ZwU'? Yca9)X:.`كjݵkv9 +5½ wգ"?VY1N܀\C W2vz% -P 7úM;-Q!uUPSU}(R%FҜXǒhGNe|;Eɇb]o[2H &y}p|(c8{7:7QT Q*  ;Z :H鎸 2r9KөR0 |q;aV|ApS%P"XĖMM[Cṗb]ésafi >C>k,4F4I'e}"Va$#}e'шoC,2Z̀DM-%@!=3ϪpkD3G9U? TהcQ @N[zӱ[% m7[A3;5qƦֶ{ߣ*ygU C4]s;buD@^%b_lz\&ׂ1 0Sn*iA8u5H hu1 BiUڍs'[˘y2Y C(z':H) L  ` rvyP* ț[lZO@2yxua&O{ƔU>5H&D5e ] ՇO |zNlL(D0ai0 ZRcGl+}?gińbUr{k/ CU2 (Lny8x_!HDtLF.=;rX$,3/FX=p B%vPa6け/oX8IhTHWX Z4ۻ_{x71)t 1"$pc(@ۋٌ{K/y&[)=Hu%?pU5j[zjKj![DfヲqwAߙ2C67eL_F{[9vQYӳ!@"g l?Co'w!p+2q~f]0 >,39֒:nGF埍B&I0,0<|e6C;zBlΆ]cKhSno+>g_Ǔs@O$ ވ6l8&HD(ky328|ZU}VIf{꾖jL{NŌz룴#f[u 3m( fۂʂJÛ77?gֹ֝|$FMOe<5_"MOK9#9wѿ>ٿa"?N/5go-CF ^"־\=j7Cf˃LT7P!0z*{DuQvh?k@p=aC"[L{x_?> '=Cw[ꁗJrWJZiyshwiA*!bz3<`Mg]mzݯ$! Ij.!ũGlUVC?%q7Ԡ@0<}. t'{NF/z6[*`c+bB &k_`:rw[ftuң1Wpr.4}>$T\lc߲+78יhm6pn=OC5ĽXܼYtp 8%15i Ǻ=,DpD]wSR!)|mfcTwYg`Ms}:KHhE[lQ*p-_v\NñqS:_|H_B$aL!0d`)E+ *0ɕt%iO89莵aES/7rT c&gJ.<o5&k̤hOX~BCP@?ūOci| Y }L!I8dɬ;4UX-k^"]js>޿75 @N. U/86pg39:)Gp(4VЪPs{V(ohKR Th #OgbLZ8R*9m6>lۺ!E&ǁZ)M$#9x LI}%/8Q"b>hBhoGb$*s(Y{ ؗŊ/n4G( (SQ訃bݻywVpg@sSb՚ %pǍ{ &|!h")Jp 1Qvgq%q ]]x r؎Rd\]a yKJR>LHP`CT>wQm^4hcO34VSm~UƙϫYpyR)W:qN|k?Q9ɥoh;j( B iN䁃r@ g%nX1Z z)"F葢 $X9\׵X| +% ziM | c=>|*wo-Z_=G.IaJQ|zM[MۻIݵQ_ZM4 j~׃9|.-{Vݮ M/j=eka6{Z"_02luS~grM{B]jo5q߹*#Q ,C!GHߚ}ȿ=w+|t! D%$OJ-?1H M2l5 Zv/6Vnqdk(i){vrSq|=R-coJAo?2 erС=?+VqkavU}i3; 66eCv0ہ'a C| ^Q /YQU:Q ՟h {ɡ&'I`[\Vt{t4`r@sW|B_AΔAcubBqj]MvG{cz#m;HKv(# GlMqLCA Z_֓mQ?|" FMgr~FmG!J?HcVnnRb Qѡ1?4ʡi,݉%0 VaH8c=k-*p`І~_no\@)|˝ZXu"w =٣tRaGv-HB͍1F Qې|1m]/HZ~F+[LP ;hk:1 )A@)~lDuY2E:ڦ`oX@Ti4mǯ9z?#?s9G? _@z8jL é YAè]ڼmωD =-8v^wcHaoΔ$a`y狻5)O|eDC,i8]WQ$A2UI?f̫v:{e%T(Cvz%'-\ˎ dZ4ZIQ`pi8qg @UƂϸb١4.ߢp (?>|s7z+oiZ'{"I̱`wvy9'{/}d`qy-Mmm M?K>vިWxbzI:T@8Q"LEy_'3Q2yֶxo`^UQ$UEPy#1?[=8/|S6AZ01JfOp?nE̟Vyd訜p,JaZBIxb?\ bi GR(x]lp V bU5y̤Yy@¿q`t$ ϘbO^pűY vHRV `Y#Fbյ{W#NI`j p?*R4J#}cy[D2@ ]Xuw1EԢӀG"4BfF;9ؙӿd]C{IXuxU1u,ŭ=*FWI$Dg*1@ NZN7ir}pv%:.3ƫ;5C  =T&F@=1aZU`v !uM |÷3l(G3x? !0T#)p>$HBoAJZi5ѝ/̨Hm➰є@m ZExޏ?G.^hf3a0YoɼۇXTbR@AH,)beQot ^g8"BI#Js!PO`\NI<7A( yUܰ(pl!nYumL3ԞG+, m',(!p`qF" ~zy8Q=*(Nri+(F{11NPw\3B^Z#}̕T/e4 FBv0C v9D((Q6ZVZ_430JD}6qLtE5 rnhc@PD$,￷oz';>F MX X)#$ mAL^1S #~uQHȳ1ū Ec`* (8G.9{f1da` iE :njpBXa"Sud 'MTɘ0(!DQPaȽ@!>h{?;kc))Jqh:W¸$O,+DZj).."$p"~<(8t6qb? }^I/ iq~`*`"{bЎƕqr~[C{raAʪ#'[Uϧ0tMtyTkLޝO+:: q;+M5gtz=F3ѯ9,'Goh*j]YtÆsYç6&rR գPrDpBT?^~_pv=#!§O PS"  c'+-+mUͱ4"K2 {}MRe{ g侧%G^l_<qYHh ք9U~']THp9z9˳JeG4;vJ/"ȱ/>GyEzWǨвoF`Է(]Iu*B_xP.70=t=30 )vz^N3l~D-M "61O&0 N(@9Iv Y$˴Xp7vvn;!jPBw{&+K:6M`(^pE{jJq +TOH 2`d'[o#eϼͣ\ӟ QvcxQ@>k~)]{m"TOD+P,\@P uB ^\d"KJB!!B x_6`{V^) Q``2(* s$jp*0ȶdЄ@]{HYQ` D;37txtoߢ_ }@J`/[T"H#{+3s;1O& WAr/3YHZƠR?dܚ)gYY}dX1d;8w5'92@aaqx5{G@p8k1qa{$D5 G}`r Jv`:ũ~uff! 79SHٷ;_}xG8P5hcoczܮWжo!Eb;> 0 F=T^›eXUM0#H$Y^ ?cVHPQ"qJŒS-!?^}x> ь2,_'S14C \Yo]]P4lk *}-I ~Go/P_,-ڄ\!eyjgJ#Ǟa]펢` 1cB@l6;m64&M[t6TFv,l/G5+I}Nŷջ?#Xq$"@ wtR!,$6 \uI XBR"@Z;=*8{8?ʾvztx9H1)pblDTdFG6PbJ|13lr`Uޔ\c~@yb}o#(T\5.:?}x.ԃBoezR|n꽂hf>/!xR(4Q^.7TRtxa6dXlMhif=YU&|Mjd.L.j؀Є0!. pCe(P` cxUiY[KUk2w#;֪JJ[\a/2w2.6XFޏrmch{3o*# z-@ڎ!ա4P!.wPVj ȭLj ";Xsea$^/KIwOrG =o%RБ1XAâ%uO7P0'A{e%g([1MeoyUО$5:Z ф*• *Bǚ'Ǿl -ܶ ً5` ⓔA/<dS m[†eB#׺rt?,Xgdɶsz/*_M~ѹD~mL~c1co2jf"` :4snD:i1o61B h9 A7ċx D>~g>KzeAͦpG)Tp8|"xrп4e ;z!za8k ր;"?"kqvM87mScT"<1čS`Rsj!lf!o|| F.,?=F8 jX.s ;h*qӈK0(B"Q]cFj19S_{W`' ]PL_j@Dfte@MR%B &MkAj$#$| aϩ~;dZbPC5X}ْ:%ؗf\6}J+P㖨.ω9sp@{I_3HY]ܣ zyAΗì ~;uw^_`9FZtZ=B8:24j4Tt>y]Z!w+S Sr:hlfEsnӌѥfúyPY>YEL~7,eNb~10=UHd.$RYYIW%_AL#7?sw WJAܿ3BR-ݾtLwNoOJ~Y}6brgʯ/;.[@O_I rGohZ8T$Kn9ԗrЪI`wt黽WCvWwb8Bo׆T$'d!(z0QC`v>Ku:Vn[v}nag + >J##vipǫM}s%Dݮ |7uTw/C`΃@;Y|'}N:PnSU'MSK~ w2ZKb$Dammz%?D`xmɳED"B:HhGuĞ6/r/k9nZ0*zY..sZYw[n;β/%Yp YQV_$E,Mz~TA^xb$۬Jl@mh]k" h7+s!K`+beiM;M~G-$ ;!0tѾw1LӬVCYvY|%׵9f97ƨ׸us[ _t0G;ּCw*kNNZ3} u{hrS+\a m}誴HR&Fdh@$[pVJ)ped6 Llܴ%,RhNS͂NFK5%2"@pH8wK֭B%LGgyH3)ֽծ=4wG qBWt/4SAxX}orNk>M=CZ?2~6Evm Wo߻wc~}MO-F!Hj J/Oo\{6 xU?CZ\rKN>}? Tնe+~Zܞ~\`_Ġ YFok [(rt c3^~sEB~>}ܸkv6i?^o?RTN##ȊͰ⪳Y~>? 늴d/B"]^bIKcs=WRD+\gtNR>e&OYhCǥo"+%o~Zu0.]%e̢ D2Ȇ}?R'zǽp۽pu}ulswC'yUs:qД߻QM3!^%$D@]6{_kb l揅I7Z mⅸ{U9Jl%[߾Ph+ }OMGκΗQ67}RѶmu:f3-9',#ʣ]p91qCpxJ#$o;f\{G}ښj. R7 @QD ʪ ~Q<;@1F x}ro-/"|L`vaXտ_[Ϸ($#¯'R `-rZ[CE+r=R:9cb+vKֱ ׹*H,c6/C k3M9} (H%;4c9LT 'hʖ;(BYD{ߏE6[P/TplJc<ʬ*XLǵ3m7n.l(ehHcNuIjlO2yW'A)_+ƓV!6g,/f +_S7pPKտ8S9oem{P2HBwO{]s]F;A!ʪדhb﷖#T]N[|OՌR-Ѯ 2(=*J95N}-220R!)kjmY.HCֻ@}g(ZQO>1翃etyX"}ˆ/ s|}SQP@ |I3 bCH4#] I#9)B y4TBiD B:X3tr]0c7/qm ERҪQKA?Ýtw{|^,΂N#jJ%Yn`?WL2샿7ۯ::<>j+:79Tu=|us!ۧ98q !B!@٫^KU4>7g),6D«{Ee1욳fɥoL! ԍ5.JDoGmfw~()T ~>zRd*&$ՙ@$ۀLs~?|K+p4~-G ˧9ǐbE.DkO2RezzT t/+ݞ7#:tܥ y*]{H\EgexfB ş BٝY|sc{#e?=Y+@C,YDN]Q+jifɏ#s+YhYIXؖi}Ѹ:*Hܛ'_qcz\Y.3%ܜOl{~tqn#- G&[zZ/½Gl"Bkt_uPR[$oRdpb9ê?ZHP-Jv(T*x̕H-ô fSzbBݏR# ~w>*u;NTm4VQ M݂AN|toƒ{_Q5Ojpy &':k0Ac.m~ F8bv|T=xR [ 0^%q8MQmRP`,[=`S̤xWNYH4Kr=XHnZJhơJuIn'}sk"!V`O)[u5/:oZ*l:T"% 1  GL//Ͽݗ5h&nzj9|#'KeQ9n33VŽ|<UϢZw;\r$dlsqDUs䐻䉋9.m7Kq&y:~rl|`xqW IG5rvH7B1e6ːcs?}QKgqt??gҾt1_z9NM$ ^b\ $^v}r&BPޏgA+5ҳy5 eOHEU[<Q86k.HԂИh7!*e=0O9RE'0Q[T |?@ DFML,ɛI"ऺL9@O}b0hUǾPW %^bPΊv;MOCc[׉wl14MSwF(´^vmn6}xj[gO&[ֺW@վ_˱6v9pt}+r CZ?f.c?cMpxhq{l 1(M⨐óH-z TqJmP)s@#rIuuho 8n_3_Þ'7_bli1DGN+d=]rRF[*Xq f.d+(%{xgZQ&JM1,m ՗ݕP GR0%zNA\o#Z(?RxdǐΗ~?^oT@!߈g;>쎫nl6MWefZngu8xwG;-\0h^|^sqP6ȗO2 ? _Y>f?򦄗ۦ "90݋;C'zKqw Ƣc4'}wO\2OP](V#PAn$G8ieC- X{/D)ʠP\^j}h8Ȓ" Mɕճ]pۣWᢃE}Vt".B*Qˠ%_s|O>?5p[++K[,2k$BCŵt !@n 7khomWA'HiAhSIx+k7pnH%Ac!bfs=wS`̝L )=Ag8 `-AB8. 9rqZu??< !*ڽY*NT'c᳅UIߴjQz]J ָْ5h*3pxm*ƍF2? 85tNR{٣86RȎ$mRkJqс+j)Jw.ؐC쫤| ߩ_+Uo_BeVX'Erib,<# <.^Sj8ri5vþ0\`H'>f0{&m'1ҿTaX .u',Q)V6V~AW4-p=v/cݼaT|?EE9cx#﷒Ε_AC@e:8tsW+h47}>1A/!,L\Lo[}Q|')ʝPǃ'-Ñ\٤d '>wMԭ_9 t鴆uyCwiq k1_e>r$+\70bű36h#dQ/ UI?M$ؤzuVGwj)wy^,OCMsV]mVF^z?'`f} ,j/C&[Ӂ.>gaM{cgID3Pp؟_ZO6۸^O[cf!<=[)''p$݅uW%OX~/e'&=߰Τ.I=3NW+``}~Cۤ3rۤ<wOlrl$+P?a|/<{m/t ! LS!ChzD}C"~vBrBdFHyQ`Cųa(0WEN~ݢK ,m;Ϝ`:uD㺹_;ܴMU*- j*TG|eES,ЩiU&)"-L@.WzZc/R 6tY`(tEօM[@ .j!NZqfLi̍1k6k v6\ b:>kMyy;N5 *Vaғ9kCN@bP߷Ayo弸ulӾxc* 8hEEq^iJӔ8"ٶW~)0eJhIJmDiBU Kʴ8o]#ܹy*RP^@w!TS&LI0?\yO@,5*fYg'Wcjw,To٪VXoTjG>,jGCb[M#޹ېL7hu3e2G|%LJD؋ ]}Z4{+ǮªX\(G5:ͫ Ck>%Gׂ=[8,8*%j RFi n [-K Jo&NZxN T컆(b _?fcciM;eqoD=>h[8zi>_Lɵ\+ߥkQz&d'AyY#p?IgN-@UMΝ?-a?87ܩ/0%vQsXuzL,'{7]9y*jO>Q&yI>\upqtJ:PѺcm|/ gG3$_7%YG6H>j%gVOF-gJ,آϲhtYީF4.Kl<33AfH@0ʽk.y[ݾO2x]RI=ÛQ ?:95:v4= GNp7ziC;C w&wr^{:l6wgr7ǵqQjfު`?z]˫f*Ń1S_~av%l273r gIڡSE toiCKw%qp;":.i唂5|NJS{Aդ5T^SՕnD9#%,N]q S1t\y_ ?C|Z{Rݿ4pqL~X'6֎*)F]sbavTc$%| iМS?so5n'f#.[Ve۝tݺZ]:׿W}'}rE6b,V-)~;ݗ`o9.)&(?&zNo)f۴ލsa衬7/;1ϧ[g`[}f!951Hw#r糧hwsX;/19ςm?2va${ޙTڹUran~v*fܷRPMu&IM$ު)o>We%yMO>?ˣU%S(_T>Hw3;2;mk|V׵n|UKQKp6֞lZY[LnsC.e;9vmǙU@04<:3<`‡[f𷊽٨H`s׹dM\rjW:)>-m0c e@A9I73-ämfqE<+)ަ3|#ä>[.*86:_n;4Ei)i o8EGl'pzgnԙNG>^1txhBW_U/gPRJ_g:"fgX*1Pz& 9gݦ7 8=%R'q4\; ] ֦]5!{Ll@JlRB{Hd:O ұlѳX ԫg 2ls]pUўKgkbF[^" $O>1 \IˮƍH02@'.z:<uSܩc9KAW->B2>,.`Iͺ=eW6x2..Q¯)ǂ$ \Ѣb;45C| mt 9SxL#;ahݵ[k(_~])i3;&~o+Cl|S>yvZ|tz޾ߙy,㞽v ޛz^L_8l/vv;Ϳsz=Yn,B-oqC^}\Aqrx~?&>=/5woI< ѻ;Z?{wlG̬a߉~̡?N|wfOӰ|~g}Ui yhN7M68̗cx;ci l "OaWσJ'Zrng?W|j8ESA fpС /kU)oWhhw 'CFf =ҏ% ⿳B/~@nApqD}_Ŀ_ط{(#U}${o苧$Pw=^6SFgS9deK0!?vuH,Q9?5<[yMe9w<6VޟRut ͧCsdo<~抹L՞356y>6_W']Β(_ڶ[cu{ O uXudV7?Y> *\%L)1΀ 0՛d^w{a_2/e/zeZJ ,wRdp8OB/q: &^ts [eHH԰4~;pC`C'W&qqlҺƮ⯪UjՅ I ^\LpAxVO9j߳QA=:6Lv$*i+\{pea5>k=YEC]Br5+Ï6 X=ϼGb>2^kMy,W~*Ezȯ_Z3e%Z~y~L_+r>qNHt:yTN3ak^8\.,mKMddc1ʀmK/ 9/2T\N~yFqqY`&xz' _{e rȈff$.*ZIζ]`eu°zaqk?~Spt\vfPN8?mvc-d %? 2bhpXe6M?esqNGQ) /{~ж-u4.'O!PI 7St?C9e0qq7c__ib]S9T#k:}ÙZث<"ƚחj:?|rބgoXGrLxw6*m.S{.Dk[qw1 އ7+|]U8 2Xj{IWtf=k|:T 9 U4-RYABxxO)dpPK_v|qTcdz}|3mrήPPA)G-jJ:NE莘e :@abi ha%ov7)}&lӏž^k?f5G&E7֪wηD`A񃆃N-GIO;t&0Irzඵ%-"1 Q!8d"Qeco/ 0V֦eHE2dqH֬"qW%yTʭpLA0#DN*@U_vӖ-F3`h4Vk==ݰzvvG~6 Yƒ@L뵮'q?%\C3oou[G׵yV{ =جf" IPǗV] nӉg2]*#Y{D\S~fgWVҬQZDg_Ho aՐP]ޫ`43-JnХr&$D<"<<:ƅ$bŹ|McYږz:T8V\thHO<9P wn9)}}4>vt-HZXdr#|tzr1J<Hax\;t[\Coo@ J˒@\7 }[n4CJ;8 ɳŎY8X ڦ5u%&s-i5U\Aa=ιߛo4gē#Nb"@(Lbj9BZ&a˞@đn GÇ&@*yHP5f؊4[BE 5|0o$J H W{ԅ nyNF!f}'(Ӗ$ '#K4eUwteLr$ɡf*ض֬iU?(4s6UB=]5j(Wf痼 5yJ9&(`2n-xN!Ԕŕ9 \3N#Q6Mr :"ҩh>9)iG9̜P=y 6ĮTlyƄ[ 就f: ڶ4A!3=4v+hv`c &͗(xQ}r >/z!U *`a\#<3K>YTP>]opyvQf>KQ)~!>"20Ui98V|I@H[ rZ+ }$7ɾҢɲϱ`.*s*kG#5c΁K,S\p"'fs`Pȗ 6$ajFFc$:Hп֪zI2iJhRֆb gmL2FmˍN.xk<k-f r.LY7O 288CzHOޜcaU2Gn+(#P"XpF-\^s {]9gށB?'lp쵇*Γdg94$~$@Yf$i)n6ǎ[|~̶]+[0d!1 8(4E"mF(wes9YHO3s"&jFa<9ԺM!pOkZ: 3ڐleK7GyXc"^To9>*’4ʅ'YTG R,;KeY8 Laa!N ԕr0LY0{aO;K D/LCd2Trl$'<+ VqN'Fȫ(ߡ6RәSk:uK;r9G|gPKL ڐ՚^(07`I1.0T6ar&VةCȄ ,eŸ;>ѬavU@b͓6"s&Peflo̺Pf))CU%À Eޑ|mF'cR}PPȅ#p) 0ҁ;\R$A6`o bp j^{ÌM`q U0l}V5JW7UcLĻqwafQF'ǘ ͓$M ZF KFy[tZY̳r&Iv;E6$1&3r0m&ku7A4(M94r4A0(ܝuPpc9Q'l  0YFn5̺L[F|`I  l:ok̀Æ?tDwNA0BbU\)Z3f $Gέ\!npoB"G'w/96$;$vww#d'o X,xcAihD [ H"$iQG2P l00{[E-^!X"竿: ׌%e" f܅?< Gr揨j@#Wd G5{C'XQN;S˘(J/}~}lyeI pX]q Tq f=?JMT.w=4O7m5hvށclH3>`&1ti |4ƣ*A (uSp#AB"AOnLmVN3rIZ[~vژ9cypsOߛ+nMy\Xd-$RRҫ鑨*^vrձs_~ٙ_ZgQПfLbcCk!= \gȾ6t@c g)7{ΒE~<V&=Bg?ƦK iu9a $0H>8i@%}]#)/2 (4/ϼVxa1LMCu*ȡa^'v1/%nګxͬ/k' \ëުJ%NWs?[ e~Ѽcg}`3M}\2ez %Gh)@>Ȩs@%X~}5dL `=H][5?mGI񿬩$-RXQ.jWHSBTg u *?S)yDs?ݪ_yl76Y %7/ [3Cpc}=]nK#P# rF%M*ņq#KҚ: 5?fo$E8dRD] J׏2v.ЋsLx[Ҽi9 >ZSyl̎:)(Iljt&l CAbI"VPqu۸FXVɿR3!EO0ܚǢ,n>^ ިw{wZgm:<>:JNۥFuq[{9Uz kQwEBbr9f7#2ܥ;ن/.Kr>m Q$h_󔇽5ng󽻼?ZZҙ/y?aԘ_1Z{dJ.~JI>>Wݘn+/7f@ 2UL Ukrk[xQr5lcb"IwN F#??<QlG7;* j>޾'z6BD"B9W`f>}4I ٰ" o#b甉 Ֆ1mF^0 \  h=2'< P<a1TG@ ! 0c:bp2fkjҚl9`50lǏ0I7(ngep\a ZO C+qar]'D؅THQD!ݳU2(Cs>9-aXt)P+6ma%^IɸDąo0y|1M+{yhq6=i/Yamg]ߒ_?l=>Q77-!}{ֿY?*iNghvG RGFչQ;a7#8o,}ֆ'1AY&SY4H"_^imw}[ }:׼=nmڷ,gJݕt Rocreg9qclص}:^=nLŬ[öֳitU*)wkΞ`;_\=@ZCC@d>[z6Ϙ{Ӻd vu_CN:ZA@zY>@y--{Р;-ǠBRJ;ibj (iys$hÞ2-z*QN2o2PTq=&=0U;\R{=2[MuPtPd6lU6 H km*k;qgvuQvڳ/w}Ky{G{>{ t9 *J qPU5d Jۉ*E)րyD4րhQP@J 6U ,6bUT DRhUQMh $0( d@0KMd:^@(H%6$o+v ̊P>REGf=T|}v8{8gkU7k,:9'LU_p{x7LU(;`]k\}{[xzevZ u;{{>͞DolW'k*/DHRم$(( *IUy8 TٽQx;|Bkz;Ϯ]lRO=ܹy[c<9\!뺉`-eFS}}`R:EZݜqo=Qhom@U8h`Kܷfq1ΆsF dOpqf6q}@gty}tn;ǢM^qsTqPyJ'pm7aӊvD3cI۝xS}Ы^:ptm sctƺd" ;Ow9aNTLҥ Rly< ͍}j]۳='wOz{QS!O{%fk=B֚&4zxz0s{xevW#*k3=ooxN:X]ݙ9ף#=͖HZ-xŽܺ8֑8m.]vy>_ecFGP3xFBG>䈡kZ=jr\]jO^=gnۭ˞s^mc/]9S" Q{{L&4d F@L@ѣ i顣S&=0FMzL$bL#I @ 11LdM6 zbyhdɴjbiё'=5OCj& 0iF@&L#"zi6MޓC5 5OѩS?MDț'jg)Qm5?TzD`Д~'=i' *3OQOLM#z@A``F#z0CL$Ԑh`ddL0&h4hLh鑀@bO.IC2/~LTfOݺ&%'S3/˂/5u mD¸t5\̒d yyt =9.~Zp-NU?ꡀ-+ 7 Q 2(PP(B2Qa-%,2 w P 0*+{e1Z~"7%AAE>V5JU9dn-Sd"Loٞj5`aUx.4@p Qd_VXȆY@ȝ>~k)|:;:N"12R.<j9`ϖnT) Q@ cϻҨE1?}*:زk,rRjlLλ}JcaEOf-p)΁Y clƵ2:]ڒ]9Ze(3C.,//6*E3\hP /I.u1m3Y|[\m'X0$ifd]DDT29t.%.q6Tl7L~*ŝ(IPVu D3`3ߴ1HŏU^68035x J( O5бzF >X:<[b2is$Qm\!NR  a*YEeSDC*K\iZ.D[?YnǴ=_sqQM慬ֺFmW˝) lRqC2 Xwey4Y3~gl30cwKcː$'@pնG/#ҎIt0NvȪ^y`;q֭ՌxĂ[ng8uu1^Ec"Յ}׈ m%irJ(?J dfd< 8wteݛSO?h|?u#fE"B+udY$QU/^#@R0pyN3Ŗ#X?ptl'ICQą_ȶ&k*3z٘/0'o#|j?Ÿ'r F%->!3xm3%ߪJs 8y~ Z/PfeRG!VJLˑRlVGMOXrc4ҽ Z\Hg8#U#2o ˦?\]0kqJ/ՏE]Yp/8B"+. Df!41v ('nrzvљr,?pmHo{?Yɵtrqo7ɐ;>iMi<0ηgkk;kVT)^SM;Eo ]9$pP!T(%3!)pQ$pU]dbpݔٌ h!!_ ];RJ-`f>cX$Bn]i Db&G|':aBӴl1ǫٝXw. YgA0<GqHT2WFUFp,\<"9@뤤^@L}yvQS_Gj X2UE`cglwK6G 㐴!2O2J N.쓋,|b^w4Ra߼]۽?x S-Bs9K.7,l }xQC Pa3d#"{¬ݸzfl.miaUNj79x^?<|lƨL E3L ?my2MR.κt軲}כc4 D +q//;-T,%o,mٔ1!V%j#Hۉjo(].)G#:H%rK,O~BP/)\BQ`еY[s15YK㋪Q#[HVUacD8[GF<|Z^0s`Q{M1yݶv틦U  1\pFٳ4y ?):%r=o=DD 9%:# Ԗz 1e1ni0i'P }t0臺z3o[](jJ FnG2.{FLh'!>d#T 5%2P|2_:68AFFr)<@.V~+WVzɉ5}$К!D.f +0D6ĥW '8i1fY0' Xy`6[GLyqW7IkA`Pf-- !IE$A%KpTQVh Tiå$@2^]X{#_0z'ǽnMvMf d6tD٬@2'qNAF e Au}N1oteR&]DVj(7=tSg L(zH `~=ZcSiKS3.!A_q>iR]lyS2e !,6/r`lvޝk|3N&{iȯu}V hYA2H#@4%a2VfÇ42ڤD wQƐ{X<֬m823;u=c/+Kݫ!^]R1V1Uzz%OV;Qw#s :#dWbN}&^_9h$Q *Lai*vVI=]cN.*I.P%F)1I;rr]!& [qөPP#>G Z|^Y \9PBIP "ܴk#hw>I#t5* tiQt="gc黴UY j4sRęeSIig2Ws:M7lN NX,°?@87~D@ۭ/9\eAeT rIqgK)X_~Q= q=ξt+=| yrHwj6<5mnEWG CEzK.jw~%{\d/f3(K&Z7s;uBvtl;Oŝth i@<M@7uˢnun)Ӊض$9Omɹ]M";$n]pc{A'#&ӭS ÿE˥x>7T6ÛAIJ ڶPTfRS'>RZ{[e8hJPG^ؐ9~_{ӺY"!r(s\ }q<,JpEL38LghaVLu9*F4%MM^%{LJ,i8!ƅ56Uz,FA13' l*vRL(qXvM/gwn9n,*^v7K^6۵yDIQЩ=:/a7SS7ڼm 4!*E ͡X*xz4zvxLÌg߆gU)bDdEn'((vŪY&xK̋ňBM2E!d oYkg ćQ7uˆ79JüֱBJ#a#%='~#8[x`1o׉;Dfv׿[*.$i-7Q}~` hJ׫iz:Yq*o Lz,i&& Zg JD󊲣ݞdο p M/ M (tCPDGHeM;uwOgv6 ''|J{dgjg:T D,!u "(㧲!TeA |w 铷b]sdrGyurGz%gƁ h{9_94:U.L+K_!}ҹ K֏6[u&z>sڥ]ޝгC=/ yQ ,;qrR^@ W1A 81}}ʏvrٟJ GD.8͖E@?XA*(-a75x.Q2)%3ʪ&*+yt뛤536zT\}wH*vw[s /U[ Q_f gcƗrS41HG —IHpiV;ZY'w;SgD;P`*~EBN"z CTH =E@ս0E' >W"EZ" ' w=+2>T3DtӘRIRLԢ&] A̤Bdc}'}^a)iЉyb[RNLWҀ1{'Y1(xs7 `ٙ%᤹\LKȨАÇ#]߽4yW6ױG6,c,o0Fl-|N}* ~iѪ%!`4FK8Z9CcwWέӱݨ+iF#ͅw ;pHoBVL/qvD0f985O8 J5e5{QJ=)=ޭbVwbwCȈbۯW\.+4ka񡰼U=</ȣ @H z\?Hx^*G&< pS>qI(UrՊUXTqWi`frR!Fr0lĔEM'[m^&ο0JG,9لxKK=`掿W聄>x=y.՟Of1ZA!81~ ܈:xُĉBG48ZW9ޗ6lHb'b5|L(Þf'igDȺڴ1DPW̵|=2l}װzG! ؋ x0:r,hYGr?F5,؞tv'k==yXUv=0uVϾ iR'z~ d?z̴w+~7X/Q뮋 D_&(Yk~{v%(={]K5ˇ%_C32!F0=D%;՛nթiU{m- ^laAjIb2EE΍RbᮀrfK42q#owi!QړwH6s&]rW~,f H0Q :(f}>XCԗ,ժs"3Ջn(Ξ$.}R<nc=rV 91hqsN|] =opif Xo:d@Bռ@'#I:;|5`$#G&cxO4X]JvKOHn Sӂ_ VG0Y^ɸ2ӽK 7Ϻ=BBq`1̬㍯ 5X&%% }yf[N[Y^8[/PntX䍲p`[칉pPGw `(8 RqKoXJ{}]\՟& !E'@ p+x-bꥥ<㭷v(̫txKW\f%agpzMEM1FnL|'83ySftIJUkj y4 s r'i##;;;t){uXT"qX&^#2~@7/u:N^ H)wsw=6ZX,,ͽxI'@An < <5yu5^ Sz=t[/ c)#< MVAH6 E0̐A,FF$E(hn~o3\WAˊ o?d MT!]h|ʸ:v3Q((֠4ly9.TOrO$`/ы|,@t281xZK5"@ &c:S[縪/NayͲi7Vғ08>ƴ@sFY4TMQMRbQ/l8eg;=BeN ҁ-2&$ $d91pc#{SX0&qR蘉^l4 |,GCa8[y @gOZU1%GU&T ݌&T%raqcck PTPPٹdb(XC!THLL0` @^#FٳoM?8/^ w0X Kf)#Jj # =!=en R-~f{@dm!pl-y>$d3>BD-SL)0DIIR(Z4T @P 1 1k I@beJ]X[Ąb3B4$J" tĈ4 $ @`P )!HmiDJޗ%.jur'~xxuxx d%5B=c^وٵu;|ڟ ~;sAG\bwܙ{^EnJnO{٤vX/]c-e1qŋ$7,b1nAuEuWڗ;wԯ}@~q/ 9j09 wD/Z]񒱈ƝdɊ0[YGI匑(rfD[t,7EpG@nN'$q)>>}28xIJ˒KD# Q+} S? 91 ;=3;oqpìWFo^H͜$tiH"ќ2IdJPv8ցAȖtaE# u{>΍i*v'&Q]ې{ {;4,%vPPHDzdp1%[[KlP[#l{_^mX;s!#:]1x(0y[Be6 f!\acgt"z枼x|Zִ|J!0{.Kqf}}dE~ۆ#yS .hC\^sEy4[L >H9pr z5޿Mr!t*ڑ7@J JsL.נ/sX#>sBYO]w-n/qccT  ă 8;Dwo޷"[#KAĹYt,`4Pw%Su,>982Y.t)q"m NEFj=v{oC՗Pl Q?b YVH$XC2u]E :C]>y +8I2i PHX]U Q9WVߡ9}랧X\B0j;mI\Dz~m;O+Q:X͍fDVے7y o}C @{4+f墂X8P`aS+_ڼ6W3z`>WMk#ȭKVqE_z=qйr66iޝXlpV @bS2diyQrӅ88@LCn!C}Ep[ iENULjwtuO9$u' u͒~$ohЃ0([qn77v"̓ [i?}v:)Ag0«9  KOĈw7 $D$ķɓa':F ft*M8:DO%V0>ɪ(^^bE A@0! PrDIw#SW82&ę3(e)FsJɲLv۶cH{,ו"xXq(s9[M/oz吹D C!IS\T\s0W9q SM4JU߻=۱;)XQ?yagS>6RFڵbfthR]뻜^;Nvg˃Q 7}V1G9 uʹgmfXU 1T "0B0#`W9fNzKOwF]u- i5G!@ cis$"'Oeŕ~زBE~1;pf(UR_x'/5P2ȁbxڞ`q7uLS]8]xR |0ٞ~a fSK \*R-Ҭ۾eӢA-C͡Apuwrpr{g|6q(&)~v_Al7ޚ2./>aX9--n"OI8s}ɞdLF2o,u6 W,{KmҤڪ:I7LyoUVSmCEF*NBVl\ca_#S%C0Z7Qګ:S r,)6I B+U3ѦU :prmIN_5gaHNիËUyƢ]&̼V65Wt20 j_6}-G&+E'} ְ}-)-ma`T=>~1nʭe4Y5nGff'o(ÙQfmy˄U] HH"MIp>bmxA r96<۶^%ԑ3qEi KMc#O(ZFT~&uTMO+YIQe>Ej;-^ӛv~98l~KcAkwy)B.4,wP;lwJI[?kGOE JVE)P*9#gZqe\<-$-uw~Z}U&+cj+4&pjZ:YvE$yw70G 鿋gsY'`weAY{6s':W^CQOgS;[u820hwR^")ЩgO]j,+CM"nT,PIUy;~=mOvm\^S5{htQ#K%Fxn}|RܭLZY*HÕ# Ve{,mV/_ybEY2fu6LZu4ˡEVJsV敊T^Q%TOjy$J`=I^J*}Sl}&юMR W$X;ɩH]{Ң32 þi8-`3h硁Sub/7Mv 4?{On#Y~_J?G2 YU"6*~Fz'?]FohzZ,꺶,D>ѥ)X41O+9|N76`HOsꨅD)ުS'%~iP'ZY@DCdb$VS&ևw =C>#%=Eb-@ j¦9Myh:ż:vJUQU9T'Tع]6dɫfR8&"F" IƟo\$_S)P.F14Lu/j?O5?m\"-:UtvfGc`r#[z=Nã:˱c*Z_kLd k1PܕƁpDl}csUQIm3̀!@BmGY|e:6·vR%s(k3+@Dyo?riT\39α??P}d^,~T\׊datUu[4vz~_˥0>ΎE렢j6hȕ_ubRAaW.;;r};U(Ccs9>ݎWtt]%UY$UhU4gIlXt~#0ХO\Hm6&[4%n@"`OGro*uYլexg +N1|!b(keWK2xY_U=3 ]:|5nq_I}h/nV0([L5 (2U=YHpƉvա)A5흢|Tb6XKr:8Lvu5W7ĩc#M_+_FW){D4NXPqzoaۍ u>E6Ӯ3[oSmo灉{o|D Y`U]4UB:e[Y*HP0$Hw^i贝Sֻ[̼aϡ-ߓJ؏0Sj`MAL90CBcӢgdl^$8E3{_eb-D@;:BJyHPu|pM^>(β-'"KI) a{2"຺t[\~uTG5Mq\/6KYHELJeQK:0(GsaL2]=v1eD-ݕXsg¦TaF2ZfrHR_12[9EMy<vyoaO,m]OoJpA 87堦k(L^ˮ\[ V[REP264ACtaRӀ0DCB_a<ʠ HGw%I" b"3Bdc:ܭ!bFofcf+6ޛ-fGMl<$l)H3 3+ pr<^)(R59wdW-;^M'auw,Jr~žMb|ZV҆ U 6NllL{3o,~34O:E$?QW0,ЎSMg\YI .b|_l+╥+k(]M0H5kT4*n~;iqu_`-sG[C"v^[Oձ}nG͟nRQ#B h_iy<ρjo%^.WK%$e}m~Ͻ]n]t<#$ "]AARch~ZQP' D#4A:^FzqnNYh)?SQ.'x%,wNEt0E֩I̕! :X&ʒn:$ `GK1?i4flA -aBA~-=wuuXz./j Dw% DJK.ߗ$|Ω!rNuD-Af $fM|0b;qqځ\GS阦:fÇ!HtjMn8̧"S^gm8ƽ3(MÛs[ p1>BQ%h[C|0) H%@JGǸg pgHyu4&ǃ?"ۍh؊Dj:A8we_-\xIl_s|yh(zxGߤlPu%EeC'TQ#M`@住{V7Y Q:Dh0UEZ?M8$IB[#rZcs ߕ-M@Ocƭ>^\K_y^{ 3~_ib8y ?S_܍l^،( GngC!0n-f0@ p1@q^k^hIhtomZX= +(j_g>ɻez ^"Dd#ޜpfY qP?'^G9]CmL0ATɫv1giI,q:N?mc /e v(Ƿq8yud/F;EJ(9*R?tF<#$P<~}qP쇚G;_VvL/? dFIq]!}κkkX 3Ul1IBf!r+_Vu%LyQ:sc.Ӭ_!DkmT4"8pF#.o.2ȥe<7^@R"Dx͓oM_=b ym53(y} Tkv 12Wڊ-$NNsJcupؾ̰S% Ҫ{<bۄ'L |g٨f-Pa;<'#S ?<#b`tRF촂Z_;4iPr@ZL ~?3ȥ=4W}m[?O3(o@aP#kc~`%r;oDGf@1O#\I8D}8x܋^RQ=*8eM@?InYf_]3dšvGv.?G:K>0zn]<ƕ#gfK`!kuf / (uIn`1E΁W?ܹľ}LCMxTgZF GnF1 0I f& 85sv[nP]zKPdiץrHir+wFK'd%bs2*~}O#}llt|'6Z4 D{(PP֪w?]ø+olOIbS*TDGJ9}8&:6Kv nK砈7 b!Db6=7ڬ0T(/< 5['m?{1txWHa\LensR~p4z;GlnAU3yY0d;[&^>᥯,@TѦ f7@U/Nk$ᔮ4k38`ջ=k 0 HvVx uK^F%&A*kqƇÐ@JZВ%WvW{J)TTi!DI* ""0XJW+Tqܺݟ/ (nV1n:'a]hBnӧs}o^ob6$H~Oc#éݪl#jpFN}c5T8DvH;8vU/Xuy(6Va1Ԟ@Zt QTwE"F.T\$ Fh͐G $UЉ߶~VC>,Fa ()&D0:aJaB՛ޚZ$B$1si3de@HYE)$A @=TdCqE-$.X)F*Q5OXrF6k%5<ؠ 棥Rߐ`u /w1MeCrF a'M~FqE`^(4a yU\LYj_=FXmM` #KԸGlj8LB 0{Md^J>䤼qTqG?vϧ.g_C:}a[>{? `@ D$#-qv~Vzv*<}l, s,gK.\)F?Qn֏vf/xYwd4')lWl+J7ô_߭Ĵ|Tfu;D"F^ϳm䳫gQ(މXw{2ۜa9V$i+loRlv gm^GK;v54&˚h35EN5W\!݆W3m`2d^YI֑u"8J[L&j#"  ) nrcz׈2O)$My~|0_1m *Kݸב,:ZfF5P3ؿi6i'f^خ/@BEML~cfɥ̳)BܜTm% s yRE_4DWmP`JOx'E7[pBrڋ>]W㮻G(28,9<5 X_eYݍ8qU[E"%3LCu%IA-E]\#\ MU*hasvNXyEnTL .SՃs{^a;'>魷m uY V\þo֋vZ<7s~q1\Yɵ+Lиt`Mvkr$-jwm:QXF %&]Fٔjr)&m^q6vu;h=NRm渫QDߥ]R4 ֭r\{':r2c"rgAoΡ-ه:*SOg.d#!Ief'܎##^jȱsFt^^QH<QE|D1ȁIo#gOr%<@dO&Em-UiBpӴ4|)޻FDqhǥvUKhsISh^tLu4;͆`b#S`7j0o|6 ndE=+͓Qk_í6q}}'iƙMC+pkb$$PɢDoPIg-*5|P)(rS 椭7:3SC1H, \VvUYԑt2v[_Łdytȍ[ޙݬ@jb@# Pǘw^}ůJ=_=kcUdVUu'Ez^{wόx<'1w)f9Z0B)e[ԗoLبތ9suѫGy.W) FӇi[&Wr~J.77`6QGi ݢ.6Fc# I L{7 do`G*gD TlUoЩ!f7JT&{{烢Mk6 ),X#B\Z̋!0˃ V082 \< hﵗ䄤7|_)”A | .#,)O)uv Ө̫k757^yX"wD9EN8q]?&fj/uc.kz娥־|5ӨQvZcc[mC-@5 g8tmƅ @l*pqƺMcM[Wjc#ueX8 :s}j=˽ ITɉ+?+,#q~$%9bovC i۸]p-Y|Z^_׏Rʗɼ9O|-%ٯM{fx1?oմc`MvhC+RP࿜̖èRWK4:,_ۗ>Pd2-'uW*mĎu{WnExiG#|;W^6Z#Cec<]r1vM-,gUۮnכODs⎌2@릏/%%>ʳx^=|gzMDQm_kZwNSzHm tĝxcL ԂXSD´i6rjH<8bA v|_ke8-o.0p\}j*~D2#t'z[B*j bZ`}9b/3\iqE܈hWUvcon(pmnCtZd0| 7<ʍ6sҔF÷9Bמ)*^9 ӺFL #'!θ+n]WO~o+u;k8Qy `EVZkE"歵\7?@D@T=?擶ً%t]~!8s8699м{{|`gL>wo42m MpBXQtBsR$ޒqo=d^A ROC m׀n]ށL EV p̅Y))"W hE[6{qn-L!+]tFB7afGReaϠ67z\ϧDV/RwDD#IH?# Rˑ/.XfFq {<'XUu;5a8Es4 9W"(z V} ku+"v?+8F >y9 ^dIb}^)v(b4\!B:#oTP̪T_1>,VLִYZF0ElƹikS:MD@ppDDul~4j0\3t~=n!aKRQIkf %\G" Z>>]n @,@B;!);,w9a@uP;ƊkLd%/-|4 ! 0"ŲN0E\Jߢ p=*^I(\!$”jXuwT*,+ ) R=܋WZ kLӑ׭jY-bj,ޢ# RJsf 0 FeT@so ̍mt0@@ 8 %+o>*4 nXG‰a(FcA>ʕ` \P &TkDH\9R.&!D@]W}$DNdp'W dֵ=ne=v kmw)8$ca%RW-7.C kΓ紐tRȁl>ܑCXХĨzGpEjOkQ];-/!bIݫJlLDqvP6O_ǥOfb!C@Tq4od"EwɊLInbj n+EۼV*qtzӥZcxnr" +Qg128ݬѕܱT:Ih^@s w"nצ0}_)ϣ< ȱX &-Fdׇ8chT %ƭ9l أ"b4.komw==V$C`vSՕ9J > V͑B`\!x8KI n0ɋeSЅ73='M)#lو׸t6}O:lGkv !oUp DmxykxfL^^HWz?Ɂ;h K} >0io9W՛r OVև6wYH߅uMk4oٴyjU?msزaluX[]3 D EQ U)E|13p` ms5WcYѫě{YYt$.'b`8ycC27}R:vUjkWv[fA ara MFxDbP%5 v$Q* nU tWO|q]ky_B2fĂtM ^%e7wrĺOz2YSR#.Q1Zj$sd5צIر7L !bAG΄E%fm,-r/s"{y)=V*M}9}9Y1A}]S>,UT'aȸn64^b)8ʌ#Fq2*s.\Z_ধ]q "#*TU? XAd{{6NʱV(Dy,PzZ47g^-~ɵM4z\*CqCmcdEAAb*tVtifc\wGWmN,J_6}*36Nz'bkE"bQ]dd !]ѹgtI '%f>JFR̤h!gAڂ0u }Uu5Fq*ZUϿKSzc423훁@Pֈb1"=bZY#F ;Z|G ػ5&W:V;{,s *Ees@C-WLlsm:T֜!"#"-ӅRH=Rq:y9Y83co#b `D ۟䏆ͭa~.nWN͂9E BQ>.Vš7,`@_eչFÃ?i=䛤؄$\ϋT4}1DDb""Z@wU^L"hFݱn-70TnXN֟gw~`Auv]F3+>4%W D #)OUC@?іh&M`}_~ pr׿Ouzw E@DEQMuMh5NÖܛhz% 8%H!mzZUn-noriJ0Q"?oǖIyǫCqxŬ<J,%oQ`Db!rcgޫX1#s0t.~\EP ]=~?b>wf6qaTFE/"AȡAIo_5WiU𯾫GL!@0e7Iz$yc%b{9 v}Laԣ/H^(yXOТ7rP)pI&I|.:RuS۳fϵq`Iuæ< 91zW E2ATX(MMt|ǫhM-ezugدK0ꫳ$lv\?x-`ڮ55T4ֆ1N%RY Րh90:\As@80"`T`\"Bmu)EU , e5X74kޒa.l+_8|} <K) Pд,4n_׫qy:7:[zg2gUQ6U!! Qȡ8N mC>Mc<Z_=L=ɪu%&x-d/gf1ЁW>L SKl.L_PWӎ j{y5 }6K_ d=g;=I;>Atٷ ;݆JF 60c*ZXup锨#t|]?^umB u,:[ȹ /aw=i-Q݆sSQ,Hf'-P^8*wG\m9Chl 2i0RnÖF }:m윶XBq;c_=h| }C@fs @󫞌 xT9@[\A2et@phM"bc>E1DVNV|ܼTޖNJ'U*(:Av.t, R^}{yiKN9ojW;h ʂ3x=.gC-PzI Vut5T$S'/n^FYC9CQAQP9 1H,w~lܱ\xk]N֟}MIAme k"0VOLzd q=m6l,p6Ya&4+$!`y (jqs`>fRaL=rJ~߀b1A~tP/Q5 @ ܝIQl:!2LH(edDɴ2M(fpH@N&5ὂVˁsNVq1Z Ǫ eXi4'&xY$(6#i~Gw(晐ƢyIT[|L8jC$l2tcxX(*2ka-TAkON,* ҡglãesn*}VS4aʝR0<aѺBχN{vUtRCa1Z܋~ u~,H7EȭXZ!ȕ#uh;}A0* mLИיu,ӥ/չԱxSn%f9.?]V7ڨrzk|i s2]1ɽh?m4]7W {X-@96ց Uiv-zrhݎFf%7Yuh韱m>[ZK0)5sJvLG(J媍@, ɹF&6D WŊ֬,C&eutq_葊a_-F1R93ES,YOv,Zwj i džWe*BRND3Է@,F4^,֑ij,{c=U|+td8>w7~j*qq1 m;z[v ]owRNA-ڶ(il 5 #I`QSu/F%rUmF~iѳV4pl=',5՛llO`\- ]E;/_@>Hƕ^L]粊6UlFVbVWvJ} 6ڕ< =۫eY0A \B{k*\r1+{zfzc4kBŕ<6fO$Fnrޙl["!|3㑹 R2]mF5H3߂#~ŸɝrNBC=v[ |0 ޑ9EL驵ָYWvQdk_~ԋW] q)gN- .҂12j> V9ji$jc͉EnP9̤R { Kzdd;0"E̛U1c%"?Mrl2E.E&x)@TPhG$ڥwаmkf#gpRC;C3ƴB,K@#4ۍ._c(8>Al )vg%/e .pm 4Jy 7'm컨kF_MgMc8C:o=" IuHlNh,xژ"\&ąynvg2轵agmqlt'5醚1ؐupۿc|lΦwrR'9 C [a>78Ѫlݣ"c΍u їXX`ce` V@yRKNf or *}nk[k] &>DQHN,pwʶUśsp**`٭Y9ো"֋i,ץ4yPy.ԋ^GbȧHw:DfF:]ۜ)̎Fӄ#@[{n{D [B+ mXl9YMVl(j v5'VgPzZZgLd=q`9JuD_>p-2B8[&kDZ,Jf6gZVvͮ'l9zWs ~1_Sc~˱W"Q-lz|wrR _1vм-2UBoDŜA$[  ҹVC?Wߎs^VuJ: ֬r".mD "-vv5b_cb綻ә"릖@}3oOSẀ 7s%~AdٶSbbEzp 4EbH[IDmFv^KV"wn'K=s8tѪ8%V/#ob)GF2ЕKqNF~*QA650#oEn+(\fbwog-c&SB"s6 XT'mkcb:6+^C"dwS\vn2U 1:H\Y)ݣ v"ĺxPnUDڌFea*afZ{ò0@MZu}d aN%n"5^*\&JP_SBbjaV&tiϷ}m5(D'L~:2sQ#hq+po?<`3JaAȁ dD,׸)p*BUsoJE4* GE'WADa5P(8qgtVش~߂[%Jh%KNX@uv\V[~z#!cGUo Kwg5ە͆# DGQ}VX8D&[#KK;"H:g3ۯ 9[V =t˃e {a<)]Vl-{PФs E;;Ŵ_ n$Bf&nϻ-FK ]*eNdY-Y1Yse q:VDd(U0iSbs @Rخ㪺"Z>/9u0MwJzU߆Mv[/Ge56\s$V k`I U\]]p (UȕRJOBV3hv $瞥V'+_jk,Vz+s:N5AdaVkg-_#O7P4jFob3tvbKUi/huPsCuX`:Vo|Xe[=P{,aUodm$a*Cc=uʣ{NԶ߱>Aagd#łCñv;;nR GqxHB+oGd1ׁȶ7 @6"9(y?6g%TY',RMpW# %&{R涙&u`*(33wyRRTX\~ ܯa3Z ȩvNg(3wW=0Uۭe s]íj-E%a;=aiP4k&:,Pz$eM͍k}!iYg͸۳Ht1gNS?n7UIf$c@a9;E`-FG#1]cWeCV>JV[N׳S}k33W/>F~H{j1[ӢhX᲼Vas+q[_>U4]bZT^=?w= |Ԑm:{DvjZm#Z  Wol(f׍l.I ʝ#Y+uM29M4tVB@G,ՖE[69.;AQ\ ;>ϑ-b=c?Wqݤ ]ۂlv+C{t,L^GDʭt8shâ7]z|͕4[F;]]XXCr??_c2-kSSŽQ2/*!1Ap:^QHpHw88 3 &n#UP0 : r]AYe"2RXAWKոȆlGP25,DBB ¦|)Ld*r=4WMZ7 km}SI`4+y6yڗ9 R|ki*"Q1WX,J;Xw9dle &QpvW,9;a0׍jԱH{o-Kv$% U)Z-UUCe?k8sxwY!=4Sֺԣ"|X%tlMԽg+ݏCl61e–Ñ>2@+Ү5K dZ8 \~K >IXK}/B)`zܝ[ki" giOKG̻qcO6S4bMhIT ڇ5l `ij ܻ@'EM\ɏDT#ĐUiae0X׭v%h#mk:;pKf6qi_&I+ya8%e:ܿobg7[Yi$Nz1!Vᣡb-#SZ}*Yeޟ7MB&f:T/si&O#D4_E6ƣ0NN*)>Uz/p[Rqy=,֏wYP@ե" ^ķ+\5&mq4Z3S#ry`^4^EP%t96/?gO깧eI]?qU mθ)-8Q3?Uvm:` NL"# ;qQ*.y-<3"cwn7KXع'^pc@aE-R0}mHڢOgзh= &wkh@i Fťڻ_}Ͻ7Pj-6܂&{,,kYGҵօE~ԃQLGKoiv(w햴{e";&~xgO~e Y`7vjw#\TQsY~p9$IBuZISHrY"]s9x*ii#'ʵ JdFI.B"1nkO z:s KD_QBo͍CͲ.>WjÜeގseؓJ{0 aձfN ِ2H05vlDOf1r+gWd|cT׷c.Sт>9G@ .ʉGd}ٷařEPhz1}>@蔎e^87:K/y%OYz8/¼Y܂:W\4R^*.ک%jV}HAM=/(]JĕLCzߐY@BCfbN% P_Pk+*}o+Gn""1nb"(]N?s2r5~Mkδf"1!I2׳Nҭ YGY% n #`SOi]lʳv1W]geg}Q6Uhű>yǬъ =բ[VI:{nVX䛵\13W #C>0WxZ܍]~ R2U}RjƆp1pQQL}(E>r_*2c?|<ed7*pXY5KX9K)<ՅU/ٷ,y9d TO4j+~}#n ;Bբ9D9$UD*F>9"dB ƹЋyIP漽}͑g-חXD`DD`E&r==_ } co2ƪXf` ,D%_¶*,AH9FQ'Gwo\Yq%3$DEV䚐Z J# z1נ)Á Zæm!=G~m#3{]2)*tPKPP!$;gvm{'=@WlP7m;Y{ÐpyVs_V.h< &@/сCKsNz纼O 3f;1޲)NyVn KrYgnT7Yqe\uZ QYI^A>ccQ1>(f?ׂ nGV03~h74܌,/PH2eIj7-]<v !.C<^z_q~)|R1i!2kR;8Q'Wq z&t]"1>,ހ)\Ei )18ģ9&Չ {-Ӽaz`WE=B55UՙH581!!c#궛[zlwAaF!D Q*Vk) bvf`~GLǏ".A02'&a.Ul4{-}6@SsIۚ,Q[&os%hw(`7Uw<]D#C__G)v|f 4 |`8aDhV1} Q#d:y% vV_:^cbWӛ< 8^PIT;1;xz0,>+ zV+/Mh+ؠG{GqܾN{q ^j=惏_xNKX2SkZ 28wnyӺpt^}YтyHln^ʨ#KEVsͪe-rdn?Hy2y/ .Gb>Wюo>9[Xz^ٿڛ@B4V~&!%d]RrE-WZtډ|ThڝX/5CxS{t z'hg?F%QWm»;o-43& {4=jXvnɭG3Y<+8.{)Bo99ER-RR$F18s;3ށ(*]([$hX.iHBR7I63aa:li :8hVD8ĊѼj1"# ^ufp֦,qeqnڀRAV5`ǾAYαePl_g+erX3Ƿ̇NizZj} EO_ū Ե"k/:X%ȶ vP*&k<WI zk/RWG6Ҫ"""尓2<'|.;:el8HP"}JO0U7OWMFmTxͳJ:HZ]aޓT8\:y3aj~F8;/[sgObZ'J _V.5~k@en]L@S#jۛ]]}Gjktw -D#]Zk&0j.hޜ3 6/`@ @A+RY358:4VU)##l Bk`@H.N{(VfY TOix8j\xni2Z=~rFIQ@Y"6BWSrϛKGj,[6zW..Mˏ+3Mj$F"Z4,)(s0 S/$9(b\uM=0zVPkvݬy\تso!i_Qgέ*KT n;ZK%kӸ1UZ1_[% :y-bYE;zwUϪߩkN:{uf[볐rgR0ʯOzZeW)&{}xhb"c Z?F9I;@idlIDld7ufIByb{WpW/! lKAs3r> :ңD8󪧧WQ}hj#7jէ'C"j2Am /vnZ^^eKRv AIdLnЛbe=+!{>C6oВA vͽMYmtr2؋eH¸fzl ;` PR9 h(FD^Aƾ'DH#w/K{"ϗ[>Q\}B.hbEVh#wҲ/bBAPN}!ڌ*o>)Q RY#Gᣋx):c"#|\}M;XJnsz]P>>f%^waHp56rc~DumzOetp慳,̦6 gdtGVJqajׯ:u}SXFZcz=ٻwFqa$n[[<^1k_RlήO*' ~׻t5~D(o7HVMKL/' ۋ#O|*;5onaisLIfpغjh Ĕ|Q<ގ.+n+['B\&כ_ع4>u9'Fw^.j-l!e͝zw09ּ!&?ȷllkxql<)5wր ?%;Qr;6TmWZ^ྋ{'#<9jaG{U'ΰ]E'P-,Xمcb/q$CMֻCiQ!(05:} h$+iQ3gԛV˘M~LWP`H {M(]։ɹz.Q^mgW˫g"pp\[ko" #eY.$ţځZD?δ#e}7j8E]˵9~{VxHee켻bb`(Sc#0>y$(B)K<]r\ΐs&G9ͺL<E[W:>ZZCB9$""2UԽ(N0TD\ѩwm$@颜2Wl&Vu{&^locφgэ7Ҫb7;C¼ޙz>W?thx gRKY,൉L>Q.'3>DJuA@fscu{i[- 1"JD>nuyC_Һ&(WMx\WP@$su0EH(-UQB1 -X!‘!;\ֆMt5jrhVxD< uLˮ\3n0Y,:a&mEb%1l8\AB\ݣ/:#0껵ҷk_vI >ۤ&"}cc_0a2!۴ar?>خ[[CQKO'oGLZ Iɸyb9-fkN~Xa5S$Lw AIQ1&{[gkw#u) L5a8OQm} SyöDCÚ ez{ so"6t;BF>t~hu[rIwQ^a٨V%X4˻]$`\ hە ^!T̑n7 ,f^rSRI۽b߬v>N5 SZN-[=u.-WJ5N*g=/D@A:f^k~EJFD\JqR{-2c@sW1O1i)QR`mE"Ǥ%qïGzDP #r0#p-2'y/~}]b"0A]xÏm-=+ " Cx }y{Be6W:oU Ca+C}Ŝy4z/1xr~W%ÛQ޼fNYLlEFFAjB6M}+ "LRjlh=sFI?!'i.>??Wnj/îϸ2^6'hUeDGQ,Y!}J82#4FgQbu L#R!ue=͐a R.ލx֨xk?7a,7D9`T&Tr9j^ggJ)a=9UjLUizL>b=cy{շ^[|mx?Χkpp uzێi`?G }$;Cs[~fI`OFp~;H.zlAԣ k4 ӻo/*q 5M[z֭=~mn>b@bD3Ln>ug#\^2JMH`]Qxn0j&m|mf;zzֆ#wO'-p]s6Mzݭ7i-co3?Vp{3ZV$4rP+AbC3 Lu4+J{MCL&\-%ba_7s,ƭgާMd3ů;̕RYmu5w;./y͊q#lڱ:,֏zp5\U<`;'r e鐲vRxU[,I*\jl^(yX@mNx5J2H (ovLn|̬8C#EkηXcޢL>s x:g@Ru}E7Hd!قOUK3<6}$V#oFcc6w9oaR/qd2Mkx*-[(AQ=8j~;MoO{ϩ5tdHlYe5<Id=[{L9w0/IOf%aZmb""NG{<\B¬3G9B qs=*g4I^Iٯ~p\I"0 Tpq/Oy>Ive>QE#I-k[yb!NclE5H8Eyd20-EB1jG IȁU5.=3<ҢgE4h'- r14m7)7t!^oԧ,G_q]G[܊׋ MLvUl,:ȫnoN`w {tUEDG(\*%|Zج,3ʽ%9oM& ΍Vt=AQ |[##plD;di#R` tH:X1itơyHHtx,Zڢ=i>``Ӟ`#[~IcHsnjRO|2.x2: fkR[cI`KvރfF#I{+j\j3l^o}*_{:t41Wcmn hQUs{># eĜ.n[ʓԨ;`Y(n}Ȗ}m^EtzS ʙ5`pA7V'_)[Ynwk{@.[I˵#HhGI@(_WGܲ|35M/, ժx%gs]sML( a!Ԇ6w9Or_zXǟqTOئ-yI!rP^hҵ)tKZSAྷu>QN\ JPԤ.Wff.6NKSɣƶ+,ظd7õp!dAR1$ }=ӷ768@w+Inɢvm㻣41gg/7iKtg>&[ )q7|&:Lb4f aq(Gܬ}彚a8Sw]yIצ_AT'D$bŪm wyӫjew:k-ȩvDÉ> ?u6y:4a:4fmUv%G6Pkτ,k^=J+8zsֺ9r#_>?G7~fn ;\# H&Ht0~͛Jv\:M*6e2Ś] 7D+E;O2반cΟM{KH޽Ή१'OSWtG-cOsS?S~u{[[a_J?rE"^zG*m Qa݇eX1t]cPs]ûF3 wR oUK .w_͏\8пk0pϠdctlٹbHF H;vLs_{K}<:Q8X\u.g鶮qZcaCi) kƠ9M_Ί/ETIzU[ U66B&qG6 a99,]0sLD䅲N;#dQ !QF͂{4>G3:z*`2_{ɾΎ~VZףt٪K s]~yrޥP7Gy  !jIF]Az~/V? Jt,ԍ#Ri,#ǢLs\uVY<|^o-gGRצTظ wOtlly\yi8r'{zzV{=U?lqwZVmoYvG4[{&*~.u1 c$sy(+f.IY3w"U0yl]OaNW}  gHdl3麼h˙޷ _̠k) 7[vnled޿r>>>pJzryp@ȥ}?ߝ3 K IpO0ml-x=ycҳdmUD;c߲n5=^m#mj'sD1(yg1H9Ʈl'HIs¡m ? 7-w>v: Pxzc!K8Zw>AKr]_b 9cj'p(Aȯ(iպ<=)1XhsOg)ãA'%]~ulV-J4jsHI<-\ɨ(ͥ_u'u^|.ioR Pn[{'89.FA Fq.1i`*6~\wk!j6?^WZZ6i]v~sfL|evzo+_&`N,d;S;y.0w4hkhc Dxl(橩HUeOӫjҵ&XZ^6Aozrԣ>"/-+|R 5H6dΣKy<ޭs[{j)/ٳVϟ߶oz01C2PvH Yu9YuX|H[`~cڽE}.80 X-@H8!,U1{iarY~ŀ,զW 8<ĺAfͩ7n 1b nF8mGwtdz/_cw+t& <#Lsk. J:dY٠jONwPܼA!_e1|>-F{L! 0r]80-_qjl#W[Bf+~kz_׶cb5HnWЋgAg^LpV$}andwq @|r7cc݁6Zm{<=:kvsӇ&3~pk/הsUۭH&s}n ڜ6Jȵn֥yoIZ tne C 8 w읛ELimfncЇX@p$  5BHMk͟./fss͋}H:%`1N` QV5$WsIVkbʎB;=6x' :\3L,VA&s$Wt5gp@RҚz((*R! 7>7竻,^osU|F0ywąsj@ D0yu%[m݉Vb!FdF+x9"@,FrMM#k֯jem`yD 8pֈٝ4dcr 5ԃ5fA:iMJ׏ZOe1`CWMbt&"X8ccqb{kI(w~PS6=I&>VqFCڌH;_}#RcS {۰_keI9%Y;FsL gDIzZUA EG+Hv۫z6)YB[%pm8woY)UuGhb6 vm:O6w&+0øJ6In2?";guUs+"eIj<(I".Ë7qƆQ0i:o LgdceR ] #c3MYREPYQԀ`SiEwt*аUO673C8ߜX\fd8D-TSq5H3ej[g!<Nh2b[wvr1D |51e#Ɍ +naC9F8=P:* 4h'Ӥ=&H`.d'$'I qRl~ $'2! 11`O@65I{$AdђOBwn 6:$!= jH$>L:[6xNNE }2I 2vzFj(0* HWWCW I-n=eb6KIR@&!qi$\akS6ܛx {'_ue! 2@!b0 s x|PL3 ݌NrwiDP7a0ss!U&nkУ"6Ҳ[J|iJ:hv9V JP ChJ B TC$BE HCg}RI!RI2B55(Kmʐed Ŵ/^-*߬kvM#_M<(HI55Bg`&$Ndr@ i  @@$7;SHI@|1ǽpm{B>  -]ڤ BsT5v97w@D ?O,?E44'%ϵYXӻGM'q[lXo Ln dÚdW%No,}užYs̺yv.,JPQ@)룇,lݛK  ];:մjBeآ}Jo.Avj(h&fOР&42!h]AN'wm-GZ̄ݲl^+GFf4qٳ@iMWlzcȯ$/qԃ( AC~ρdEnF%H>[Ptxkˑšgcr~tk]sG#Ą.~ qJdXp+UMz׊w͌ة[6\Wں0 i+( g1)3GцJDXrH`CRa҃am6;K- Xbrѧoq[q C{ Pq bdMU1d[Cɉ|6&)6(r;l)@+~ST@\s1p!5QuFE塭:iGd6Z{{qniR3ߖЩԿSpAӘ R5D-9 " \]ÀGz[T(9ai@xWe1WZcg<{tin* t@:tuc*>.(S10&s eJbaz۾wPfH4W.7<#>35 k\u0",ÕwkS B#I $xyk yҊL6{;c{p՟ 6 K XEKӥu ܑBsjM"y/У88kVnu'l"HVj(ax./"/xg~G]/E4}!Ɯ<"a@IsxZ@j鐄1~)WTXk%TB;92{/k1& ڒLɷ+'?g~1Uۉ/ vp.y|cZ(w*6 m8.K5;bq@LaVu#K?h`X&Dp3xo}'Y#Y`pat@ƥ=41]yt$z~Fh32UքywǙsjxoͼ.e|FIhhLǾ/=?.S:nON=VMPl4!JG;I6I$.MӁC٩>F "c#+@=yUhu3EȖ8z\!˜=ؑ"n'ŸHm;oP|E`GdKs29ymLZ-W@0.D &r{ CYNz;γo3ţNU0Z%JH5-?zΪO a8I) `iR I\ҤZ;, 0"H:%(k{Ƌ<8 / )]A1/(ƒl07\&S; zv:h5qaPmGGCHK * Idk_Zg-;1;[}iy9DyFwW?ieJB(Q H$&,!&PlI j$BnG}]@oVB䗱BeFF/٫re%i4[%f}jI!s87.g& |+v  ڰ=ќ2o"{e4ؑ͜ iZۓBVMU%ZƘZK I ügBI8!$,@ u Bn!gg'MqPݗPበsPkmp{ E`셋U $*3d$xRI`oǕUZD,GEʢI`qI6!0$9,IPn7BP4kȐ:II s=v,C^ ^ӧ,a&X T!a rt}aC΢g&Vm?C rJ O8Ԅ$C Hx'ZCpDd %B6Yoo!6=|HliD߯|=^{r D hviB@r=&@uz%HS^C{{҆b P0߬U|EiFA2K[n|bdDDBW;=Ɗ+TU_mW*IJu 9*K@!ë")X?PM̝'BoEb Q@2eKj ~cfHJԔ$!`4Ca&rHX+B'DgX́Py܍9d[埣ȴa a E֎tq{BdRB2AFHjI!`U%ϸ|K\]m]qQܢm(g5;*!"1X!b-iYSn$0 .@㐹]mH'kSlVfI "BMZV"W0OE 7N=fo*n7IfmX-b"˒]@AVi O xGnYh\6 ̫a"v M!DmB=8<:>\wJ}w(/l]鳏<" Tn Zt F&:l9t3`C*xf98PIx!sydjֶd l&uA/PNډ #ee,E,H0sf,ژזhpVDv@c"vĊ(:hڰNgFFX#2]hugVq`=; +jj2u8i`Qˍ+٠1 Qwj_~$P[СL*y4vUYFSJȭ*8ϴG4aڷfάɋiZN~Te$ZıCkܗ4smōf̫[km+#VB"$QHU@2l.3&Qoo.W%`@: T֋'v z9< 0 pu yz^;^TѺ FX"BNAzBDT9#"1HRN6;:|T)T (*iq-W}P!"g0;ĄgզpQB8C26Bk:X{*v&i,8L]XsiT)0$@HBn!M$=?X=$wg7iBOL򐄄2sCZO]-Q2{cm`IM]C:Dd$ H>dQ,d @9gh(R^L.%'q\X&B`EP9yP{kv:a `mID&هOd )Tz=ˀ ~'v82!QU$ =۽<?sW!$`@ۈBHI=YG=>KKϱH&c?]6@ȩh|]ka[ʴ9@3QFVsZ5S3E Asi4wܼ  n-'xV (`^gm\TR$F&hѱA\j+65Ů,lX(эdXmȞU,Qy `)5mbMˤF!beym-%IV̀XTv'/oD&T9M$ f uBCBSQ#OFuMeO]ϊG8ojy!j?•.A zۭ% $@Q$q-в{SPԞc`ǷeJa, @ Zc-xLp1㸼¦ P=`t4'\M5$Yqv)0XP09}  :Nb ~7j Lȳ}(C>Iyuw ڂXNa-eSBۧVmuc ZMQ:ۘF;,%$x~-{HKJDjOpZԊ0fFf Vѫ&c$' (D!LS`m۹Z._bA LGEPE0K{9PHãA1ݘ -#? #ZSrnŠlKΡߜ9>b\Kʽje╭&c# A=%h0`Q`-C\x_}}aTN-StG`0@B.mQZ,EVX4ir+5]S~q2W+ IWGrU#GJMvH dI}!}^-~K#HYs趗N|ͦX$Lj2CaXURIԈ״;p7# i,QZNqͫhr.d`iw$q2\Fi@ENp|/'k$ q5O` ۲6:-MzDX.D3-cb7KHsܤ v>wZ"gz~^3HA$<T $|5@$$C%v¸֔$PH,%0,6셂5vDP4!*Q!LU$aSQ`5QF@A޳uO瘚o; ƻsc`tmH >qQƃtۊ(6㊂% 14F!̍|?"ƊhѣQB, 6&Z3"=ztnO6$:4u|~ln87,10'X05:\OVMDDz}H`BzT2NbCMhtJ EZkx^խ;{?gQ\h-6 >bͩRHqwuԐ'^FzMŃk<9ٛ^k~DvB̆(j( *, ;V x/ԭHq۳K 2m*uC[JOM^n6L\&nn5{ůJ-pxk}TQ,XѱZغ0pf[dY4}kI:FBn$=u-ᛧ魠r`.آV K~%@ * BYXJH9"nP\/8'&͒Ӱ۲d0Ie{xCqu@MbHB~{kzMr@anRI4֤8Y֎#$M\  &L@kɶho0 f"EX(QѤ5{N418^ x],m6 Pij!'d2,;5WwZ\wVR|7f,s5%"ho9N ^os&=-"HWR6Ja!<841NCLLšSŊ-aN$i7j;lT!N=8eIPbbD`%T{.eZ4+XkMzvXqvw. ܋U;Vن"" *2 tAtVq;­^`)I!PNB3ɞ[@Sy$⛟#BSo:vH@pKMT'T7f#5ېt(vÎ';v 2Mm+׺Vn=tF[RӸȝBkq4P^8ڞ˖n``^08̆Fd$2`/U`fg=@t8n;;aTh!qAH bTwGqMur}?Va}\"S&5{4tM7QX#b e躭[n YI5l&>] ]+KsoK崖`^wӛdhH#H r]r.^{&3 0I0I@^y7K,`,Gdk;݊K$=O#jEͳZCxj_u(ޠ}mtڢ=31c8Cu䯄ɒ(WfDIb,Y5T/.>`wݭI=Hmpa2S5}ճ{J$HmP^v5WqR Ұ6ݦvVYS!CJX`YRRlz+|׵בkoe+,d2 % (~ӿq$.֒{X4xޮ-]%0^  B),YclC$Q$Pk땅A HeLl@ @i#Ӂ( *hMɘؙ(4{(hI%J d5SKdJdYD3 ZB=OFfUHn3҄sQM\j{V˫ŊnщOWXmD]_ಂ1#ٴFѩkjܶ$J5aas%S]kbUU\o봫HSHAl\YPw[\drR"\!WQIqM)`7ĩpΡJl5ֺmqhٶ[*ٶѣVŭM[ҹq k;ዑy͵Ӕ3 $[Q]n5ҐQJyPn ޡf<nyS8p@˷HƺԁŪ;A($Q"]- FɱeFI433b4!))(9E"(bdщz|q&ƾ^"KʰYהn6unSl0wy,8BH& cFzXRDc9uBӜQ ll A8mȘO;F[y.ę 3KED_O}dqvSMiD7'/AzK{J L؊e "`FZQI`ɱ&̡1Д}Q`85 wa2zj[MK06m'yo/!F5/gr2V$&zE9t: Ceޞ@p{5]DdIYwn<+] 'R!2^FGuWΪ&ryh|gkӐh/W 3X I{d_M@׶I4j'кnzZ'EV(,&  bzHP2OddҮBFFmSmkYmRţEEbmI5TVTcZuh HH*ZĒY LˁqẛCgk6fAH^(lV[fʍX*-jjXjZT-hX.Zvv7xY#Y6ѬQ)*zcc>NE tRFsp.C5@UuWoP5UfWiVj`qqE:9i( }uX=KBS$v-V*歋\j$ښ\Yы[k5\hRmmIUձN Xګ5eAI*j˵/n4˝,FO]ǶcN>Lh3mŲΫǻ&!"I`ۺ6QbaQY5˟-$ɢQF( !^Swf+xw',d5 7\;й7ok-qҮ澔cnH/oZj\ȅ mIdj"BIT]b,O/j,Y\;CTt ;)9+,j ΏpaSj‹9NI}qw=)A}IRb""A`lw.sypx2PډJLy])>f*mщ+jzɨzεbر+-'kB)~#7INZ8{6zV1A$ydu铏ο?]s:=g;=-T'bbwE*/|snޭFXX;E̡wZش2++"@  (.آe & 4h*T1hmg 銳f6 #32Ĺ)65) | F7`FPEz}ri@' moqaj P93!r"L8nSSஉc1E_f_],;Iy6Ghn $m0o+ZTq"Gan2c|Wl~zy=qz%6 b*"X$\c־vu0C@R@CvF&r+-d(-MDFQn7 3=ڪ*h8Nnt1g G4[?j {DOYvO3f[2d40Vc( ㋉|͟˿vEUnpJ%\gN,1SC Lﲩ& 'HtM۸lNLDІ0)ogUyJ5 ڀLhc'H\& ڜT{ȥ8*ڳ{EX#* 4ZQ%x'd!!Ɛ ZBIC!B̡ Q |nJlHS KҪ:N)֡6ڡtXG%Jd}HDvH@< @0 5 ( IjM~-+qn-cUq[]+EŴkJ⫵[ڸ}[v]+^=pkz!6$ !I :$v'HLhLN m4B\&Cv .,=2V{Hj3A ^С$ޤwK$ $@̛VBRt$T$  HC=%٭a^ #&ߣémI s+gwb#$P!th $7)$ JHa$=@qlPK0.Is32b^ [$%yN{^ˏg?`ܤCnZ,ɺHv,d/KXNb`edf@^ⴓ`B@!"H+ЁBNрI ̡VSpwIzfB &'BH@L@*ytۈyy #ږx6I$$SIDF˒ Bvu31$ |H 0hKOdZFaHntV*C1$Ŏ4X@ LCLN&̵Z՝YAM(F$ D jU_Nw{U12" @ BFBIa$auhi7L 4Pۤ вߘQ!du*"#hmpL $$5XHmX0$i$7ɉ1< W: 20=_Qu媤eR˚F$?NфilqDpH@vY$][X!qEc-Tth\TTOdǴz*oΫ^Mdja6jQhj5[mhرlj6bQBXh"mF](53DlQmt5Fx:Wmkxi7H[?X,0B[&uX&13ՓQ^V 2B C=)edYM%0D7QUcksF_s[Gp!HY,%l M̆  ZLmlFL/apY.HuL ^>3 .Hfί+jurœh ElkbDb)B6PmFU!F*"ɶ4TV2͋ʃ&ѴAVbTlEFɨ`ZBAlhFf`nڞ<*jܒ˶&4Sբʒc@CK  l7!BZ<믍u lF0˩=ZN pЁ'L$ LBRεXzCg mKL48Irs !@ٰK! K sZyo*CkQZ5&$&Fѵ$^sUoXn-AZ-EHj hcXEXߗZMZġX # 2@̝^[ _W$߇2-);$a tQaV8Wc-}*L 2a /hj(-ձ;o7D ;KXA$ $X %MTHv LbhI{C:p<e 1(9RgT/0B-J(B5T\I$$0jlYBS%'$ViIȣbT 4b Xm035J 3&NjȈBtWd!A$Ϣ`fT̍Q ^u"kEU&HRɈdH S1!MUJ0e2*\e䔭"h B,ud eJ`ԶDQtPLtX(r`M2b`s#1ʁB.eLQ,*Uf+(@g5jd hx  ڪк檋ѩx#P{uB6.56iX:v&# Ɋ AT*tȒLTl@%(* 2DBZfE0uDHCh8HM!2i-V!jX-M{)M+dLq-ApR @?E'DL h6w$۰`cgge+6l3Dkp/@ ѩD4B7HI٘ F `rJ S@r ZR,( Œ%%Jj4IBEH.MHSfVb@TjUL Y8% Ih̽6xn_Y@d(gT Q=)YCm3je$Y6T4R `6`tQd3&0 .7W/qlg)+kowz)<^UcDf 4ep_ 2XoT!3 hFRNAa@a+) s?$*Vn*HÖ!A2 ?~V6/bnsfw\ktF^z_=en(dlk;+Es15-n䷱hU`I:+;~:_wqFI:4HCy'5+uɸO*y 0qcw2mff{G5ߏb΂r{?,HdsZI G>x-f~[n#uy)A ok6=k伔V#s|_M2MM&#>Ӛ0h[QQ ]dž빌DIǺb.ok jP]2d`B! 9T=7ݦr3kY#jv>֏NS yӫ٫ HD8j]HF"<7H?y0^_ROYLou6!y+62eA]7ape2^Qu^Oy瓸e4(P %ٔ^%y<䊍 cOZk5}wCD|Rͩ'݈gW?Q+ W,mY0Ϫ{sfrUumY)Sss?ekvX{lztדnfz*N&nxޙ+j^ᭋW}9ƾ}_[E%!AW$b]g4># ڳRO);[ww{/SZTU,3fk=n=wkٱ.c<=nWerp~$qR错o_q#dvj g뗏p>#}xN{kEq}omaȩ|As߿dѯ:vÇbDs~;S}< >\.]OoTmL!+~݊{!Jh:.I7+$a:G}8 c+C'osX@DF,6w:\Œg<|y [&(iIHr9ZnDz:IQwEm44W7mr4 oҮ=Zι?'X6Wm8'mqHn#$'r|qTsa-7&m#DD@?:|K גye DcN4>)^8g9M\sgE9 ԮScC$Pm?ލL7uzˏ߳4OoGV[DW`=m/gQ}~}& |qyS.2na4mmz}Sv'-[3kW2FQ˰+[h9弹&o/RS<#]fq Z2kxm||'AΕKSYyXcSry7ʹ H!b^FP2xFsozN, \0κN ya?Ƃh"(r;Wz&YYLSHZ܍>|Q%H'=р&+氅*@/J{Eͩ&0wBEQ]ހulH&.. hċ'h[_sATx jWoF] QfcJԡ5jgF!R=SGL*"'3q~m*; c9j2N"=5 & ptG8!}ߔ )vΣ4(~ZCAQuoEAUF(ák7 (ʟsKtSQYi갱bps}+><=["j?~tCSZa:hT(@CpN1 fQ!Y\b!plaMMDX_SG>ҭ]ߩ05# >۽O̩HhkQ[j-b6ѭ* 0&5D`@/GhF䭫FNF[7j|uwQM)vv `Ø"zi }te7ߦ(.6Rfw+FS_؇ :/QE&Wڍ{ ߢClZ{.h[i`ay:z~Ѿ{]۶fA@t<&VyhWMw=#WjA #Q!m{cׄɔ"$ ؂Ѡ [:v!RVo۹o/ f~n{5=(6]I[N5aa1'HʊO?9bJG|_o8AƹmEdƍÂ$֭ηW?q'lڕqX bTE:Jz|/;>цn%㯱X*1CPRk T&_k*FFQдߦ˪~yB5lAklXxp4ռF<3*DсaF;r%a*=KRW85X^ҌQQt3F(W}!jxiWLݥ.𢋻NsEMk[PqR2c.2Ki1fZ/)" fh֦;ObDŽ`wъ"0Kؐ%9SǩPSv ߥS{|6@И곉tE$?ya+;A+Q]7=@Fӱcgv>ꆒ91 sѓ:AB%B>!LwOҁÓ}&L:p&Z3]NGds [@859cSx FAb+Cs풮xD$"$Ǔ$2 L|@KWa'~hu z]n.fˤa *BUBi-rri\!V3KY(I  (YۮlXڛ(rb-d-imIS15.t]Ӯ#IF#3o?C1ΆfI($"IRkUrm\jMOʭrZѪwFjbVjjTZM5o5mc뽉6j2hh=_i+I0m(ls׶{oq}?_Fq;bH}hO"SCIeJ緷|M8Eݣ}m!9Yӭi2}G(^R̫F! (3IBC rZ~vZ[L bB0zWLr'`^|>$qTµ Alm|WhPEF>}aL RmY3 ?R"z ]0Tj{+dyŷgNsmddRȺjnɡiI%$!d$BO.aC'HJ"~!=K$,3dY5P@?Y OyT  =S!7Zkt~8@N! K$-LhPHY2CBI.H`BC~rIII$Y@1 @Cg; n!`CQw,$;RC" +o6knz[UүȂRƐ ?ɒI?Ʉ0Ad!!s$&@) 1eI8}@@ڲIO &Ik䤐!D2K$:Vƀ%)b;tvEV2f{ IHYI%0̒fsRBHC  #H}:o7 BHC9$>BBڤܲI !D$: !;@5dgY!Ҥ JOaKB7[WV$Id H2@: $['q de^|L'Vs]D'2x'DIBcdRz$Ż&T0/Muw=-^$a5*zm~7sw _N>S!KBı 1S.%8^o z{7V{}[n|osi>ly?9lIԏi۶5wg~owF3.{[t#=_&dN_s-5+G(|[&:Id{W՞oǝHUUWy]=~{AOFӧO{3Ѵg[{m+7owQZ/OOq%β9e?:6 J;tpK)']N!?<]宕)Sܴw]o:WmC]p| +r}c!T.kz.2m+@~/҉(re![h(9Gz]nBIb y߆33>ex>N/Kkv^'Qi<]O?>/fjW$2\Ț't/'49?+vyZCC_?j߭d\wPCl=0O-?J{̼ރ?Z|>jd nxnzUW]*KS~}UhƱkFw]l`Ruh~O9 F"A5C,:NNhJu Q,mC~=taXz/ `/-޿ S"*^xˬcWHE\\8#Z|ВR>珶UW^uf/2l[Z&~R\)wmBQ BDvZOHeg&j$UlYgQ2:($V*djT9H\_xV8w$_/*R,慶.O ȸIUvKVbFiC[Ƿ#F(ܱZ};R;_n諗{,jmX]K_ /)VE4,yltME|.';I-2tbr8e3GBrVL]VƳ2FepOl&c3j'1.j"1׳82'ޥz'lp\zIB HȈ$Ng^cKI(A;iZmn!te^[qi!C{ۈI&ɵ>l *f6"!<֓@s&=5%½ gK-w)I5k`$OŎEN$[ 9d$^*ƼZ߹y~1a?씑A`m'ĐwhȑdBd&$ }bIy!$Im^᭮jmZߎUV"!;@ܤDhb=I 'Lc6&rI< F>~] a!LO-ֵ߅|m ⫍nRI!&&Y H퐐5'nI'צ0J)'Ed{Oss*]é0aY $2a԰ s `CTI'fV@H9 yl$ߠB~$d ~{wvgrN<A}ű΁%zGf",((pKow{OR8Oo$'2CI pI=I8 '2CJT/lϒ!Kb\/-|Jz@24T9"0 `j~h~V5xкf?Rmk[Yԣ0ΏL9࿿|Dj@ ֏ |#yyԿ"ըg d3jχ}9IEM c*"ģOf*zSJNA%m+uӋ?Ws#@4JI(kX1gBb_cKssq:R?VZ};'zK{OΓ*etq3li>ӫ4׃j)>OHCX"/o'o.`A@.`I%$B;עH};>6CY ixC!Y! HIOwq?ɠGIE7~s^/.oQ$=b0 @HOd2FHO|HII'Laa$,'!'&VC`BvI-HvK_Va'0`` fV:'&zdUۖ'w8yV2At!]Ogә{,ۤM;q2 Y9(#D?_R;Q IcsackUݳA/x@FA~qAFb;d[!d 'IVCkLsDw'LAtR OU=/xꨗ/U3du "duE**էo+USk _L5%:7@dV?x+Gi(DD(O\$z_(ޒD~4)\$Lln|U[%us3E Lk?7}4f&> jg=$8X9465(?²Ӆ@q_$/N7-?w& 7s+,vx)IxpaDO=˗}m)V.6ŏjO*Qq`^:?zc-q岞lt;(ݹي{$r |bh(s79V hbEzWHOr|%^z!t9a~*VL:ݲaEiU#*,RWhrW~ᆐSzF %P^;OwsOMxo0ӳ>[fi!q+o$/:CЄEAJ yuIsAawͽq V,&IdeWCcϬƿMj}_V9_${~q mqQv:\|WT a D6@>O'IT,kҭ֋'zA~@1ȢX]v{ԉD࿃nqkbr ȈfIL O+3A#,F0!+ yCx$zIgJ4[EMwU4Q={NtQ ?߯<V/h修ۏƲ432!A]Y<4WװyoB<rYysRc]o]nRe &[63aЯn</`|-׆ܞ!BjN`!ϨCY(@,'[P|BH{ơ22Bl y$ `NwQ$$'B@8߃bB!dpj\h@tHM;=Ebu_v')""*wF1L{X'> ayV_' 4i)Cuк ˍdX)]BB0 rl 9 5"t7Xl xP0#}UB`CߠkCd?B\3퐐 M-*CI$1$K T $Cr2uOMdd!|BK)$&I$:$!dd~2w0$vd'g$H_j08ht/Ʊm Bn; &fay0%4'CEKLG'o#k<AJR "LQJ].얅˂}5pݹ.k4s9~寏U䓩HO83`m2/7>O)״#?# ÌOO Cb`0zX!g-#d׉lYf /|QʪAJUR0A91E*Ǝ?h?63| i]=Eo.cpxœxmlfU4v$¿:{ש'4$?EV( +8VKWe T+_(+GR_Cִ*^˗<6Bw87jp 4wǽãaRDW%q_m#mJ#SC$mß PThv[0VW#lw I l(z@2HRUduĐ/?~ '+ܲNV(T | g<O:j~?q.Gx6+ ËT(Lz,#$%/fvZd'ҫl/QE)%@Ke Q> j`:$30L `ȋ;0KY"5ev^ٍũ@b1XW9g7Qe^~D l+@O>ș̲)l3^^u{t/'Ua ԋ,tcNتm: D..z9Lk9מڗ;Ӓ73E~]2&q\o-<ԶnlpLZҊp  SNF~Sk:#ɫΎ+mMl:y~H{>D"1hF2Jj%p¾ʡeBB)5\mةmq5\lV_^БF&uUu6Z7FEb-4)lIf R$JjDCh!V@H[on֖BIctL2 th}^rݶn!vP&JrntV TXO mon:zşR}B8|KE% IjKH٩ZEZ4u`{a<ޭwkӛq|U {8X!0VAov.ia~ϼEGl[vF)JHUSi|ǑRr}Eu7zcbuL&Kt4$UpB h`s:RP*G#F$d8 zgԠ TBg+Lqgc_wk GRQ% 49 3*@sE=gqܖż}pliżLn1i/wwǣ;?w&dNgX'y$̒CϤId7$!=f}GeI ⤒'v~z}$rHI>$_~Z֚liVkm}y:r CM7i}@B@#:CA?Gs_|~@BC9t_|tޮd<Ip|¯v;D$$t6{w(&M):FH"G`A y='Qh4=@>A^,U?E~_X-< cm4~*,?|3!`mKeOg.6|ڭ ɥ99Ê*d|h&3^祚j؁PIaG}mKP) &k`!!0ni0'zM!$?5myU!$ 0I@zҲ 'ޤL CҰ@$c I= 'ۋ.g$i2OP :4 g?5!!I'dU$$ǿy—wE#NT 6^Z&G`"ɲQN" 0n^ܴBӭ?1g g.!D+URITlE/ sZIC)\ο)C쒔)+Xd{3 zBoḋp3cdd%{6X ! Ϯ7qx UXjl֤y@AWlݻF^H%څҡO/W p?zf*$]嚩oҗm?{]ǢUTZJV \vZzxji75z #+@,]/Cfwf=py27zATi7 P .Ţqjѐc3%jcZꬡH8vݨ)l6:E+CBʟ^jMRYB\'\aD ~Y (AbGI+JԲd£n{EBzL=<AV9߸qyg&i֎ ]PTv)\| :ԌK1u a j _#r0xcqC41YMYYUk`3ہU=6a$"akyiZSB_`Er]TW+Fbd%BbX}~[8(Y1(+rOPod PLn;+Hf[ 2[pL uXcǚhQ52C㾶~)C `ף_Db="'P0I bC|T=>A87{z{IH>#$mʟad'}H^֑`Iڤ瞧_/'Mp@0a?!I0VvZ4Li״ #g`eyZ.2r؛4%5 ypd g~FDb ̦ AsnjY*aj ]mZhiKZzS 3 w`35^ʪÖ%Gמ>/c@>@?>X_cn?WɅ퐼+L^IMA{ k(-qTH"QXYG>O= Y3B6;̕TXF"k!54\rF05,Z* Ɵ+ԟ84EJ8<ȲY{%(X)d/0-%T̒#9qG3rÆMhwy$;VbC=b*//i>E4;\= @)>$<%UNȷβU AN*Hiv{]'qsopP? R@6A$%ߝ-!! /=/] MĔ'@(B ~@jû <njqjzHMv>#i/}޳0AJ5ܪ8h\8Gde1V9z8%]7ioHd &[, -$u'xӀ\IxI'!Xn}@֩n Ù%#0$S{֡'A`CA )C*z$!@Y 4Mi dY$XB!'3<<^V5/k>s$Ԅͪo3uBzOyDnJ*{?-p˒uBm UrgIp2sMvn Jj47ImS3,9Ԃ3zKtSuƭ&Ut>%M%lt9AɊ=ّJ&EU%u\anWGEhڴ.NebGeV}$w/_a7շBZ5 &r.US,2 `@3k}}\9i61h[Q3A6jkcvi)p ZH.mK5G XiP?;w@05 si{`!e?uJ#K^I?Yo%z9$+HO(C`ez!Ij|+W"mmז23QRI2{KT}BB Yim h*,E"J`ŇB@Yi30{+k!n%?۴ N;aE]XРA6`1MbF6ۏy%a:3z;]'0vYF T=h?eWLx,}?=0'FoQc2o=L`~P@EO`?!֡ Bkr'<_ݠArETj_X\cN ;o ;vIJ(`YɑOi_qMsnN_t>;/N]1ѨHocbX'WB_0ְTA>/HK^iS_|9Ux5zC6xȾaGLҳ=KA^b~ÓϷ;^[Gi\fLb.v2`mP(s0#G'Et/@VO_? #?tK˷k!zЀ{>C8?C3Cd!G4Of2@i}J|I-綐IHf&` חK\HmOhi!-hOeVu;m>߷v`V@< ~upNu6@={ ޤBy;s!3I'XI ?ZkmŴQm}qySZ~2BNS $5@=>?S cs)YrЭXKbağtp)4"uyucPs?@*j0eEFF`2Qu%0Sƨھ$hq@0@tq04LEDΣC]l^?g.{u}/T7O7,WqBOB] BHBL罹=<1)J%  %4^J{wwM-@4Rx7`XTaoQSD=$ Ї=O|*>mX0>0&gZ{Tt셓t=7[8;~_:l4ϣRO*&z~}97&fFVl91. ?*r\Jb-! - Ȍ` T~> 1`nVj;4u:凮;J"cPcC7kU,NH y: D~+~7Gm` !0"DFs (ܡ$C @d΍ NђBd#$nϰhaD@ROW"c zVC|ZMצ]#qX|QaY}c>ZLiJx @*zH=Ýk=N>W֓U4uAi$UN`>#+{H.a?x,a^VyYlH3\ذg:zTtąUCߠ|VO$*:-,% $q>=캝ϕ}hJk117F<5|O8j#JM5hjO" ֽB̗sur.s#9g0S!UW% =uZm?M칍5QL6^D?(I'B_iGשyֹQ3\=_a SXc׹q9J]D6H+=SBCmJ%wqf(DHEyJM%1p*›{<2=վ&v%$Xc%mqNQůz"2|N=`n<'>3[cp0'u/[vÿ8龄GRRGTÿyo]Y)H-תD=E'7.$ҸJh @#0H.[wۖGA\':/O>jGc)ǜ?|<ꬼ7v)t` лl[ɬ7=| u]&ِˊxYcWȢ@<ěfV ב]-|VLTR2>ri|l>'e~Ùh"@D`Im)t@yDx9Xsc.N+TEZ; Eo05˙. Q4o#Fd3(TφƀL4S@Id$&"BB}ׁ~:]') @$))$뷽.bڐwK6{*<+jX|;Xf(D|g46əuO=ue;vV4{"m8jnN0bcLNՄcBN;0r8n`߉_+}^WG-?]Bh ͨZQՂi|Ĺ^+3%CHe/E>ՙbKk7sDU_}N޷-Yd@a1~ "f;͚zP j#9VcaŒ`x* #d3T7,I>L? !cOv}MfEO'@T^kP,c n{Gݞ׼c$2qm5So]giAr lKEk+I̐;-F_K]\p^[#'XAJ!T̶o-iX|fRY٥, m/&R ;aJ `T0+d??J%ckSͶrz~Gk|? z\Q_ ]R&מv)ÙWl$nvNjzݻE#5ܺ|xACh[&7֡X̅G_gFnz'}KKkSX](~ezA'o[}ѓ^s*>?Qhs;.UKB 3 k0Qick3v[LաKʹ_#m5029 m8JjtWKOR,t#0ڳJVVr4%Y;;.MԶѽmǪگo^"Ě"7|~Z_#:Ȱ"?^gjye`ˇ)\ۭ.8:kS*MAP=?E:wM]c~ڥEWK ^}&,(M10n>R%:NZA2 s"1nC JK7Um}%wr"c=RwOs3{< 2ۘǶr/ xs!xL_(&_?` x*|? ch8-7˧?lXM˻@zt: ցfPLc: AeOf{( A1r$mد]+ mWr g9԰hձLi<ݣ2=^X`RBz7&`}~ ϩ{R>CNv,*={8yF+e}"B)g[c<&n-V%[׾WqR'/8#eE2CX1h*< zrT %טaM9Nү/Rm_&m U5a2v;2B$X]7vɣpiύ|eg@",10"DdA_ QN(&aw)W1Ebrc/)JA7:or| g~&T0ߡ;S <@ aL@04FBةyZS$dx}=4 iwU}iOa!' oBdd 3[~r8p2HRϏ ˣC-M7`qJfLv")%+ ^4]yrA:Owuy#'i^usɎuơ0bႆ͚dIwUM ")24I8#04HwX> S#h&EaXojViߡ^]oIKBSݷ""3ӭ:Vœ!%{lFRDȳ :4lXM,2ax((zHjXi^cμo $)2Pjc l^-!%ozt X^bN.?i?D!d?;RDZ4`cghոs)h҇I!/{ju|vOHi,xxU\#nNLs,[$&cÍ%wP3L66voF(94V_Vq/hiLޗcf$lP` kD`IZWKMOd@RhBZYr4ƮVs#>Z.s'钧>Q5stL8*$ (1T+7G;f;hgr'>?iucMa?)}Klzh]((bS'l,!Z_#P&n-sE>U[{RSʻow`ÿ|y|ddGBvN}G*:}Mz$X 5tHQqt)[iS:SۻgmXrn=%;{gK/𢾫 F5H`;$!ejje*l)'Ay>{gwrS+ȵ֪xP8pa&Dq@scסB*oDfYbP9WrtfWi555}Mg.Z}b3_m2h|ZY7% OJ՘GXb׉_wpwBJzdg 0{v(z}_ixs|AUYg5f*5Z 4-=ЮAi`ph@78 jt4¿?֤ T{ 37a˴ʙ9Ue#Fvsͨ͆ey>Hp|=~*,bСv3mrik[t+EE҄ Md&GvbNmO:5ۑڻcZ}x j-%^1Dڜ GEt8n ,*γ6>nWtֱ7(ø= % )A uf)!Fdv@( 7=p[)]Qaojͷǜ'H*Z% .SK~i]EsAIr4[0?a& Y"FNZ9{l?]3P@UzVeGXr=HƅzԺ$ l)b5=Œi8[2R6Wn^wIR6vhO_R\oHֶF+nҝJּ;> ZWݓ;;vW62He)b,"z ,y.a:a&AeQQ4էb Eu䱤\"X>`%,UTc%,TKZ:l9Z@ֆ:MStxP7??mm+SDC؎]F0!~VGcSw%_NdWZ'͡qƫ̼<*'`-: 0 eז KDAgA7\۶i|XstsrBYߥZTT@Eqyum&^$,e4* j$ gñmm__^\_őNmߴ(k6k5`!a˸pH`vUxNN\w=*N^G%Tm8VݗMSГ" i/n m-ūֽbĜ$:uCEʬ鼭F""m4*W~Vt%~22s/4Y ΩqaY?hSZM6)xcYӽD-U: ΔS,<#kT,Lr>5\yLtNN{Qkw8ziɷtب,KF]dv +u`F9Wdjkft#rE^D25x3xa:QuZ`rzK( Bu2Dw ib]E M+ӯnqƶbf j #yZD ? bOy8bIh&A)Yi骉dNKW3Hpz_^RҜRf8w<7,﹒/cGŗ;p2OZ%t^շʟ{KOl@^%"|vH_ǝ6 Hl5)K]L_֞S%QXQ=naI1P8qKWT|L0g!ИN qM7e{oy2>#!O.celdRW=ܐ.ܴK]>UvaˇDPhSt.@%7{IleNuԷyzHm.3UHρ$R\UӺ0{׊@}屿?K߳:Քk%N N=֋,F]\^ S#kOf !珙h4fW4.Zp~P?$ YDžFtX*SgEc9C_ͻOdv>>{|M2K ,l̛ud fõ(M:/hsjKB)ł%#;_`<ߟ&bYT_<Źe8s* ,O[E hY5j91}lԅb97|%vH]=E,^ EVb hV Φ2^"$ؕ4)ag_.߂UǢZYaXzR+I4gab[ D`ExQ/ݫpkہK]-`",Vǵc qh# i۶\MB `bmh0T6FD7^eB ʃxd0c%}oJ$];%뇷7)%J ,k}CwТ$ª\P,7>,5jWQ-xֱUX^{:>Xep.::pi\ Sֹhr1e#WBV!4NYT|$vGk(nhVVQ%0qvR$>JwL` [!~QF_qpHamJ YM$;l˗ r{~)r`sDHS6XnD.-e-\#an`ݰ^+5ޭ=9nr3Eb+s5gs8pȎ?.t 1BPɠKD6+7~sU|wkA%Y-HViPB.8EÍ;z06]E6 @+MeҰ \UT)[ex{KP禲p4dI⡏4` (J'0/Z$/v6BɵP%_nB lJ+`nuBn::ml4Q2tB^H@Fжr6M*j0-"GRϋ1ؾE6]38Kj r|hd. 8W~)JE]B[ԥ+;0 e] c¹=>_/c񁄖zlcs|eiQ\Uv?weryRs"uTU̒Дnj#j/7sl{ l&8(M%RiQ>vVfܾkt pytn`33sB}y˱{idZo'g԰vG7=$q|d^ojޝ88(ͪ2ϣd1'꒭U@}0?$fgU^1Ȑ|{*JF g$Ǿ"܏)v##ƅYM<gy՟ڟ{gI|#1&[kSZE{/;b=#yce[- w@g_C&~-ILC=&e% |dN?~mq96Q}N8t*=8tiI7.գiνBmpϺeK3 Z1ո[.ĭˆI0,Mxd`1]`VyB2<-& ª訬 :$ 0}Y]*lܦvon<q0$$t CiЯ# I,>4XXfT?G)բꀬT,OF5DJ(.l6pZ̉70T3Ew buJT&[ʹűPyZy$=IFTsq>WπUf),Dl=-zǝ7\Ud2%̓QFA:rIZǬ`D~ϟnDE ȈBssycv>>nxK/NCdHhTv|??X;kV[O޸@ǶRƗLPqg^:95(hڙ#_z xĨRHd/+gP/`{P8/.Ot{S )8b!f(Eӵr^f0Mz*1U ]$R뭉ou11UX ӰϵݭǔX#2!Be!CLjzvC U p`" s:Bz;Gt=.x7i ǜLkyL[mad2KmZ9J DPbHa7wSSvɕHwW1hе+wt+yXu!Ҳ\Aˣ]C!*L::+5?"*ީc˨fr3G(߲3T_8='85lX5D >{KzgrmwP ZY$!w_y ?w,'EHT?I12, =50a9z6M}e foIyN.I׭?IZN{ ӡ5 kt*B1c=aaeV]^c= QTF-ƙnXPeGpM ܳ˳@KCHtFvB'+rHQ)!zM!! XO$OD$2y@.`)"$:z;6IEؤ5l5,9kZ = ,WHKH;Mojtun4)#fDYB7ED9$Q8iTڻz1:6v,SVr 8~f\0Ҵq ݑz::eL|W6K"IJKNGg:>cb @g*̓ungaap_ϵri`BRH!97yL`YlTWC=9%5P,깵䤀@1mԲlZ_!;q%({%Ӫ ַwV@.>|pᣂQt>f>+[%&dccrlg*|ݎeؐ 4}%a?4}0hZB1Ecc]{&Ev1xwG1;K?eڰ}5 \|<Sb m4pD?0ɤvN-y9G\a#2Q8IE療+'-(5K -v|a,sm&VI<I2CBObʒO[qUUnF,!@K$&{nìQooaam;I ͛_y}e܆!hRܗ@)сM (/eܸ|,h y:CbbȾևH!lO3~n |(f Jt"A.<:)879Ϋ;-NQig׻u?^c _eka6Oq>| BT{\ (D>q s +t{y}`;ȩ0>6bԢ +;FNLisN nO5Sݎ];j˔"хհeżE(˼* ƃ ᓎP ^5b1HAg5A^Q(8's~y~Oy}Kv;}3{=eD,敮V-4}x -/nQE,܄qbcC쒘HEm5c[CvIRC:b=-ip9%byu|4É+?[af\/{`9?mg%hf:Qvz:lu1E<.^(1&Ej_}<75TP˗'oQt;Jkz\y2̐eF@D,s쎂ZJWi4,׽nKH#AiTS8qh˻:LIX6Y Vo{/bVsf4ꀊ!,j*htE]o6A6}v\S5}QG:iJ!r4EÒQ:|]uy;KELV?Pz{3TƚMb|d93M^v>Q`.Kis!UC嶧=gZf,IQ=jci "oxJ8pPNexEL٤\U9Ub_h۾O 3C)ntJ&ˋAֱ1˞9(( d E@sdW7w>]h)P&WT}{j@ q؟P췜KatQ0rq|Jd>fC0 2 i|1G+~p2?ʹ5#~FذwI<,20~O[9o+t͂gE~ebzxiCj)c6 E.fEDA&I {gτ|L-rE#4|}7uBWv\|o?Brg*J7tan-R8XbdXeIWm\j*Mi(j]ԅchfmS*!>͒ϔx_v߹x^uM0!%0<[-K2dtEYa)!ݒ̄!``&pBF~%'d*3^; gQ>k"{Hk_u (6JaHox_^qF+^s =$vN!YK , NBL椀mH3Ǩ?y.]c8ر40Ky@t%b3\{ |՗~vԖO5z4R?;oӹIe s2l Ԡah~s~l#6ϣHz:&Q`|_3dFb{x~G_ז?.b`By M|udkd){u_w͠F,g2{ Zǟ wJ 0w͑i ( f sBiJ`Z %[R{@!00\CPe7%-P$W.,vgii;k V,[&%hQe6XSJVq3Տ1.Մcȶ;O]VE!!bA)T-9deY!9@.M}C6+a97 Z?qQLZ[:twCU n뷽_&3M5@W?u=#qvS5R1vFF4̥F̑$Đܕ{ās c/+ <-+Exa'#:`9H#TAg|xj!YEhb-&AhShls-8~_8gk۴w[&y@\oPV! xox{?BN *<?٬ ]J;{b5MHF 31>(2Ef5,\) Iq"`J2~a tH0or i?08!=d}&md )B d~:̀r iHuK?:?rkSjzZFOG,u \$i$ ՟0A@Xshzr6/aC[Z8"2x7\N?ɹe5أÑDFZ,qrTH5&_\WӋb)wRz~J4s&9NsB9T z MjHG<ffj1+%6BT*7 %D.U¶~/C/!"yVjR3N>;X17~B{uGR% p "ؠFB̑eHQH UJB*U dY /f hƛr$Zkn O~{b;WV=PrN']kز $ڿ}Cqjkvۋóg&NuPMZ E꡺~~?a +1z;d,SδMfckq,s݆gv!ڡïv>$&i2@gAHmyzs&JJGJvZ2b܃`YOo`Ӷ:QjrK ^\Xj!鲰r<>h*x.sw^?f=bLjBz}SO/I>oֶ6"2n:(f?9N~?%{ `d5_:٤Fى@P`gDF9kRMWdjPnAL%Q*RF0^h[1-Hnor  Q%%f  ;TcRHsՃC&2 ULF&LXE)+_U5br2AX"VS5J6P$sue LF`S' 3ItڂdsB$.t+0o,(3cWC!+9qWQ:a%,҆c$ "JnA2{HQ`6tľT\z/)/Dy`D,\ s; rӞ`觚L7A"0dTN?giT8l+۞Ö&YGD]|ǐf`wlj@0f9[gN,QD Z ߚrUT!<$#v6rCǪKD(U_/{k}e338Ld SIdRĕZ@*‘l FxѢ ْ~5.`pLZpq~K" ,1n.v5u*^MӋ @&Q&]aT25Z=Uw}%2F] L]ÊYݷ7=62.(vD_ym҄DsxkC&g8'b蚴 =J&Iz|K:lrֲZЅ}"]kYG|b5-nK@=*Λ#̵a%c{>e EZ4-ݮvs/^?}XIo41AίJzt1վBk!NZt=h1 繅4=¤-"*mZm)'}ZOy} ss>,=!u6(ON* `l݇[63JUslN65($uC֬¡3HԿٜk TCeJ28<¿ds:}eO hv&[0a=f1T}sn;{e͟e>C|=Ì &8 ) kF9:^O;m"caN(X"CM'XB,,=VI}$ 1BI#nxh[:ǒv5IT6=w-/!Zۅ1C^LVXd_E,(;z/۷WI.kzlAf(5ġ $;F',w1T?] ),GIJHi>]!'EoE6ə~)$IfI5D'Π+'N0@m8Uh|7ѭg7!G$6th"O5 aЉ  L-.O[FK/S5AS ,(v3W]Mi 7kW$6qiW#Ϣqϯd!ĉ:VfUwGr^OM9E^ u0+2|áQܓ(>h8摑{dGc(VnnDc^g߆ ?fE(fy3J ? RHl:V.8Yv~RDױbni$Mdaܸv&e/\5[WݫMgQT[ܩ5ϲQ5տwYK4Bɡk{>trAOҪܶIUIh׋(=3_HKs5%Y3Sw|Y3ex_h,Z?OMc ?47ҕ"pK)U\㢕qKS)lWO=!2%t# }sZ4A>Q9K==\uW仢s^wzyO|FJ}3yfDbӄD ќ s;_9le)\Tg/5Z ڋd:`,ߚ;Jj1񿁭*uhbS<߭rcn9z̤v$HE Y'5:YH_K&vAt߳hՇUYvG!,:åvpqo3SweN퐋ZYX\%edg]rΦSu\&WTtL4.1wS(T!B\֥m2`_Ҙ?͛“[*:kɂ윛_bn۟/SpX[~o?Pu}XpQ~}/:>nimhlc=/J_[MNqZ䙺[3>9WkY:ѫ1K}?U)Ḣ+c=Q<1N_k~z헩:&~ϺPtX&A2~kO~s;HzJj:ʪqv^/^وǛ9(2_9$YP;# 6JX, Uv(Pn;}lZ SE!\/ aT&k>~TdNVFu monz͛O'B YSXnM/]͠UGnУn.TAn[ٜk3` YOXUB2d'rD Ņ6.z|W!{Ȟxdk}tCUҖ,`gctr- PF7/qYR2%7G5W0=I$V}~&>7:ѮwWۤӓ`⓲j#U uXBkY~6Yi!|W +sFť]9茡Ra$iz9q^Ypn!z4Cd$~}pN3r8/'{NԛPݤ ?HtF^}MW:Ư|Eֿyډ:J;s| Nm~<" En= [=MV!W K30;Xb6~V-Cl ﻭѧdY4QyRzp;| (r{_`\(`HiE^M/fYWYls\*2cVNc)[ksR[o-/}9`fAr4y r,ڇd/>89zn?7zى woQ{(f 8Nb#yjt:T1JC枉 VR]ў:bx|a gd?ՙ MNM L!_Tf3cgH0AAK8 u'BM /VX-/[XA ،^YWhM%ty&&9xmT߈9 RTwm܆T@Z>Y^b3>ܴR+.0T/D޼?jR\Fld t<Bh:lWřWm0?*n9R|RWY{C ԕf/xS%6demVܲR WQק62s}$o%³aGLEw~0ckտZZK:Ha,.ElUv2nlHQ@)nV1.FYgW0aͻLXu3QvB)kh3bz/,6z{u#[9׻qAm-#.ni2^cƹB3- t+!hf3qMשQi^*&jY!̺b0 A@7"3? Cj|!(ҍ u1tюI($Tw(c֒)SCqYcbnhXx ]#^mNnm)FXÇSbH"h!!õ$"[kL 'IqFx<0o.zjE@FI;QUsƤoqNARCq#MM Mm\Nɫa[mӟ>C/^{\W<.O,>Ӝq)?xj̳r+ޥݯk ֵzU[>T7Fςʕ?X!YzS\R ^d`H]@WvDY4K61aHύsk9Z9Ɯ`B/85jPD H~8'qy]a=x;RRJRC?oFkR6)((DHաʂ PN<*fXAWx QL%Y3 ʤ.14G<g9G_w5_#DOH#}@E4H&fG2hai ÅZ~H6f[+X8/up?nr͎~ngnݪ&9yQ]|4&Uy &ު/˦zYةm4W1鬩.T|6%g6eK~'>,^e$ e4O. YZHw^CKoRb.'ڨ\~vj5x}hhdn!dO33qp^>}MWhx3f ?ASflBs%_dž']-N5O+\c[O]$q,6x| [7ٳ01i 8^aT,haql{5mWU5&5G-fE=oeiQF|;i̅nqzQJSv8@ְM,9ioKZCؐi[ c9eqj5,:h$5^ iZp1o@O3yET;3sh= PvkۧᾆkTl%fe˲3k"M4m'~+TXOYyD!zNڒ&{YOQf`CVUy0ʡuձstMR;tN6+KWfVx-l{_Z^~zJò³̊o(Tm}kfHs`^s67';l7)" z!rwˆw&Oeu{ 4؆֊~SilY/'r3+鰾Plh˫ә^ݍEd(ythJA4iM;/ҫUrw1qeOx)j#%:VqSVWR4KYG +J'md㎙1ur0%1F; 볗"}INs5&\~*fQIRg-̥DL t j21ZԦ3 4dl='`eҽGrk^9Gjz48ľr+NSVmhf?2S Nfxc+g$"BTV4u!@]JAZ/ Ӑس!.$l*;ewui/&#CWQ"Չl˺;LR]>:|*L#}1]R.W/3w#}:df^Ӽږǚ2CU`GgQF+ * o0l'<3Oʃkte+ĤXlckftr 2]驶w/N74/{EmE%fB.93ҶG F!IlVxF]4TrpF+u]EI9F{ZYU, ē$b7"Qq8u8_6:j1Y vxhYql>7wEYU= &᣼΂QO:\t* WgxScF>Du),m0EY21㰝DڙT|&k"[Eg9Ȧ +ҡ%؍NU!=lފis7SZӀ$t-E /,SbMk3xMFE-YP'd*gz͸g`\c܌{)⛼7`^DVwip/߫{Rڣ3_8RictK}+yx_l!zKjdQp5M&1|},|8-Cv,e"7]ea';ٛDlr]>e4-Zӱ;;pE^(kL`6K7ѫ/Uy&,%;q.<_*iʑ?=&oI\q[?9I*qkL#<觩sǻZd>X|U2宆 L.-I|䁅8VM,/'nYEģGa~EF>[GSZJ#?⩗Mwphˤ3gThm~QnXR-'vY] o[s"x[ɎLLeB>='#:$*ҝ΂܍dk}[}re _zR[Lͪa9ڂVAVB rф6FKc}u`3/}b1ř-9)Z[z0C+/Ai=u/[߸*-zg1:?uOTq}6Ѷe@~] \|zW+Lk})ju#cg2k^sP(9`κ,k;`.ӽacgAz[SSfk 3wc+Q/^Xuѩ,<m&/Yo}wFBѾG"|(2I*m-L-K0Iya^1I9qUf…!](О]9[YPwiNj!$#[4W,މ~hB)F J!0TY#pKGaڳna-+^Yo} k8:#R&OGn)0R2I_ti{1+~:-P:nZbq0V} e&łxp2WvQKVb [29UCwNѪA>C;c*?Nmdc[Dr97ki5"3X/9yV2[q^]iW?s|8qƖSVi}r7+͸XJ\B6e{F,d}}pQw˛wyO͹V`2uDXAm]q_܎mFMޙ O:Zvob4u4 Uoz=OYE>)1׺pcS;$Qz8AQW6)VӚیFBII^2mm*\ws#.3)*nj/>Y xPK+b6ڧZOm:NRZ㭬Ms3Âu⒥+ 80C^Uu־+yԯ8cZ\[TEQbTMqZ1lؑzD"Ƽ~:5vE\[È; ha-ڲeٷ\ұzŠ_Z%1 ke7M&0ŽyvEɼ'.tzD{k+Ei.ܶϑ`_7_qlEje.PIuGHb̴^_kkfCiōo뛗s0N2BY V-7F?:[萭mieL,;VM˘}>V-jme2YXuQX\{$[; ;/=.boucH Wy {(AaP?_[nYNxu&U;IC1e(m!$DV6rxQw!y=5y+(Zu4z;ĺW)-9qRibI%tsU= i1{7hl:qOٛut2;a1N{W·si117ౝFmĬzvѲ涩7~-MJqbLkc: ŧtL)9T!eU}-E%h`Q@h8JfQ1WeVJv+qy#i0f RI_R"y Zʸ P!HEȡa`ǻk>M&HwL ?w?i} G<'$1WYQ}B/@jVuoZ>اg_gw_dO(3={o=ԉ[x}A0@\ΏnhsfLsEo '$蓅oO\uOթso8jt^+=0\I~G\ L0" GjozgFckIA3#W0M̐JGDÜm_noHODmIF_!dQ]f8At!3Ermn'o}o;Wg*BCθޒbܯU a`a#uMFoj(MTW5֫Ti e]n5wRfZF -UvjL0bЌ HJYlg#{9:TDT 44}ʪ:eO.L+WH1PPԬG#uQ,08h1͝ (YE80`a(HLnΫ(?}f&|<_3Y?Ƶ@`NDxIIr))P#;Oi=hOGͯ]V`͈{3qw`2 B``_ܚ&Z5=/ HvgˁHC@抠cH19pΒ/ (lx/_i]5qQe$įg1g00 H¾=@ܽdsm^E02KS06\a >؟Oe!d)$?_T;Ip {r!<#Tqx3oUK#Qξ7/rP~/R{-@wRќpy(¯M7oX뮞$1W8x\onaG6](Yj ms,f)>O=iZ#Uշ>#m^U,~>}>Oc={V`M*O;H3\Xۄb\0LC!Cͽ^5l!tz[a--m[`3xk\M 1+͆iϬ|D,qߏƨJ>4Quw+S5[sګװc)9"IC9Đ|º ƷRn.\Vl{/7"CC[mABR&$.tbMTTTF߷i-t ֢}gmuBDBxJ<$AW_=͸wVιPFf@(8&h7ӿ 5׿cxqϪ^3b {d3ɐyfpDN -m7E@Z]_gpo38|F+=]6klM(w.%Db `,pLmcߐ8^Wzw}Nmt+Yl-PA\d·5h;\i['& 8A o4VbvMzlQC8X #5 .(790=Ǝ ,I#:WҸϴ:ӑ탣H1/J j {uHH R طU ݳxKP|tE(H8$sprg@ĜHT>[X(Ç3(ʄK4aa,L~<ǔNʐ9̔ b+=ZZAT;/hM*sҴ}aGX u[wM2N& #O]V:3{2gcvu8芅@>nmkTi=<ާiťq, eU(X\)jލ̆"TUs; B< fL}eł1$UMNк/kGJJ\u6&tO?m]FBQYh7:md4R/[ǂ]؆:64A)w<+;\̆+&,^!>[w%ל~sݧ?e7w׺M$6b6tCuP'B|K ەW/ˬ&rsض5=&>y_vd*~[ 5Px?)릊MѿW?/,D­.~[IQP l:>LS؈1mQgj0 \#7nXKz,4O{ N 58,|jb|o;$'hCU%b(h%N(]b0F:%uv OYv Mh#%zsL@ NT; 'C?9ρ43A׭ w?NPO@Rk.xp6s!Spp2öv<\o(2qL7F`sRcXl}H|Ti~c cBIIp ,8=հ;a{C`ǡo9nxdrJP%[bY O98;eo9 0cqȘ:%5!\6ZACf7u?+4rtN^k_)i؀j0T8>y܅kHb- g"f9q9i\Φ=-mԿ-op8ޡ+RDP5{:`}ɵ@0{f(aQZ'yT,&'Ip,z$Bu"da!H6JB.k*@I);Snek2KPP% MV_%"7Xa,^CB#Bx$yl&SXTJB-h4uS;):Ӂ+N8b?'ЛY.f&,|za'ҋq?uy֏{WAQ^ #uVhV1-qi9|iq8\WRv1'ZtJow*cOHcdh_R64zEUm~\7j~λ+@,Q4,D:f97<}Fq7u[Br׀!>"A#9TǺ3@:u,ESk11|K~xNLUŒV!7cm?'5IG²= *601jo#gsgJ`~㪅a_/So5d$h7N*⽮0Z>G.RtxA~BH~HuC<4FL x _c=ޯ?3`tOZ۲cRE INNvf iŁʐ <+Ç y4I;%V:,^;kV?W XKUzvBȘ=oPꚪòPC]rh^VO#!ڵ[UiSZGxgn55:_i'b, ( BԲ" F$E1稘d6&5c b]_moZcDu^;o߯oӁ 1-;DZ &K/:5H.`ո|-|sZ|2u 79経ĢPn-ޤ%jit{ݷ_Oxa[:Mu&" *MӸt*ʊk;ɻcN4h^I>f뱾gwR,PbI2f\q֓UJ-r6[q|\R8}dY fݚl )]V0gX7߭Uc5s?=ƻ=AϥG9|6}W_kkt*P;:6jf%"/֚%-RF1 +(cް.hvDܣh[?'q c7M*0o^7`9^6h Yw7W#XfkXQ'09"MR( ?p=86Kz d4Rޱz–vSCyD)\5}BPPa@#!9éݳh6-]kI'Bk}b|Mנo]!)A%C԰l0:qָ}N]b[qbȁ]6\w^{|ϫ'|&ғwPV#HmƳ"ܻy{rws0wgĝ,mxQ_N]ЎFwT0_@?6Cp<,Ne؏n\66VИ*ab.T19\W8՘EX@"\[4IINV 2!>krp1;D h!6~7:&z !N:d ?.ʭΫ}Iqf/~01Pkz RSLZMw'F+;ΠoΨM2]4|ļw4<Ɏa*@DF1\,rNŧzV{.9gjn<u;[ jLu V#~;/1))N} "QM`_#p..ň >Nel @贩.y()OsZꑤ|_0)97:VHG$ BJ"7.Y]]`ڭ+ۄa%Ϩ69dѣMbPHYDZRa[zw̗1W=pEdb!|ݑo PIzHvLG2~5y>cPiyjڥ[J׵oXo2{_\mrPL\6l΋6څkwW $\ڣEf\gG0}0w o.&]&s',X= $ `D HYZ2Kp8 ccH~;qX 20Z_Rd`~dlQZjrĺ!!Z}=!"fq h\bd)!B?رomkc[F^։y6y_NݮQ(,a3Y.el eeFS瞿!q'ɶ[4s:|Hy$اTiS3p/j_ kuNoݠԆs{$XB]|,8LWc(آ$ݾQ$;cāɖo=F_yf_?`SL22(Ȣ*XBhqG71z߬I;?uokR$sOPS?vxqU㽞=-L~C`ewF|W~k 7 j>zu,9/ױr\d?67^}{$`[TԸk޻caf7 1Qq ,۰3vm!>=C(~h;Aoe:u2+ &q^oL@NrX\ouoo,.y˼FKc:h4̤~{.''f@`*Sewpϓvu7N$\m iMno'0ۺ࠱Xg'rVSJ&+_b'.рOD ѤcKuZlFG4k ^[(p̾}kR1<(i; a V'{4:.:n#CRn5fE܂tZt ԃ[MtxKҭbIi +F%C%FZ]hͰVW\se~Ә ֌#W k01a*ylߗK%K%z~}p!'.C}\^.3Ǹjy% k7/J ý4-T]sjd1OE0͒5U\NUIvV#l%c|Y*xSgZ:M[{ qL<ӭnTH0?) 3`O½e) j]u 8j˛=&S3$:FD~'>s PQ )1&I)IjDkdu]c25K0/U2#B ~DLPIhK-Gʢ$AСdjaZB̒ZA/[8E>k{c I$}Ы֦,$ 98M=׭t(%SuԠNZcm@I3=߷wO3_#Z}h:<|2y)a.A<ϓqxY)uRTIB200#6@kWW. c1caop+] q vkSS 5g1ME#S7+zb,~3 W:`ƍӜeH/vs!=UC;7xk-e "7 VF7 G.pD~pT">U 1G[O?Ӆ;QGB۵Lx,3sQ˺?Zv`\ݱb\TPgy=N=dvQֽ)}̝'!ף~"!ceҔ,dQj6 \:I[*CZ֦ry2~}+ ooxz~B!tTk&H:U#vQ (K^K.b,۞f]ηLa|h=w Օ1:t3.!Pb)~S{}BLsr'Ža a̓$\MAm$V$Uq2YZ|UԪҫٿL#q\ۼb߰M.:%zZj{]"}^ 1'$vA?zՌ"y<`'BF>iFK9V{*%NGXƬʣb1?t#cή_##R k:-rC橁i_zK+dAH/mӵT|XT l"<5U|gPfs[ޑfSfܳ8nVir]).9S{;[)X3J"7@Ss-]u%m[q9uL5?Oͭw塓AÈsH5R@ H%IBS0þavŨ(K~=5T#<9◛ډ3 tGGPٙ9:=O3 h~ޖ!Ap nt 5`̉+Ł.3~6f.DZ??MmnGסu[!w8Mo~ \v9㪱WQR7>pFτYynuo2ՎJK\Fl\س$,kZޯr,}2aɧ+(' :,7u'q觰q{w/nhju-_ZDz'"p\u 핑 }r,+~Fp.Ts7`~=v>ԅ0L6r@|ԙfZ|JN&) eAΘ':D"> 9K\3i]֔yZ?)i3s{E4C>3PYD96hÙ;)-^Ñ-ع2zyƲ8V⚮|a%=m`gЃ`hg1saa{eZ>OvvOm^ >@$0O)Ri;0}ât< /Lt?Gn}2Pőa7 wﻋm<\wQoeb]S\TYmA,&> Vɚ4uT%6H0}Of3 |i'=or^ѵѩ:~M~M/ ~avxR8Q<),ԣ=҉o ^x}QJEV3uFtLl$SV91 =I6VIZOƢNcoؼvr퉬OQ,ݿxNR9r~8)"?{sa|E:=鴼/o{U _fٺ= .=e}|jvq5S>"f& @[i.-(<)*jH@& )U›>J),|K$Ƙ Ǯĺ ]^f?m }` JH@> ٱt,ռmKc;=G7wZKҦcoȟy-.{4DA/fZOE=8@J}ثpƌ& ʥ.^ۏjՈMqX5%̎OC,d.ŒF~xቩ3Sǹ7<=.QTUy϶2qk#yvgIkwjZWgުeaxrg!OE J!b+ V٦ㇱcR/{) wXXW*l19i5\;{e׿ϗr8 h1<"g"q"6 dZl}dIdceI\36Hbz}UnFS/ٞQL3uUj/ V?0 V!xI2ŽΖ M%-a -+k3%Ew`**Vh]l]F$s s}k|;9^cGFy62)1ƞy$QhC" FDTBUHĂZ.'Ȑj r9Dfu6v hd#u\?G!S:y+P !r F b02q58G[]KYKpTo>sKxfFY$'} Y ΍Z@qω+R7t{0ِJ#H0i=|U|s:y@=k> U-a?2sUR@BX>V]b 9hs:s oV3'cAH-VSf%3[52řLK8(UаI3<#D:X| (2$`i/i/lm.ZVG3TOrK1 P1ey'~y^wCm: S_Wx0A#҈LSWeh+rty歛5ˡ"-^9}{u7rUj=+OcɜqZvkC لu!xD://ďx搂y3%nZy\<9E#`nwŸsc> }Eqn#/v1'ᕰsh~oqpe~$hP Ki5> !>H Ȱ4A˂cys}l>?T͕ay/>\fc#ѷc+ϵS':0t Kyg0ޖEn\ao1X/nǥ߇/mFFsS 5|__U=G۳HQ shLQUֹ%,UWG|Um)^F]#_:#%(X)o^O`')Z>H?_šm=Foރ?.0w!w<]=LG=(N޲SJJ@2idۏxVDWۑr h`]2iZ|y1/(j-%oﷱ !|6~k [p< xMЦGV9`|2c1'6 -ֹUC1Ӄ`= taO~>$h^~|gv|)%t^vDU`,A52y0۝͈ j=Ļt9WyzOi!ֽe1Zz,4 >Cm֟}?)%)WsjqVRWWHD"+ ')0ZTUzd)X:QcT.~>g̠1P6u<< z|g7C/RFH 2ct9NWoo-Z皃*e6m:w]~9rl Y/nxHm^Evs ?U=Eqas>, 4֦zd3eY?A3hE=f ?7+tوun }%btiw1C]GQc6-Et -n0{i1RG׆|}TjpTX$~h[jI~ G)↲R ,˪EE"[W6WU)*?˜"{5W-Q G_NoLg=r߸2@Rk8BPjku>~wn|7\S,HRC-aK7='ҡm~mVmCk 62.,5W1!Ad2#bz, ԻNe-} Y M꘲`)B R%y͗l7Foz&4\k1R͵{d֝,bҷ{cuD?ЕqvHi` @ . veO8޿LU{5JP H-0xo60ѫӄO*c+)??cڻD.2s{&P ]&}$ŊZs3V׆1k5NjS%|M )2NƐIk$6, +`8\]K6Eg=x^Ud $ bP`zǣVCKJs˒;;rkj"8'E$ug9 2ܹӲ<;A5ڨho0gt$ZoH)@ٵX̝. bV`{3mQ,B* hR9UrY`ĺ4s]R =XY]y5:yWeƎY2jţa7;YU뫒(i%n.()?IRs0eV*y꼄A p̍]U&u' #*XyJmGRu(]`ܼLI} q9hx>ªɉVmsppcږښ͜6kq%ru\w$aZ܂cFfJ pGRY"S"*e)+')Is?߸.cFϝm^'f2 SKdk=םLUIjR߭$T 9ԈP[aaEI2̆]թ( /ڼ)r>yQl3oc>O*:x}\я+R:j-A2j=pvh;382CR gKq}Z ^"CE0 :ާB`Nwz3de8I42iI+Hn{Hy~|"@Kn]Ͱ8=T˕?MUyِwGǸ>"oHFNġ/ﻑ\։9]p%濮woY P7} }Np ' /Y]x4GvAhfh򉅟SfVMd-3q8r9IMqpԣs& _oR87uALRs#uHN(z:"Xe+=1Y6@1q6ƅ]UW&ih"5kn,\Ǵk)A-t:䒘2'J՛c sO+X)c$m8+] zXvD¦drVDaTFR˭9_+ɯ5>3rhs|o[,co:G\ Uϴjܞ;lvr½ʡgɛN+ 1h~"Yy[ݾy3?!xlj[pf,Y~Y lxCB|X]NLx4*.Q~3X(11# c_j˙fC[|\2H1T8,@<jyiN˚+yK6^eFql;*Sm?Aˑ$:)b$T׋/_SÒ6u?4xhQ"tH.E #^UG8l) #2C,MaxD'U,yNn'V6Za+Lx[Za{:-ouaK *zGGeɄ?l8l3 TAOꔗ%2͝[]`Dd wGkKRK FFtuw]ڹLS ZP౞.,p,na8ppM m}ѳ!:|zgҷ6ȗ\b_] @nϗ@gJleƻW>Ž" lVBs DA AG-t;S&:x|׉<4{}XtCMsdzŋFY4"2HE4w"01]sJ?`]ARM S 9 {rQnubuU@:TZ{u;xv駜ƛԯ7@LKi35L7䑌tfG(|521 wjid*r)js3,USЙR+V7"Sjr&0v"2ۮm>ךN!B"2}~^NF`gRN,qzw٬uscuXB#D@U RZ91,i$"ZXLk8 $J.e+ ôF>zzsaFp`F$/nA?^&ccW-ɼqTŸ/).!y0ƿv&6wխZskv5OR|J`2vp`،g^ukm:憫t_.ԅǭkxh(@A1ҝepro MkgTL :"6H8lAHL[.Lp@5.sj)]dϽ_!b^$ 96|;y#~£@<#LBHD0'ֽQ, I`p~Vc[т!F2Qf6J4-}y @a Dr$4NF|H1ILIG|ˮ8YPu!{!=@wS f՛X$,6}(*clD-r,u@ Lv5e8J߃ٵnd "4XGLF<s\88d"8zSu$.m TZw#?Uh6׮݋FܜG{!\L̨{v1D arC{5F՘ q͇^W/@_/B/CWP3ʹ&o(bofv5joKӗOvB ra ܉vA] fx`7g3vTeD)Kr޼Iԛ(V#r>ڝT NI ǢzgTRuBssydap߬3 ^PvӝvE ZDz~uN-[ÉX!\AAM͟YlU5 "u+1$u-h8t7Ru7#7Ӊ"q7ărWam~Z= t~]s-}M63H+Jsc.MNg2W,6SmgVdc!sVݦ E BĝvG]&w&^ƻ3ɴF؛Q$ywCOW]zq%Ln^;/i]Zx3дz K[Gz+Xz)N+WoR$֩[.&8Z94uvE8 zb4Bc8 zQiBJnt~;Hn[RT!7Rt˖q&Қ]R΄2iD TALX8~qi5&xX!Q u{u8C_!9qWiΊ)DElcw"COѕ[)?8x0r}yAVh̑G(_>H8x2'kԉP`]V.7k8Z/oyWr+[ Wg'hToxIʔrЯCM{jNN- w[:t-XHWORhu1@sYbU~9BDGAOWnmREuwiđ%PNWz<+<PW5nE#_~JS@g `᠃l4 "Tl8?_@~v|Zw硴|@dۤnJ=C-u`&Do^GE3L$?UÀs0ډ00R@E% (B\DHpRX|8=nES!ͣՑH^1VЭlBvmic Iyps\V"(F /xY `su)JDߖ3& W:)k_1ޜհI~D7 u+;"4wˉビ.e!w*_oZU;a '^C SE3̜cyߗC/'yϟH D{[K I_8Efc_&vyOq'Sˁ5~s* 1 JwXu+VhR0LyH Tޙ?ڿ7/Rx<%\1[{7%pbodԇqM1K2BZ;ӨOPkX_Iff.羵lk\*h~yeg-N@R\JZXf|;[i Z{ǝ2EYɚsֶ3gBp^M(4kb0ť/tL@? e/.!Y+EzӁCN6X{'?O~y;drW ٦F6L.m\nclgIOQӿ>(pYBD˦QN÷C7%[(.ݛt(,+R4Z<wGңh %Bȋp3l/Ol _-ͿR\<W=1OZkI61M50n,˪c c~e괚 v>"ヸh )O4ݧ`Ug>A8"q!eݐФ/K76t{>q/Uf'oA/_C;%-_iƱ=nw] vEE"qU"{{qkChw3m$L!L򕸶G̾v<$#ZTO?Qmrsgʑa|u܊?o$78}T@Lc ?9MX ͎ZBW9CsΜg~4 Sh9ڍOkBȑVk4jHWpʰg|Zߓwʧ6Wpoew p UvBմҩ2gz Z>κ64/iU1SydZwq "/ؒcXG;W;d؛.2kc3\WQ$}/qWdض ;Ei XLSzV 5;4 *b{u MTWO,݅y*ڗ) OZ5 ;ajputs.$IL2jF@ {J!ij-gΣga$ :[9,Bc|rZḁ̆B#9$b2GҜ2}{q%@ljVf)X6SRR,P{өO%yif?ZW}_mӯNCrTv8[C+u2e IBH#@ry>'g?+Ju5p@h15%J~ ]dP[إzJ9 _Z(Ej(A$cZ &WWxSqKh!k%$#wQq\KXhtsTj (N еŶ֦R5LgX4_Vj҄[Vf Tbk'V}ޯW'G!*XL$@0$2ɔ&7vh`|e̱`R7I \!ͳ8Vc3ĥt A1hushY*)ftUfς!EW(`LR$Rwso t_ݓ"Hly?s7o.zr凙ïQ[Ha?~GZcﴺV-o͕z>۾Њa5+i}R P[iLJ4GtߟA#<-(ĆzP̗r%ڕ7z}(EG= 3Q%D0@Dq; 1_Q͙%6`/_o[_C3W葂"~n %n25OSc0&f@? ¢l>Ɠ!R 4B[Pbk!o7Zŭ(_W ˶[CEOuAޜ~FJE5wW_ 3,IhHXMUx*1\223H?KJ*-BV9nUZu&P|A+I#Z_gy5$֎e6U*qӟ%}b'@#cc TA'r/}U#0I:U[Ү9V+WcT4͕M{bOӱlB rb]m$m}',^#a,$1OgA񵀚]kµ=447FXe[W⎠br// gs[.h?E"q‡>w\+Mì^KJAŠDjfW0߂sLdZ,9^Y;Ǖͯt,,,}#aMlI.CH>sQL9 ܺl4@?ڝt$`}V|;n9_VtO!3arQ[U;WFy::*Uqy~?ȯB$505Ҹ;H8\,Qخɚm^B 䡌+UIm?xϔp]<iTWW;8tUyT*RykWkS&si\YC$?snYѓv, ?|aof?f0 ZJ$ -(/'t|d6~[tE8Nc'\(:#{㩖jtw,bd14 Xyd\`won9Ѫ"u=F>u Rn˜IXs;M_crq%C=qs  ë;gЄH(` W- AZ{¯%ݬs0[cuWuwwf4<;>-ۚ*n$j1ei/rML r*-%Y ![X8˪Z|77Q|\- GZJ6oKaP0B0]hE#N҇v/Vo.::ϖ?D[x/AnH?TrmfDk$3N[]^SRr;|T $m]CY( Qf\rU}WOhGRx?+Ͷ`E%WyD }fpGCk湼$z!HC;^)`f{ +ؠd [oG=}dBF@688e(@{_eQm5d;~s tOR%~e}P\ӽHBK2 Tl7\ hD9I9?]##^9F(?*Uŷ 0ة7k{o3nR8>a!.s26zc_mb̚lͼ߯|7ky+dj|yw~ٽL/Jj l? ]y3併~g*%W0%PRzdUg|ID@$ p1^ՓefYK, @(Iw{ZJL~ &3F&u`@f Ƙ 4:g`آhڰҖ(xst<6/ꀍxUU7-sQLc 3F͆B洠tks-6iI6|j0A7K=B271*̘*KDgрPFC! 04vo}{F& ak5T`bc6#) $#  $;ϻOW<yc 7 ;;9]'JFZ&W;>O݅d^ b=o$JYi S5&P&zMvZ9 1jFZS_|LYgq P5]%(NzIG×XmfE$ "0ea;MA8d0H`+ɖ--dR zSR-Oà9NF&#"Fh=OS_KԠ*`f$ !T =AvΩ\H BռDhc^"H 1ab$}/?U8)V7VMl/ޟu9aŲf.pj"a@p$$"B sSEK7yoM#٥JR-3ϟQTtً_:ƿ8-5x_>Q3 F@ls4)u8瞢A80Pȋ(ۣIDDd]OZpP0=l: =%g蓞תh 1ѵs4(c/G~:5@5z ?P|2|͎:$I$3K9x;*Zdsv(Mȅ&z!!H"0" gOD~U0o[%gy?/lΩgGK6R01#  $K @v$8=BP\dEƷӪs҃M0!i ulN{M \8fnjUQCD1 1Lsu,q`⭅".0L+Y,m5GCq6쏍^am7:o\$3%ZYd^2y+[+DS;.{ XdZNi b$SZA"Q6C uAz(w6D#[Fm聆Gl%j.==]V8aG?4 >O$f"nw5҃4 er0@)%`nX ֟6) 'atᠨ;HUF<c93# Fm&*`$U7r ׇo}5"?7b ŠIb,Jxy+ 6G/b32U@.r]GhMID K}+* [N{}k=Gɑ}Izy`۹?dh玖] ,(qR7TVP7. L20Fj%ȰJ)jñ})+ǥD(e.%к_z;g7xhDAl)巧)tgx<}p}#v544(J$]ɹaXZu!OKc^?ǵdj8ZY'N7BD&U4JN )FDn_>ɪvB /Tw՝tSuf#)L`菵Hc9Y,C{Y]`FR@ˁx2# fJCq??=?]YYJ #G6#z_~vGNXƪDXG4ZUR!3;ϧ> GŅ:QyS~[JBbprk6-,v nS$u.֜NI~"+7^ |,cy 3Q&w&%H]V %X*ytWilBUk~*:Wy>1k8(n+'\CUe"1 cF7MG yU/ILdKyFuC^}⧕$_j l9F`'ì,v6}ӲK=L|BՔwq¾6(L4vP:aD_e-M 5S\}) ,5x&`,Q 8>iA#NqZV"w55HCo> X*si}U90®Ϧ$,XlA?,"0{  _S[[2[wכv Zm%w\&e*aFJnvڭ/+'fD%|Y}VV<8͑w&R2ff›vhٱwŶL֬Ed^Ivlu2`I'BA,z,ɹ{JE!K[a0σ߭]̸"Y6rk FED}-)GZ4T0֢#`а?gdj΀C-֢.cgԘ.;:l@SR'o,n _u1N?F+e r lt >ȸR+ܘUP*1A QvGV6qrc5CjC8zmbB,<8Mx6,xZklǯ0BzWg<mSݡi7YmeJk@191ݥw˄ɤB t'bm_[āi7;&cx83kk6G+:yZ'Ա-D^Rh(JMeйۼְ"x}r)SPߦTҲ?si5̨B^Ey)CG\sgXK1Ǣmtq tHX+9"t{A-Hx?ߡ_l>u?cɇo8Od,9 0Oi[?CL,>(QsKR w&>E0[ }DJ$űb%p4(sd]T,m+ %cIRZlܼshƮ^Gt6s\E5m)W-!)b0.p6dDa.>La)9M5=jak 1蕅}C(wWz^G(( եl}d Y6Cdm,[XCS9"&Ww.\U{5q{gEcCcQe”G&{D1Ff }*}(ίVoba|TbɜEMzUc'+<0VE jq9iv?B2Bw&A+(e#MMº!g09j %g_}&fgG:*jb0]j}w/9=+t:'Kћ]go_$'_#-CQu7`PBWNٲ*-B3"^K//)gw#˘г1{u0@B/HNWP_gi}mTȕn35gYeSO;OeԧdBRJ 1\$7a /|_#4A=˴U̯%GeBLBE'je0D`4`2RVΖ9ݓiS/4#w/4'ʕYV^rE^v@@ CԨ@PIRD :#3 "d8 %R'Z} ϲ3 bG[)mȵU[r/w&vr.ŲyS`! gK/t ;p6LW.ә|~Uk+BYyZ`MKYBspe*14EךVw*+VTV ;$c1mK"BŖ3h+*er\^*d ;ȓˈkh.fmRJ"ro%J=Owk3h#l~]m-F&6p"Iɲ% ͡udd|>C4q`-Y LX;鋀!0ߣeD' 0݇)z֪6(Dͥ Z=ӌ\WC.T b#8%5I5}ceWƍtˀ" q.֊[6*Li0b HPjUeb2 Zog|{~ݦ| o/V0=aD n[: #1i5<,`+5qٹW p 0l`.'wB8.8 w ۯ7E֊&1`t4v0/opAl?y/&՞q&"#0d"D|xq{˸C|m46p6 \:.tg; J&s ov J%Uzglx!Vtv[Jq *'"Em$F_q~?z:;[_H3KM4wW5r;U$:IWLC**5W8iޢG"|;NH{jGu[?81as{aAhlc3Wb-L؉SszV|\\@w9və5R(Ս!pz9*!dRI1|g(kJrzĄ_ '2vLCڀ XKLV(Sh #CpwvS3m4 *cgt_40cK] @!\.LJ-40f;j%(:_1_1%H +U֬)zU@! ȈFy+%,eA2Z DgJs @LI_ 4@U'APʦ`ֈ YhESz^U bw3VX`2R&:{MplfП' (-&CmEw jR@F@G0Dn8WP8ߐQwOncFg{5E0veVDsJp P @( r,nD=ŷaT8njL(8+[[F}j[h~ AM\!7ÉXJRU+7S J`p TЄ \@@)XlC6b`&D!c¹EBjce% bQXTCU( i3" @@CF*T(,HBpE5MNM6-jY;,0ذanv`)Z0qx{do)*99&WmuI`*,Q.7V_|ĆI!ṄK }!/g Z="2 Eb%.*W`ed,F n4.F ŽBs @|XMP+34l#V 2mϊ o4R".7R'lI$Z:f"f",@osֺVt e""ȁ#mmiqW\UQV XH1M~5vƾm3@fi][u`F0"D&"qi[ Ր8fPbdG57ˏ[ECVmcQU@XNqNuO761d1Ph/Yhnן/T#/yjt?<D9S.,{gvBjShs_Pktp> i,P &%I6/>9nk= >='; ġa`Njk6~DO=Y/2BNfJvb5T[1-\|ϓ쳺,v]H8=*t{=t[S=F-ꏋG y[Kr I*t~>c&,0DB*2r6qT=VQhxA;&Ajq\nB_kEX!vzR9VZҽ(l&أsbqLK[q%8+C78K+F#!8*™4O_G,RnYT-Wy>ԓ_kB#kB5='R:g볳I$暴yoz8s Iٴ˞VgQnG78Β#>~R)Gap~)1Uy =aHSf/JRG*Ly~>˰9~JdP %!wE=uѻV˩YqϱJcZb7а,;F HHg2n<}-}th6-l3<+{òni!$<1Y%FF`sH " 9,CzT}cmd\|Nζ) wgù:6a% ӐPd@nniRs:;=疎|zM7VTCNke."`xDD5jpW䉬f^L-Aj΃6P'/HEi-pN\O#w2jn][دraaol&:n8KQ jQE`3 [’K4 Hn߇BMϩ^|6BI!?y$10 @!4=_[Q-=<&ZU)٬j͐@I#U1<͐l1CM2>COEo:o?.9^*U{Wը̉iuDxż CCһ24q,'B1bGsz@aui"!2$eYapF"%n6?ѫ$%,lc?`& |]+P} 2~sR&5\;MOzՊ&.[xQA4B[?Q( 䒌WX(O 4V 5аOf=VY -;u%s1y5lw(9 ,h)J\PrVޕVgIjpu $C7`Vۦ^auEa_χ3{ۂ"  =zCA孌 PǺ5HGub d: d   sp¬l3Im Fgܧ{8bd3]gdۤ6ڸu5&8N=*~,=:.]j&8 Bsi7ZU6ۋY)cY<'U]jȗ2u ?2'-dN 6oۋvw;9i9 m;(l"9(9idbjђ/ab(Cd)O$wU^UT;z:jj{)5,mqqmMӾN#QfUjƪK9p#|wF"{b²PVd8_{]W`;>r흏W.dtCqQ:d!rN )o|rAB9OEh+Jg_)L "31b) vuB\5Д Z.A^sOԎ/}*m_oY7S+B4Qs }Z%FoCQj4[jbFrj7X"J_uу'pƘ Z<5nxaaA[ 4\{/eAD^00 "7n [V#vlI*l@H!#LufV87&EqYo{1+ۡ" մOB(VW81'pNL080s(DFfev01D9,Q?cwө#pDA$! q5jN 2H8 rPV}W^%]l|N2t4R[<,|{*YXwt >?OosB6R[T%-vΉ֕MwlKgv,P957@F@26]%'6?K?딯wk;F_[Z2H eMrxYq!PC~̨&lP/boax| 5+y.DF.pmh l)Ym_>5P\ɬe,6ܴoеQUgNBMk ~~[]&zjJEMKy>? :KEUr4%tv;1\*v'~(g=jr(:CLde.NGɸvKy/~c 8f2ڞbeW; 0Gn_k5Ӯ=*C_lzVgX`X0V!~EN\;?GS\}K-޺7!9mavg0-$xI.ºNq?_6^p?{öZ":ۗ6?nAe`GIʵ&(*EGɝe Ž"qǿ5=c.]'ajŕE-C }.?E\GYeeQK9O+`^LK]#egl2]_6' |zrk}>h LYMOavvINV.{,3XHwN*g񑙎R,ꍉ$Cڝ|_z@Ǽ3^㻟Mes}rQ[fObx9,:*›.Ƈ:v?SU9'})m>P Fa*4pldqc?k%*4^@>D_PS^Skn;x>,:&-m_Yte}68W~ ;^^v (T 3?苤I"0w*j R:;1ޜ Ӕb)ut585r]I:~|TߐecJY2ϨOeL}=*o(+/>6 Mx\mի%|" ]Y7OK\TS@! iCE䨊 qkOeL!5!3gu|~[*ɭƻ9LarJ:6e BU?<6`]X g=]$}"Ħ\PyɼIN}ߴD8`?s >ʲXLFWTlT5B%4*lsWh˺zn۝}q&AbT!@U3R ⒑$,I)IQD3lסX~L%#wv-cqc$z(lE'?oiB;8itQJdG{vQ2"w6 E&~XQXtDUr78_ޥ#R@aZbpbms>P.lcpf*%LY7 RLB$<'4ףU%PblNSXX5,U_,qqtF0jؽ:i aȒm;ؘiz5˵;F uNlIWpZ;_vFG&|(9Xad.Vjeup.e,#w֑1g")/+":Zr9o,> 22 /_ǃCE+3#k b}멠E`!S弽UNSt$ںgogS[gU/KJ78ƉfpL۩Xu ۲X2ًVXæy,\\sScF'Z/Bgx/k}JY䢥' KK= UH N*X`!ؽz˃w&~2zMPh94TfN 4’RSIJ4H31z!\"ž\q_o$D<6*ƷoVF`Xyo{_z4gM jwO/^M>IÌj)Z6 +q7U$5KQY/0K'5 `yC/je~8~Y~=?^ *$t8;_vWض_"bPBeq)64)?L*sPSĀm i5UzQ.GV{Q d,u%b_Ml݂]^'*GeҲcxcH{fkFp1 :v#;1`l}jd}UcP+Bxzbm MF)Aֵ *@ cVݩcyu+:~ zUiO8M/-Ra"[dJW 9m0(XjE5lSoH(4gPI7hNkk/cYiQja'8&mfn#D-lr">3RL;Z:8;m_C3 $9~%9;=sSVJ)Z6n tWOk\xpq}kF Kcyh~6c C"PEe}\~Ldǐ I@Aɘ(Pȓ!DPu*1E2S&$ĨB;Qaba6 ^3Com_=-e?hJ-ڽfWu=6*Qػڌ_BϏ߼Ta"zy:WMg鈁 ޗ/d<)\hW&32pR3i;hHߐd `֯~ #~ hCL}2YnosCKmWV24'cGѩA#?U<5g嗸'ZTq)#jzyY)F 2ܵ%,UǯPu@QFsB(E f,,DF*hL_SX Ҹlf TXj`W¹W֎1d03/=@ dBm`#(0Ɓ38-A)Q4i_/C9%&.]e\}HطߢC9 K1*=RcR4cšf{Kgq17`׻OKAE2?à9XaFG9q?h^ȃb'$$o} sPdym[@xj_"ef =80 $9YIAܪBY9d#4rGQwp]Q za2Ef">$Eb<ra?\V9){Pa7TvLta6sȈS+aQ o+q^/-Lu'D&2U*dL_σJxy>sy{Cq9I^U+t͟*t̰߭Blj$mmg˾W^<0GIV; ̳Qct[aU?4b>8t>Lv%7&ȯ__$ԭi\l<g5WݵοsTڷmk^sed>n^}6;AgL:ٗ}\9wB 3Y nRSiڝ7-%/fs<3fm34/_+ d/BUQ۳ѵܲ\<gKf?VrYZPnCHcHQYK6Oٖ Me~CWyšLBS.8A L*$}#>E8L=doǽ:><nD}g1x&ۢ]']iz\+#s.b+p?C=?_o&\P2R)HRwv6-bf&e K)LonHoDPY,YOHd E.&2tրZE_yT+Pq#q~%@BgY~zgq.#!j$ӹ+wb6<#rl49@{^F7ə#z'Jt' v;e#>&eWE6IR気j&1q:+4(MУk%c0{H9 )1Oqet)3׌v04=yM|6Zbl;}-( ]H8x$F"* žW<^ģ=.mO} OI{LC}7zvJ}u??hptS(\@4F 9KrY8QᝠNѧ~S%$A?ó[ 味oXLN k M?J KK-[KeG/ml=_~~Q-ٶ|dQ% ,h(((̊\o&eMM0Z=.\=6B)K=.g׃w/*>Z]4>~51`x]n/ìpPs;X*ZsT**waې>M^63ӏ_cuQ[bV/^C 0>ur  Gye H#,|sGhѱ:M>/ZXz?c>j> Y w t 5_+Km3d6dUV *C1B!nMIUSXX`Fc1Q^~{{2R+A͍Z}u5΋̏,=j P>֯ͻq(c!Ο(R~X "Fg1V$ &0$,ZV \qIh =cJԹ-_BG'Zt7孮F6Ą{NA4#L^"@( DWٯK;tsW𽏈= [R]uV2۔>>#I='Nt7A6Gni"[5$K}_:`(c<([j۸Fkm&FՈYOfog5GTrO?N׽S-aGaxb#"֑uΏ%(,_9X5|GZ׫BlGj#pq2SH@b"jD+]0>]fRÀ`S$0J%@,nCics%[]R'FZY^W;\`F̌&Ùʅ*@ˉ+e~fBbb:t*osθmgZ8|`Q`V1PG!+1k29 |D`s|NU阀ϟP(XLĎ d>9A@lῴ֩{GNj( }۪yPa4 WdBwPInjd,(Vqs7ɀvu),%8(k?@P]fL6ی; @̤~KD,[Jg':sK 6Yďbxxs( Le ͍YY(<,؈$F,pByr/=F"nWك"Abl@\/nqd%|ږ/Z9VgݩYEٵD9K'jlXc F$̚&9jm3M{C .iAJs˧9M#CEehyZd# "E A>1mN-׺$РL;p1X{>[FT l:Z(6wHm䔮;΂}߿|&-Zrh䍺**r70wSnvZqjOjE-Sp?#_!)~6R Kx}Rt>(5l&C>ѥۢ1 yFtY - +8(Ҳ)01mܪvL=9`yk]dn*n:8s\'uH}B{xVIo]i'ꤐ dEA'ݤ' '~nneyvI$!1yRr_g 7(siH%?+(tc>ԿLU|F0tGtopY20c Hj257V~z 5Fg)Kx萍F $,eÅKjjq9Ъ qK4@q~)_G+"?C}_ZK?구thA?dߛVצ6qm?E2s@ a' \ VyhY4_"G(,/ڰ1.+:Fyō+~][t. :1Lܰ$JP~#tp-8O`xP#}jhU>clE?[i1KRێ$x% Pt#I֒ҷzv3O0Bќt&MU$ FU:>,Ä_!+ kݗgy9y1eZk9wRrNdt|+@2FFo1A_Mgwmp4U˂C2g,p+!F/wcnAnDdKj7åPڰ$vTѨ] 1T! @d5.7VH:ܗ[l?/F2  $`byv.n5:q&3&DCA$duVɾǑ Il,\|F's/zgw$^ȴQZcuFNLL>~O)`='Z[lxw6ܐRt7S_&?**#QZ1X~+!p)D}Mh/ջzo; $u(o*nr>SiVfx:d|VOD4bၕ4,WxdsKr1`~Uӱuoo|^\P,)> Xzڻ6+.1!uW-)֥Aµm{e3T,a$`c`n 1ܨH1(\e6 t  =.&+eIIhHNꧤ7 &ݵa=s q,7Sn ^8H %lJe]sQ 5gp,\;P>a]_.؋jBei%*؉y "J-ЮBҙǓA=7P| ~@FT֝)ozr'?U+3K9{V;.D 8"chS (@#0`(<)ڤ ?Ft4QWd^ 4Yfs|46~>FMevU:PBDº@~WV=K`:eO&ezEԦ vAi#‚ .)3 aT00rV~}ķ* =}6dW.Q޶m0ϥ+FqZggcgոܼMOc7Eށ޺(2f/cZ6TɮPGofx؃{MCKkW}l.rD몱Wi' t2Rb<@ZX/eŊ+ GAjNtdD[o];EF3?tcPɜy A|Z*7NWT"Ʀ^}GމvVVSgQ$m-ϓoKKZ=uf0k-U4&F Lc9&;}d+1pE|h j{n2]^Gٳ:2M[T 1nfنSCT:DSnj` C7W6ѝHD@Ȉ ;s.H[kgG8=+M.!Y EĈL&ʹ^K;IXeSuntK1ex6u30nLD$Z=CTg4eQk& a\%h_-kQ>(ל12O&)?K2WaIw7;gj?_x?ϟ}0qyeRR B1$Lp#)l8cO'c4E|@A胾$Gn'd喞}>,NteTcJR`Gui9(@e,m*JIII<" 7uZEfiœBoRE5 03regnYY%bI#A(@@dՈMl6\a|e[nc %ˌ I R5@e jV 0X`1ⵍ @sDIRn|:tٙje2'd2Ze˭BC84D^l֐6P  -F3G" ڧn ҅ 6:.Pk@c%5XNo[n a.ViH.I։YBȬQ_)XDjOhl)Rz>L&֗i:n5(A){JSY_$~RqvyAd +#Krz_@j\08GSߝ"duLjevl7+WY.eDsA#k?Attb]r,;} OۼK2uXLg06|8@$'A3I/6qy8$@qz-uX#$?Y.+Qw7f~CaE$8gj,?1¿D)Iyʬ <VOm v43fE4  vh= !Sr1ݹ@[ aZY}RZ/ n ѷ|z q/$6$`J9ZyVZՍxYAzP~:Euvda#+R|x?80?MugV=7,uV 7 YڽI%@4q5o7?k-'VOjzvRpWմSgf"ZbswRE-VT3gLY1!Ո2R0VWe6sc/;rTA5; nzi_? 7YlJ&\(P qwhuz `yck&-ZTB kmŢ6g5ݭv**=P() }OuQS(Xf֦ʸꁁal<fɆ(Ӕ)tj\DILj>$:u da1mg7%y>ףHN2UŞCeKܒ'gْWLW7dzgJzn_i;ݖ*S[RZ{%sSCL3h5wۺ586a L*jߡx¯TtGQsj ~ ^*sb ]8G8&gK7K|ZCR.fVez>t՞چޮOuo>g?߇s6ZGy8)q3'zlgMtJǭ8tyJQYOcO9kbvZvhZ "HaC R/`ᘺ,t8~1UeaRid{ίdjQXXwpPjm&'炒AȏfVaf$J@Jf'X@Hun;2Ka1"E~TEy/ZpU{]W !i ML/qsp# 7Bpw,j㱀]z*uEèhI1y`mNZ\pT0&IUv$c4?@4(MvA隆pFX.ׯFT(sRHmQ "82@7kԕ T rfԿϖ@  vBI*"Z~_Cݶyvk4A>}._x(q`洟T+՟\q)FQ͉܈vF}VO iHzMB-XU*C7\ !/MGLc,l둟#qF7"QqAQ;yK˟urhzU/~ԭ3B & t_*@f0DFGqr s+pVʱA&/(),Y*ZZF)USpBWSTR2^\/RI D͋i_kh.F|:C5hU%. A5%*t=6?܍ESff2~~c$t229=679r{͆4r=rPR 2驅4 ش]Tʰ-@vvx47\+JYV⢪ǿvQQB@ E"2ԮUCȥ66ԍݒE[ӈ[ҿ:,z 2,e$coapu0K \]eRuq:vHʹʼ-ͶX r|VܗdulkH5XY+8^"+To0![m 49qN;f͠ր1Gm."~Zv^rsTiENtȀhP)& `G#( Sџ!42Cyg< gEewg.}Rz5}ts$! _2 f/I$0(r Irv {,;>}BtOnQ z2%:gOwڍ1ר_BqhsMIr01YEon<ե8.EO!VYP)̏0)Ŀ&e- 2}~V(|}U ?L6W!?z_~ʠ#IR"YUc5[4fv8첉HPOHYJ13_][Sgx>OY:TŢF1Y77hȈ]#E*D>9 %IVȕo4TP8NbNj`e(6zvw7uأw.eSkWaC%"30dBizXM}*?w0O +7)Y/wdV|4gRh|/?}֮@MTC3ʉ-Ϣ`L`h*uB5R$t @A1t-2,B(&v+ʭ',śj.d^+Gڲh0m/)^u_gc@LɁDt4@;PtA8(QxZ=:TdYH~56D0 ɠFU$sq&gq}7п~ yH z{8U@r.F8  ӑ78~VrX6JIwE&+cX$D|'Uk^5?28w& AU*79H0GOFI_I/ZWn hN͡ɳۂv굌)ۻ5NNۘJ7B)h&r uK땘ߋG})2YH?SQ:$Li~0~ll-Γk2I͎E"9{ c_Xկ̯uTFзY"Wꧼul Z5ЛʜԽƦ+Qv]He&;\Ys~=at{]Tu&ƽdԛq;,T.˃S7Gd)k)%s$eNPzB΁~]mΟ4p¦ F]!յw x5FI{aAMu6qU^a@;Q|fɁ)]N=o$M4y.{r?IM x9R=Qqֲ߿τ;/j:>7X_H.ZS6BN|]&ka֥М_&9&X 8J̦?rUeּ7$nB  9_<:z/!YYbQ@PNBK.yͦ3%('赁BœLQ%UAe҈bat(C>g陆*} ^1tBrA[Mf^0? EȂ*Gems_C:g1#œ쎂 4v`Ie聓ЍQ&va&o)DtS)Tn%fBnQ&@ ʲgܥ!156SoҘ>M"a)j$a?IZ-6e)$í;sȸ'Nj6lfFVj'QJ $l$Fbl"LkK wz/Rnwؙ͵Oh]|^- VkEFtE}?@X kZ#"6 -o]X٩H*_uC_DL%^+bv<l8HS7L'XQ|,7k5FKf]CpܤAWC"pF0,nTݞ;Dc94z /UH.@yi|~ gHn@6M83}imԽԣ(_%jIxneFY]VKnViyi[PW Z4%R'4X߭J,eUR3_e]G 34JԋM1M2Г A47";7w @mg6JƯOe[yʔh^u;-O)2V8aUu -k!u&t$#;2q\`%MvZ qxЮ~0bO" ~# T.ͮlSP̡+y+ncvHNք ^wnX/غ* G C -vb)Kܔ'TJ83G~$8'(ϮjAHV*OR[}yIx^t|z[!.Dhn? L->|WR\\dz{ n4yusVR2sc{"oq)3&BBd߄աD&Ia$_a7( 6rp9[BTHo\-զ'̤ A8:} N@'arqR[j^$mg@ގ(2F&>n7ffz:B#_Qډ跸*7B{wn.ݓ& wq,Bŕۺk qTz3' e`JˤdrftBu/]Mfdj $",AY(dr5 "ţ9h),̡L[Z^`9k u(J:D!))1XP]T>)C\Y1%Sg]LSl"PCKf-cȒPpU2\X*0{")KZgт_^ !x݃IͱM#ˆ G|O;Ǎ\,`s[3 6`hAJR55vG:+i ~>eX9C)J{+DZblЛRʙ8:2ubGn66o? v>EȆM]x,;1E ⏆jOGtr,,2z!H'q'PU9&_,*>_`_5r.zy&Ӆ܎hyx%f= muCPyO%ZZ3a Ub< Oe#.!.ͺ"S󗳢eD@f߇qHTE!~ZvG-"9KWrAʨ읺P6]L@ΰv3dk'lKNRrĭ{uω|3@XJ+.p%JW5G4l8K9nP|ߞ R;bSa!KdݭC[pv/{GZf-kK_9`/r./ h Mwd(<֠q_\C9Fdj jtƬ[( #pU,TLV0k7 +WKW¢tSf !:Ё>+ޕam-5 *bGT&XKE\q e.g?'}g?^C}ӤbhWg{tNE 4N|j6rE&dqBfh%-a@č9q!2Q|M8)~E1Bô_b^8?#Ձokft|,,$zVZCX&ceM/PKWҨ,SY# X %u!f6gxi!‰Li?Uޭr:CገBWʝA)KOt!𮛦KO'Dj8 d%[HH4[g)%Eo~mߛp~ >\9};R`¹/&j 'Z+]m::8h6 uBB__nQJ@ 4`>m7WXY,JI'Ɯ,}uO -μo.CM 6̇b! WfspmW+R _ ohCfe?q|5W`pa%58tмq6(WXYiJ'$Ћ6(UzEQZrQrFW+`R-YXՔ,J⣑Zq J%FQ^f 8[ qX$iDiBǟJS9r/g^*\{BdX b >~rc7ط5x &d#q|h] %04:t6DYvè#ŐoX=w,@ 68曖 v{8 xB&r = z Τ( sSa:!>Ԓ9I V/t.$WQǶhSDGIᶔkjbN% ù#N$A9U%|| mOydU cq}e1${ jOgy@~?*AO\ s/TnB6Z=mܮNҟkiDL?O8Y;hˁ1lGtO Z9T^0Qҕ)ސ*<,TxP &>E]z)fԩ#||YgZo!yhN'!Vy%8$et&N U6l0呐%i));9s c6抨>h Ib!!٣kkHGz$ձmLE3"3Tv?!$=$"S7? ?Y|ƨFVP}˄L/J' Ro7l3qsB㈸ 8.to&f7U 6l;ɂ"OyIw!![F% .<0SNq` &6E'%K9|8K8G<%HF\e"g;9d\l;䤬{9лR'֡86h˺/4єĕ+<\n=K,fSa~1c}\8@ 5Lx%8R `A_0Ě.KtD˞`DĴ!K#stͯ5N斣2-ct֔?F1p@y \1bǜ`wo a61 YL1,bOތT@<CUaQW%\clyv>ٖ Jm$Vy=Ծ;p;:p}=Mq?o,s""m9dB#b-apX /.ݼnIV'&{II/88%5~‡Ii4T X"1z,_z=T8ӹ)"HXlʼnXQ1lf%gu&~T0oMǒΰ{!y9m1x쭻J9CNF0R^XGTb%&xܾd[f} G߿._kM[ET[sa[HlT 6x>csS 1vh1']A} 6,jO @qC}{WtH&#X 4Nt[PQv=)mDʻNmQkSc@F_)oK5Z ֋ eF4` ]ךncmR98L4g_Lp`1E@ME 8]c!B+ JB2!2խsy5]lIȓ, ̾AG:'@+On6NKrv96N~yʭe E>LYKػlEQ3"۞ˆ5 P Kxj AnzKGI(\hGVÍ +9` w,+l X}0yRur %߿VFrؾyPYe*Dӯ%I7a.$X.&z{M  Ŷ< #=x^OQ hF>.r56ub8Vo+).aNS tPEIcv%+pif' G^Om\g(`]qy֕[/a] X*!6Nd>F}EVF R$T LŔYF1Ƞ1>Z"XqS2ͪy@*]H 11uT.ܐS<\nςwzDt\](J|V[c1Cl#B.G=Kcma627LL<< oz`:g"G>w\rejԉᔾLDQ~-c_t$HOʪ؂ `qFpU=ٻ .dh$[w'poaU*2ve.YD͑ }Q==Z$d_Iwը9I*;.;apZDQ;aGT5} DY3 []P9gⴉKN ;;mI{کhh3PqCzZV L'lr:xFKh>Ft2 =sa IȵK{Ff#ӕH W$!*SNc;W9]i4pВ gOdxd-n>;+d^9v}nֶs{%_ u_أeke] >jHOTv\L0ӟ*ra9zI0źa%*t ݲ;{)0#[(Kr(#lۿkjөTJT~ce[}E:4],뒿O4x`aq?J,ǥjX6F/*]ztĚTؤ ";3x? [qOIyu& -?0M:T2uWܹCj̨R(WIf.a!Ÿ́(-d6{϶lQ[ÏYB0ɁeP%"%Ӌ1 b4Bؗ{It)XTH3o9nۤ`M)7,`zwϘ}0;[,뭕yG9S*}K#}Je6 "=IRULi^P_۰s<](s8-) 6W#M5lQx7L?T y4+4@$1x_B8zue(t~ Uج(ke8%lE0xeH~r*|LG/N*uDwO ›>#9V <S^q.BXi!G,2il'њ}7RFAh1P6g|]8$.'ak,*?1r1 Ι}]]P`Bi= E<)X?9,F2c@NL5m|(yn/[o0E5ujLLAF^![2{J /URfܶ,ӼǢQXg~ϭ:*a{ ҩK@KIuDД,߱ociAKx׺F{KAkK̖3Q{zMZqdʙy`:@<.wV0}' B&X== r!9zCgn<{YjGїӔ^ޔY#^ k[W٘7K_=@,o,"ZMQE*]0;p@}\b >T9RŒǥ{sVnQdSAt@iNyPUX4( *<)mgYdElnG&2w{3h8gr1"~P^Jq0eLf 2nΩ:tPB.xɻ 2:dˏR,x0qĜۦ[d['j!A'Ë[{M϶ d^`K&@Q p2bŮ}w^'yorsee6L},R@?nOR u@%65܅LlR:5f6Vbr/ VH,-I2&]3:/#5ZG[, Ug_tNÂUf~㹖;M{4骉$GGIM" `;(Fl=me\bTRiJqiQ) an?x{ ,h{&xjkj>{Ҹbdv/pʀ̌ވ4 y{GEsx]z!n(' w}g,W /PlRk:ռNVO%UtX8. w/Wq8D{( J;)ʶR0?FHZ;G #F۽3Z7v6@:d[O(q5~ /ӈ*Xݝa(@@+ywp?l캋v]Ʋrgb'+>MWUz`V1źugVrV5Q@#^Aq =+iPi3zcIƵkL'c9Ve$qkdȭU M1 ?z"+q[ ң+qk(Oh)f-cW h'XvfHȇ շ aҤ"1IjeָؚOR aCll&b&3$S3e K!>m vsk /:!!GI-PsI`<}Ã)o9bx`J {؟Zk1]pF o|"B[ S5;K MKsT $v#j`r(p'l &j u\ [RmYݿ"/A1}(*@jß_Oxb3^@S2v'&sꬠ7˜rzS@$DaPJ*[W%㡿ęvxmHoQ@bsr DI|&`=FpjIPuN+쓯rA,w_>ێS.V컵/%Wv_j)Cl,3)p lDl|͋qMM$~uB;]~+#rge '\t!B!g 6@M>=ݓEEXGG[\<k& k欌3q7JEB;b (`Ga:w2Fۥ|>&r`hl>*PlFx_6zvw>.I7 |p`͓Fwy͜QU} 5h}}KQLTzG3 <&s;vUӣ0]<}6Qd >tJ/_ڂs&#uHO{Qڃd6m"QD8+b;Ƽ!/W">DdxP̺(EcK dAUP#Kzݩv]ʶ9"ӊkBoD7znvչL;6}7-,SN x~d,-]L\\K4ʿr#M&6Ρ0n$\:kvKqcL ,5fU _L)U3Q }kI[ -HWB׊jpM25GU ^t->?qYm>64+WD9 00X P,LɬxҘ$ӭ,4FzBS,;x4=XV@αN:1>|-yoxv&đ@J%a/,eRW3~~cr)NcES%; B*W^n18A\f{`4ť<v}dEH- 6HH3<88Bx2Sk˨nUg::{ndm]eՀVIE& ]2K XTO@S_ 3x.v w/]6e 3[ϑ7g{)#h.$Rzl74y[B po-97zd4ow z.D"6`C5r_zW ȕn:ĵ8|QMn+vĚ5 s+JU>>$Ig.6KDel w͆PF1뤯,l6+~ӫ#907WzWX)`< Kj{馣4*fޡ䌍ٌƔܴu%]UlGŌ6fYDhIC\q$5B ߚi_vmff1f%0sW`#5&%3_JgB_fg"w%!PL^xՍ=%ːY^;$۫zg'߹w<[H@ T˫ 89ufG-8%<`Nc蝯a2HjUPXPxz&Hc5>T-@X#ꅏYk>W=5u^اվ H%hÈJ,!."_+]Lg.!P r+̴ѡT1uOZNLi_}$c.q9}x>u^Wn*/&\E{[.¥& ɢyD9O(( $@8O|}q3*`$O=$ VJ:9s,.w;rD{j+q6`Ƶ]DMonlЖ}-"e +aF'N\$@'D .1 0$^;^ue=ZMUڐunJZV?@؅@ DN=.=%M)v/IV/G_?E^A/~m4s/KRk]ďꮼ3vcv=AhK+^Rq5zh۴4hdzp3oDqo)q(Fg$%t7.mtXt7Ј viB!M7_; c~t!QdnJY|z3"qp‚ԋAv@  D% i1nE Aj=zaa5$nh<n|գj?+ аr{uS`3(6w!%ˬ9ZtN$qZvўn$SF i"PQfx0 ! n30". _]ri2pd7w{A3CVÝK @ޛCJ :xM}L?_ DY$0]=H b%4ڃ$x24i4gz2ׄ0(#3Rz̪sVVKYkYKUUj7;dE8AZD_i*[3´f}8K77T@5[\ͧ \a-߅n2E/De*ue>zChBa+ɷ2lzy6|utGpCX=TGo _!M^8+ #<>J& #+ .ʑ÷KŎ?W|}T0%,\K9'f6ng5u?]in'9wZLC`z]Σx]x-8PGx?f- [ )i"C,Z|ۿB%wsiA,d[=D~d7_@'1 G ^2y5H"=2Vp7k@p"FA2tV!tOܚq$Z$`بDQL 8bU IKX)3rOޭ0޹XOj׺w*Wzߖ0V79?cʾ}O㤵7̓o5'bKM_+ Meá۷kLuvWA¥wYUMvGpDNA Ӵ02DA8GO<;!on&ȃeD ׎W>ǤIVl`) y̎A=5Lضߌ:i+w /oSؾÇ@Ko&SԹSG_gw,H>}ݲFdU뻻%dR_F#š]̶8E6 mAhSRFN!}t!D !ce9#"!` A qX\ Nh:I(K_/n!dc0`6& uNc W}arѼ؉r% ,Ҝa]X!kktWqj;6<]7xT]$nY0* *F."pc Hw6Od2†bbqVC1[,gO4Ls#8ꎆ=ksrf(#i /mnr \t'$9cۂЭq@;YeqUeem <aJL`)\u1 $@O5աȲU¨.wV˿P#ʚ|E玫K||*5^YA=>|ߊ*(-γ|&Sa@NTzjaʴqwzVs0pxʈr4$)ᣓG 72֘E/2ixY@Ph"tΉΙkNKni_^]M̾pFVE\;M 9>e<1~eP^x_%z{{> l+ƮFm9 ^r^.6w`w+>Hun)E]*…)[g&S߂o =[N!.3WТP C0FN27 GPI?,P[x@|2P/w'j ϟNKb] Z-{1ZU2 =lƄSZ;^o20"}/b>#8BfzґO {O)ȊRߩ3\dzyd~cwOOiaH'<#;Kԫr;u^ߡSі1 vgt+~l"bSwa rxt+H!+rr ;eىB[燑3{r ^#)1 ׈{W#'8/a8 /RvJ ]B_/^Va% V.{ L}ܹO֨Ԅ3wL톥ѕpy3#Z#ڬ X5dh9\ wT\r'00.dhnDtn7#3P>\UVQ R,C$I2AźZ9c9N@FĄ->WUfA[I-uwb}!1 0 "u0B"o`_x #ƃ\"@5v&7/s,-E u'Y@`a)U6Y&nD@oeK4~8;g`D&Xfu>F1:0z 8m(,r H}s7Uh՜<9:beZ갫gM:']? {|;Q-ɗ /^?rJJ#US^ݮ,f)HN`[Cug”oU!6gccˆ> >~ٰ<] SV@'u',=X9j=rDnxA&LMDl;e}L0ʈK2R3zB"{P/0D*|$}QT;c`3~*T| Œ`e{m.$G'[MYAr /䩣]yxz6| >xr3P-V @rOrәda̚Zi b&dD7h﯁RlaH*,2 h7aL[; 6|5KIPKք`͇iq*czAay㵖PXrI5fsI+;Ie{Lnr#=rJM 6Ijr8c#ѿtDAQ;7(?R"S5V$DaZ;%}v4c1+իCd*`x^T]LQqM"%%Fg0S;Apu~;b F1 x,`:tH90e}:`Ex7G'G!ť2v#2Osԛ2ג;B3냤k#bK@GQj4 ϱC:[(bqa!T:ryM?6"YuCԵp-tbF aG^/D H9ϸʄ }7 h:Z. veEvxDig$ϑ^ !t߬kFa@W ,S1 P "{.]HJj~αtyt+]MxoErQM&]f4H!fP$x }=C(̴Oa"EBG h֜yt_Y·5k7!,2}V׳~ԴtʼuR / ? Yɒ@GuPfuC֥jNw)uR _Iɚ^Hٱ>"dm:mHO)睺BgB!Y{K4f1=HxD$o^z=HFI#zV9\| {{Ma[/yV${#{W^*τw'&i+ni:.tJ8{fUϻ.0G0at9] w@gpr WsǗ6142PRRb}8,6UyI${mvEhR+74[.VƏ7j53UdulaMA Y_H$1]@z" n˰QgDDH<"CwYRG[ȘP%179r: qEO|bRqr#rL:<ױRAzd /̥XH?N MRJ"o>\Me7*s"AɸzQU+{WXp4%/tPKR1f+Uْo;i{ _":k讜)ےkiɫ|Sd.Q:hI֚x>mnr(ͪ NCnYcXgU&1 fFq ѕ t>snϰcloX-9#[û#Gt{߹czhk@.)mp, (&#(@^v&.ڜr_#~`=_^ի"8g .$~SG[lyY-|H#\iyVbb /lQ$ޙn͔{0,x=h_M{lK@C+NyX yrygk>lv)Dw>!.?<^0n # g[OA_E&Il&]ɰizh=5vq74SF=46MFG!u֓4*f]쾃:aU_y.fkow\Y(İ2<>V*UYOڍUx2Z` G*X8c\ { oȹy"J}Tiu478Fw_*}bC Z%~fڙ%c'dx4? º/#K]N#w#+oX1ޗJpAD}A~}@@ɀ)ߓDpj-gTl86'=Kq8osT~)3@-igkXX*B&NR4㱛YԹvkL1ǗP>sMTδ nuH췭(NO%m0PG [35eEz;W =2c&>9CwGoHeV"'6pE!NduJdXC=B:Nԫ.@$+,LŠ<-}X}M̛DQ? 9̡`6bکk.&Р۲ WE.UpD#!MMO+ieCڟ(^IKYcoe-?UW.k]TΧfW PC!'M=BH3MmN1( TOe,P/A 0fY[TĵcI"1 unjEdoUV5 @K99l'p&Q?c0Bܾg.}{C b/}܍ I0L"ϸJh>@?we@b8I\){VǶV)8|E}e4X_UO6c#!rqHÕa#Uݎa+A~CcSi_Rߝظ5Dt`Ivme71^|wkW_9mIs\b9"^rAx`]̩wt]*|㨃j\XY]]ÿW&s+KdaAdd(nhg۷3e GЛmf1d@O흣ĔH@l[LX 3_nH낶,h͑7ɏM57ʃ H؇8p\ɳ ]w %vV3OφYv~Οfռd;o$]Ab֚vA]=lIͮc4C=֡ס9o%4q(2&t D“lӶ *F4.Ĭ~ٛź1.N[N;꾎ǼKP4B¤zƱejHY\7 6_!69W9Ñeխz~L)EZ8yivQF?Oy|__ľsgEIֽSkoac*6ܮw a^.b=ؠEQ/if2a△ }a(&1A$CE>Lys0Y\7/gX5 *t"WRpCyw =hͽڴ2*CT𪜕"E*垇*Ω_2@~@]oDsCwF0G_xAwД֥ =ކ_"'?2襁]mpke:m9 s NGgy S!x5$̏^k)8FB#˓oǂhDxlY#Q|@" 6[#7WծswRv c^h5'}{b# H?:"JdlqeZP]\b /91KU &=" \ Е幓Qo8)`/YRF C.R'ĪEpX#ek20 :>?,@Qjsf۪RHz#&gTa^Y~Bh4BƑd.>-SfnrYO)^׉X{_O9~HG B"Fz)g E?ct Ig 6K[v6 <#ggo~{ݥZfmNT+صy{UbJ5>HQLސ5Z`!J\_} ܂#}#OR8 wJ8 5HGgb˚E &#N"[9ا=mtF\ աx̷Ylx_YAYI0:O)[DUs,PўϧsqJ_'ON= t##S.Dvu>kx~N %v"zxu8[x "ڨ>U7o h+$Ltz)[)N"{*I<R <5r[Dʹm+;ᛰ>T-j×Kz<Ĩ/pO,/Dp}zUW<y.dobQiP9&.gNZvLgY0(sp*R0}.Ij|!'i0 P$dh4 87h];~ (NJ6?\7HX} {~f*ʦ: ټvsZb}tFԫ4{?NyEǶؘ,^(BGQi'UH(=A=>roca^5z| {l8pNM& ;& >0h ӎԎ_UR&3^p͒E35ZKP1pЗ잏"'U'E*W XC[V۴U]=ЮvNDӪTӟO~e24ZG\.sMnUC,@s F">Q*4XPC<ƥ$|89C7+f`4x1(&v洝-T0;|b6a.!IM'jfP:xM%bvHF yF,t0ʲlDi8J啉tRh1/O_~s=Ź6LMsJ̎;cU4N<84w֘xKw'?vј5r:kIF^|< FE CVWvyVE[iSj뽝fEs+&Dwv%rF#{ ģ;o Rt6Q,Q`I$ݜus0J2z0uWH$AIFdTGcޘ\O|_?:.y}֑- G'|iBnq!zr+R+2qmoD>[x>_'Pگ&P41n<63]npTƖv)ê ZTcR&Wh+`sMQ)Sw5v#n[eXxv`Ve&P e+Z1/Z;wo)Ѵǡɴ쭘=FR5y,ayH$g<hQ`)RqE|XwP ?H*|ށ`CzGX鎿0</ tSb T>FaqHO 9Q+N0q;OT:l5R;ts4 e84Kw=m 7=9&zNO@|/a; Ej+"[K vf]V!PL%yO)ŷjZY?Y!J(q◪?m\|/~p:LwXi"Dx3E_BB|bۭ"vqeJ!zc)hԅ2\QZB$bؠRȜT:-Ltn6J 5"'5棓rO(}—kI?AeЋǓ@keՇeEB8e+?XOcRdfZ)|+yٌT/ fxH>@r214>q 2Ve4eՄ;m ? & !^XB BT덡1y MUsB 8$ܓF]mc%"Rآ؁0>x(Y`Yjm׏T+Yb gQrv:؀F]6ŚmU' ZeuEw Y(B򳬪zl8Z0 (4LIĕn eL WGuC9I;,+&`yM(F]-M@I(kT灺TSH!ܡ==Zy HY MQU?d.#'ų.炲52$9>h Bt&ȥ_sAf$~7+@WhN>c Lp *]f``pდn#PH С)Ժ@B {8@"M` g(7 ԎgϏBo.nѻZA[Z N y05!`Cw%1{9LߖK :!] U &P.\šC)+w*0ҁ?P}KN43%|>TņO[dSNtR<YC؜V\)qtƔ2p1.gBc҂ JhR}Ja8V[" ؆v5wYVݥsb^hܦQx3+'Go.1jH^r"C|L/ CGmo[j;ϋ$\ݺ2^>Z+[w~갨0`r.*6„,<Urʦsho&eӺ^C`Q0!ALvhwʼT|yxb F`:`dk<|HQnpN Mk6n=Z\cGTw 8Po<--_"cr@ "z!a:8]299W lAWVRu}=-tEw e[Ds3Hh'@bY)Bnぇo˚4M%(s}'R qԨ:B(scY3D͑Mݲ F olW#P_$1e_ U1a]0WHi 2(%c8Jx'Bq1!`u~äێ_r:/Fm.|CN[*`nX֫|S^&wZ/Zy ׽(|u)2bv#i ->M">eu]KPLٺ< eѻf:DOtx ̕ $3 ~{ޜIW 2crEGՇ \zԎۙ.)R 2FhֹQ L:6KN &q-|Bٜc}mඦ9+b)WK`ZL}*{ >ټz8Xc Ց,ЎB!qDŽX*aϊ`+>G=59PG,ጬwϮx.pD(ZާJ@P 4+Nktb*[QFdww)qтV_߄n,EU-OiQ j'yq&^A&aƥN.+^Kb B}qgP5;eK'` EGD]4+/bg)- +NHJھNY]+ej|" 6p@0MVcq¬8L$EkjQJȿ*Z9L:h e#oH~dng:~ʹvY>/oh{}IKRnՑqnB(8L|\'(r(y R΃n|hWVw@3cpD<{d-Es3P\#ᕱ`86Gv_Ez"P_ti5aHmrvT]zs;0Bq6du(c٭n~"^Q"It4hwrrCQ&lQh}Wi-UӪUS%jYUdR}f? Y >j5ÏU:wBðu+XQSYƚ I7DϨ$XB*(|V6yZFCS5ϥ>dGd-Ӹaj{<[onHVRc4~sbX`YbQpŅS=Ac#/ xux:td/5YU[|@쭿_N].&Kiof06}]s[hTI ^2Dk NT\2?!$ßKZ(,Tng\\27E}~Rc~:$ 4QBrt}#.e\$tT粇x)B6ƒGkHT>}nFё厓b/7SU/g2(1 +KACO}&'Ba/)]l[U@gXgs Pbr"4da~gd`kOT6P06./MQڣȜvܙT( ]f*gv2}Z." (G!S$Z)Ξ X]xߊ,e@mѪT~b'OSl٥]Q@Fݫk dIq?*^׫\;{OK7}HɟBjkEQJY}uҁmqPDǰytn'5j*Bvʲδ)ݬڲIXkE:K1v 7* tBAhn%/ [aP6rJB9SC<i:f:ޝ"3yY?ĀhipIT5֘rj ط׊uj|BP]FD'+vuؒ1@Fj,BJ)b1~ MQV2`"MH kP6*l̫̎7[b3-3cj֕"@k2lj|h?iN; ݔ $sX2g['wgvr^wXyi ;vWwzdhhiTv XLq = ٮ+DǨǜ\IJ:PFѾ^tx`i :r*vkބJ9pr4ho}9DM Sdssť>gj00\K^SuÒ&Y C{ŐԦ s qݶآ%7<O @VI3՞1fy[`n?$^/-l'~#X.>P"\$XdZ+Ԕ 5֬_xE> uX@r5 3}J*[q2a7ţX2 |4 0ݫ#A}.4Ns9|,~<>i:s!wQ"ت54?8֑VȔg@{.yԴCWTq54=e3A2{9RA|}&+V'F*Q=( {W6 Bw͑qτͣ%jd ZKe"r\A\͚ MbLqq4[q5JwF U;t{a/&Y;plBRƒ}5qLF <ó| 7\IA3*l-|(h8~+-1Nl>4?Y 8(ry#eW+]=S+ЫcIsz,l p%@D1M_ح?f,8)AzϞ*ۚ FhyJټD _pO7ݢWJ1Y'}@=ӷ>i~>).&&{9MSl7:oif/#!luOF^.XqD=DLB*^_g,`+Aj{LF(cߐIooPWG<Ӎzbi?lA 1#}!ﵮkت0Վj4A+ľ!'ew?] _ЄkHWԒ.}GG .:@KD,ё7|M$M}rۑ~ :77Q ЀjߟGr ݋ѡr1&'. @ȝEiGo'On{J&z׿c>(rqQWYe]] 9F6 (W0]YhJo1/U7S֡X\D{``_tp5{3@YߦE.e| `һ@9z(%K^,ql+B,#9!K6o ѧw$Dg'Ɔ[( Oc2R ,怹ċ>Ļ-HT^D y}eex7 7z@ۃJΒ8˥+.OF }8JŶwQ:;AE#nQm0'|lep.1Sה)f#cW\4h"@`HYX+AVc ! 2Hi^eNRr|w{aaU| += RpISxP@$I0 o7xE9'v'nw$at&@.(肸shA}(~JM;a+~a(~6Jt+N(F!#zR#}~]cܨ _X<{tD)}0w$ygM-t<Аp 4J0Zq&l┊UM ;n0>HzN&/ 44[9ѿ<돊wgҗ]-e^-{s.~,9Ї?0ݭmwh~jB1nFd~xm"q}R㴺gOެ'Q?̜ 8(*20z߿Ԡ͊%W9Y3 ǪCƨ|V>y)y:y{-3A9x_tUc/c(g3^";m+k` mw=q?0Sy)Fb%T%9>>#WhĎ]w ִHKk쿯hi˄w4On߀]a20R;_e30 vRMjY :K[(<&h!sʼR٣P:)-B|јFUk577Fc=YpCt8A^`58s *gQi?U5, cН:ww-l={̨^TL2yѕNѵ!BɊ1gVHR5z{C*ݰ\7ǭT*|,Di6d+mE'ff -ٳt?cB+3gJXGhZE Y&'x1VW| af[ X5~ozF+k9DyV?7`hU#yʽژưt/ԟ_\0z5ٵ;y()YN|lls!}$MTԌ~."h(.]]H=JҴ&ݝxeaѝ4i75v˴'5[2EE?(|vӥ1B[՗`[˪W|v*fp>S|ɸ)VMݐ򀺷jyڵrk@_C\IU̓s+/}i|DxNNȨO:׌iڼHXw܁6lH4ԾUV`p|GQaxǎA[@tJ47❮1=y;7sеK0ϺgӨ U{{!~Ezq3Rk6;lm;,rrZz\`#ns$j]%}-okTɮƠ|uIP 56M|ix>.AQQVx_:[Q\zKe" R8t.Ӿ.Rgw$N$=.l+ieκa+nU)Zff&q瘹AtPV>~6qAE8 j٨c@屢tv2 CQNߖ]&glԌe۳W1pU/fSˠs:dPa /a*u[eHͳ&&h_ܕ4P\ Ie &q917q*P ױ]8AAџ9htk欝w& MUs6%PDjw^[S룶9p]eX~|_)fs6M^-l&6^?: 3]UAI^Rx:g'/ gD)+ ) -E,<ܙ}/T2}:|:ۯVl?րjgg_KeP{o:Qee,7C =o0<^ivOT+PL0LzgjDIo-O#_7f.Dz-/-eԱ(TKzIı/1VH!ZR+`" dAMܓwkJ/7WOm,4DA/>z;?u6=V O :*)Hh.J&<eV.oˁ?o3&~X C=.w2)'tj2W22Vum|޺՜ojPwd/W6!][Zdϖp2"a\2UP5_WQ%QyBTH>+5XFuGkih|h |Zkl> P.!E˹[Ͻ?L %]W ow#533y9ې  o!ңX[f)znuyOPٹ0Frw0Y~G {;o>%q&[ tñ!+YK# (U~wH:mfCAQ[\+ 7 O*dj{6|۲z}9 U55@cKf$̓H6=(?ބXʓ -# .i:#| gmx;)n_,/I6WPtgJmjTAyLA61 gs4$,$,彭LdHt06[=rZ bc]d}/d8uKoo~re X(zk4B_pÖ{d ɍk3V1kwcɻ_dkՐxR|½EE̲O~/k?iTs ,o{5徬r.aʩSWy.~alV+>si¨PBLN_lC;d .\_X3zMs쭦EmSY\sY;7g7hVOkE:!*NJ6׆Eʵ(܏esǯdܿCW8cLTj$HLHP܈z{p M~>+zYYOj%LRr>5{/4|8i6uf3;#0B/ ] (R#^D;G4cHLyR7eǯT$vN*@ GN3wΧ?"q{6̠0r-[ǻ Fw{LN[.eCI\~L IRM9|UcG^6 ms)#94ۍ'"9si'^&m"N2%JH\Q["; -Mޑ :H>Q4I/%tCڿ=OLuLϵ3vt0͍˗ID/hc,o/[TUtϾLӺm"Ȩ-qQ]%@3!`E0Hvbц f ڤ'zvaнo*)O0Z=1cїc#݀gb(!^elhO Nʶ+ 2%&g.Z20Mgv|kFlN.(Sgo6vcEóS%< ?} 6]+]71T;o:,{ O^Z`_ qօ!%?ywt l,WȝG+yP NNVq2HʏW:a<~⋁:="q| h6bKr{\A?LxoX ޡv)yFB7D :BM T을b⭢Ps!pr~6 >0\SO:hi<ȣzU \(讷m)>mUƯE?oXqp=^;0^)=n_QH§VѳE6` n.K%Oy@at322c-RKjCmhsʵ\iw`5WktvPڛ8K.C[kJ|?"%|MtyJ7ae8bHUϡ 4SAI:֎È\ZR-)@+_*N >]4)J5 joh:=)!]5Fz(𺑝띵DEW/acN* S:O1g*y|Li?iĥ+nhHX%:(꾁?C}{ sGHJ߮[ &܄[$plNYjd&~i1P" ug,6^*iU8.C^y:gM/bO91R:*.z2G)w F DxcE,QuL_Z6b9Gmv3Gka~Gu 81IWл:y(Fh[@Q}~nYb`YV'#I2jt[W7Pd .yc))bp?5U2PMN<{F$lQE[h|I`(#$;Wyg熹nKY&xtt #U噖lp%<*rdj%)XS}LQc o]X I+)y^o)13މZxv[j=pr"7ϮFvkz VQD ;1]Ĉ@ RdIpws[{ܝ-X7E8L܀{5|HS!% cv"a2RG&iDAI'8<2Q72[&C>,Ckz09 &3sYљič舝pe:`WҊEu$,Yk-u'- m?^Ӓ4a2v*"8r}*dkMG$m |Aj?.& ܊$_c|dI].Joxz ew&B9eKGLэUbE' \`+g'\ȆKմ~do_"6E4 uO~B)_lP:AaHMsSB5P&D0Ө.>M8D%#K<#{R=;/4qjMKh|hj_ôߑգIPcYkc{k<fT>]۝`c. zR`ͤwEJ΍ܝ>6* /ŇUSP }Ї׊Cs-KgiZ)7Ўe7_2!i7 %exiWw y70 Y;K6x>_X*G46bntD}P.tdmȱQeLֆ> ӊu +Ƈ['C:#S\@弛UAza[ةv nE=Wظ(?{bwvUbf/Z2>X*͟OI? Q\B$yggT `euЅ)[]M7i412L5{AiX$Wd G~3WTCy}\,GCB"iz'+64}Qҝ *|K't v,C[ eSH2;W!@،y?EV>~sySaĊ wڨk[0閶FӥsKxyoۣ |@+݌q^X.o]l.)3b4h0 ynDo~y~W7JaN<ɜ-1P\aƑP}LmHSQ^Cq0 0[~P|f lXnʮ$!wqtRs3Ow A8VotM7^RZpPo zvW5퉩.]fڑaNf['RJØ1DEa4+T8׮smڒ@؎鲁Jv/opNjg_b`b+QMX`ǰC~1XZ3{q.{W3:rǑ3{zglNuW!tJB̠u'??x{'Iͫ10 B_ejWrxJ))Gh K> Ȳ芐7KVХYZ ^~ ~&0DqToַWii&#`Q]>j4"rՑY?~ҀϦ &17ٮ??xKXr?Q@&n|] n m%9F hitp'LNqZmϺdkknߺ߅] IӸO1s82 ; J'CA-B+ Eς!J€7xnV+*̅3:azJyKHqjũ=x !X-n^NvAHmY$~cM; rZ~Q5Spt-TTS^ϧژxߏ!2筓MEj83FPɭPۥ?48`~w$:({ՍJ,%c)л*Q#ob50 Ni˘V֌>S7f8Glc'1@z9spKܵ(4C֨xlH.{ <.Zvis?ѐH VY kmHTmr-crpr573e#mڙcc'MVb_&}y@X6`RVX n! ]94"Z &fPB,;;A&.yG۩]QF3yXm/oIjݸ6/^q)PVZzu;3WuYm6:6,Os`$GVv́>U7}[i~#sPTK']zq6v /lU>癡n.K|@U cg i<D`i?5N޼O]uAGWñ2,vs| ]9W1mk-8'rD- (U Z qe0jjb $oAH#-"6( xf̕x!P>ժo| @+ƂUWp*ǽ1@Hw/ނ%ITƼVS#4_)y1 NeJ6H3pf3׈J'GwÃr4͟#{-mYz"4^o#do7ϛb܇HN{lowXg0RiH3X#G֕!(e'#ѵzZ ܳRst+bZcG< Lg;P( )[uVV_TLB;Z|!֗֙=@ Ic-G,E5Iړ|0y4-BJR$8*5bu6, uE+E!bDD?2lLu 7_ F?A*u{DB`T4ވDSX<j+Pta3^<7HULD |}Z,@ A("I]L'~9a*+n`}U.E r[لx|r\yI%Ci1$(h=k!e:w(Z< 85p>VE1v\h>~meԳ8.=u*H.RAv8z,S51@ ć NyI)B]|$cYoWK5}quNx2U^F b0gH"z\!//Zw *,Kz ꏯav#\0"Sjk@w[{ȅæZ1&v9 >mqCߧ`O0=\iƉ>`3î$ K-35|ڲ)W,nWI  Xz:]Ш]c8:?hD5j8?DtJ|EuEvYhyVݵ4$"6Km No.:%k0^S_l5|!Wn0jy:(iZIA*+_k˛ _R$J) [ EHtH֥^ڀ/!1䆚}1&3#명rnR8)$&x~{6a;_) JiM"]ݥȎR+3eF:(%= .WsĀ)t㲷RGߖ1'cUfTh xrob`^J7]±\6aub<;\vh@v_ɩ>7)SCG̵N4h| =` Jmv #@A ]J2v9(l/Jg&(t#>v)Ny<́+1z|r6`j5.)ЙGUcr z|n6?]!YQ]yyp!DO u:2#naݬs-9*i/ WL'Z./y鷈>!E@lV13({+ sVOóy4ހ3:rDϩ@iJ>Ju=WIkcP(%2%MKix#yT~=څ:`!e/z8eLi\ KNV;K_E\4*C`2 7tQ茖DOtd`?q0zocC`xf~ײK3A|ԕ.G6}PVRT6=ʔFQ+ODhBFzR70آ[G&]|{fg3۠ic~GPrK}~u/A{0VjݦƌJƭ\_ū>O0(϶Camc+.׿_Tc֭#n!1yf?6q` gO?#/2y4X[)p2qȀeO]b5;[!6`;?nZ0wF/'\\9ePTWeg*x$%z{n2IIV {T:dH(TN:$8Nzj[J^>lP_>FMc0707ȕzwk G؆()_ .X#]_b7|po;aI 7 wQȼ6!:y7"rϔiMaa;YH ywZ4˜:П̞50S1g4X'uq}9V^Xl$HXEES ,}ſUgI5ظՌtX,JB0Sxܡ1Qۢ-5XԮ-祱<{ʍ>|.lp⩝̗',F:jby63-ۤqX] ‹ ӈɱ%'vbMVJ^"% zrdȒf2'촌N[ϟO3,E7rY4r'q%s2ܬXI6EgN<Nfjy?Ϳ禤fݛժ&ļU ܭW8qSipWKRT~yVOϏT՝ft:oJNIZ}tmY`<_ȗgy"b㣄2(5ᯆ 0ho[z?{280X}/v!͕\]x%7018pȏ}>a85>_oM- +|O;, իɏ`j8 Nbay˒--ӗ)@_2 e[,Rs]Rmp|49Y`߆:KnKۻNetp +,Rȫ LEaA% FPjǠQ)Qᇡ"(%[@?,#,y榋hǝj0{v^iȒ偷&@$GnILCZhPYZS/axcd =bϺ˚W!_ݴ e@b~(cYsrm& P ])Ipf/\q}=./v뤎9!տkeU@)y$TmefAڱ,`vQ|>=YJj'5p3S;gݢ`e[!Kg '{Gn:g|=aB*E+~gvGR2N%Ƭ3Nq#̥;lQOlJ%7DoڗaP{W蕛c܎UZ0meM'3> \TL)|s!jW*\z[ݧ=3#(큔S"s^W[Rm-6^(d҄:+H(7G0}L{UBwQ}3\؃7Nw3Φ$ "`;GTiZBnB[`_$'} %+,`j\,+ ׁm4.IfY9W#* 5f¢gR:AjG:RKiQDU7 vԃga6Q{vpz[fO}l嬆[*UC _jB|iEx8 |˩ay- ircyhBa)]PSACG཰Gx0{KQLۧ019> A/a^at/JK.$$Tw)*ic˵n߲AlB(yP#-Q[2:*`e4H=XL\/kcX u7jpzJh<]C Z& *n*:Ip.[5\K9,fhۑڡ~B{ a1b3*Nac8ŬPTF^@#MF>7}'4`J&-)[$’S3Dҩ{wFl]7H+`^Sqq45/:Θ+Y)lzq}HU*O$.5!a1o#qp|ۉA`ǜR4\V?DLRz,=RӜ:Y"oC'),ԉ,(#p"kyIޓ?[EG,wL>?ͬIxIVl3cRcQ!^s>]k^_`H=M; >%e0k7$ .}> +Tlc`8%u Id'Рt1́pβ~Is> 56TeCP/iI\_JջP/J"m\n e $ g{kMiX;t#`i{H{<0fR)6G)NK Nt`H=\seq 6O~+ [ngvcq4 2}[k1J*E2(AP!}/;?Qt~Khx@Ukov%ox\ `獐_)Փ9>G@hӣ=oݷ5R\*UM<g(hEf(^淺ά˻ŗ={![lLfbvDbU/"GКmL9\ zxvf͕Im`rA{ypBq3lllœW;OAWzW5|IÒU`k]Jb !Ot&"yD.$Jx,{TX`ae O;xS[xx"MKz,X-Tt꣉5 6pk+fܕ! 9(rJa,:U=6$u鼒bVc;XZ';gx%oN jCMZ)fl Fl=sw_R%7cr7tEoi9X]n7݈O:]>l6HB:*rٗ6N^DyL1*NGy\u9-I3a-rC&Sj ;?,5j_K@[ h)apx-)`L~%3O-$n#9V{pq}^Tr~d`~K&<}5_D<[9Ȭ0-F٢Hc%82Hge7PA[_,7~08?>&A&JDl5W""42'%s4_ߴ#BqCvUOnb˲I8'u=FCG-dZE}vY YWH/.?d'!u"et$؋@,MAlY]4,1`kndY"WvSkl8,D)9 q;2pߺ%ҦWHZTj6)zAGv @sBz\j/Ln\/ 'riR}&ʍBԡvᬡ~P'%,Ay6@-Tإ@}],( p:ss?6AKIxMa5è{qVYRw2>0mWQڥ2>9:@20| }  !@pLKfzUf\LFAvUWHZXz#ml~QGG{uмn^w*Fhq֚fL#,>r)e*$4񟴵'y'qGZ%Ps*whЙR荨-xgz50oIJ|2~`ta| uQõ  8ЄJ3cKC+M2"4[8:ksڒ16ϒJ]!,wsǜy_eh\hA{߀JpI'B[ 7vL3>Eәw/\ D4+DL3^MrKFh$4ȇ4U}͢KILjaehaFMxEYJu`<.VCvs)+CK:VڿqEELA%TײଏkG3'Bnt͉ST9w*S;rbkZeC1+h?B.ӽ (*83nCsi@$?zJ,8nÝF1lF)/(3Q$1 B1_R* $!Xx^6*Ej(w sBnQ|!cqw'Aʹk##4=7^+P݈j##ə!S* P5ZZGW&8:hc8N:%KBg^idYsԅ*n;ܤ?~D!Ͱ.>`u$b{ˈp$1&Vz0Q=~z!& ߌFr_h7}a'R,']d=>ݮIRkwdx9CU%'Zg`b֗YQ9Kfj0v[ެILƏXU9QdX\D_$mdH}qE\]Kv3cN:[$<~Gvm6#)eGa%n)*ulI ;WYR 2 Ȼe\C- 3wm]9솘ќhWeb( Y11{QTSK׿sHu%y0u)WpdiD x$ 'IpݭKz|^x/e&>Q"uyJ> cGNlA3 ~*i+`Ȥyq2ĵ_GדOz۾gEsTȯ:-|ĸVe/+oxPy7_Z=pJ"P _H۴f"0I>KB_WAݽJy+s~1v&7p'-kLVN g$7}Zw0Pz6 /Ʌ,tNoceEنlfko߹&Q~x.vq~V}Ǯ_.A `J wxs̡'ĩl+Mf?}@Orb<6OFE=mU)W{ ^G݇`g&K,$j"8:EciN<Tp;AHٰ"±rfNP 6HҔZ@NfBaK3NfGrr ΋tyէ?nDTp ce]#ͰCTIvp#+nw+fϻ://dʗˢbQ9@c<\)t(9 shi3YKad㌉*|;3SYdRs.?\@,ȃ+_E`[겜4 8C> Wu.XBO>:RCee)qF2Au٤}1W[UI-5MtDFk؟_I}2^Fcvw-(KP' })'#+Itj}I."Hu mSESn8~פ\lQGs=<9kEqlEoO1' kk0#0 8ҳ%XDiyԧk}OZfzzH4OL 0+{xkϵX1̹I1@bmwn:!oqgdp@4jMxDbܸU (g0  WP}!O`.H,A;,xfl`Hj2j@ɛn-!~F!s_=a)JE VCZ0m} ٲ1$C*]~%Өmn1ݎ>z"- =<.*tFpWP[s R޳@= =9Lr )pX`W1$zHAǣ-<H#svS3D~ ձoDq)ֺI)c,20IPg,XQ„{Mh^}={>oF]_sV܋P{6 "Fq"2)3oM\c6>P\M8_Ks8+njf"2w3Ha A/z]Jrqy/!q$:r jL@djZxu&K(C!cĦ"t>3! ,n+֠C"J [{J2ע@U[WAQ #u4],Jq/DajrFǣm/Q%<ZY\Fd6Tf+ tp Yh{yۃǻh &u YRu]&7Vt),qhĝy_}$lIenr75-d_}XܹTmDW(U܆dj2[1W*댉h'>ɪ;Д&"w?H?γuhگ `2y3Ob"xf#]4t9PSYںL@$ ?yn1®~o;}9J^;CJBӆtWqsr$kS/2`v`H .EJ~qK- JOѤci&nBv"T ]5hL8x2ھAi].K̤ͥk,zXBVi$$&0X]IsYTs:0#46awIĚUIEHhԇtZP j ! gj6i۹ ;:&mWr_53&UETl㴬]JC[*Apݟ7;%XaI 9F F)V_a.nxiԇE孌@;=DvA]:,]L\ 7~) J׍C%q&V) `-[݊͝Gs'ˏx[wY2ݎ E4NI.}wpkRpI͎y$yk2C)(T0m=qi9ܦ1ex]t 9T:wi~K/xI\8x#mflVGiCwOOܒĈXSMj#׸u鉀Q4 ; kg;N|zNc* m ?LBy$}XRta,t?0ׂAxz(P*t?7/Z$ORFVVϽ:4IDҴ|J}=t]٘[ƝPGCl1੶P&m:"6<$DAfI's'7"}wyҊ"xRr&Hrt҈7; 6+ċ% sH'3+Ӗ1bEzCzbL~G/RlvGr@lw{%G3[KOĥF6(}Nٟ>Uj(1ɓO29.s' 72!>[MK^|A$ f -2 U;0ͲƼ]ڋ {ITKPng?{kMQAY8z%d 0aIɹC&+R:IѧpjwD PdQ XGn3P>Z1 ý¶ӭV`,rz'cm@3cKWP,Go#zBN93: #- ڑIa$̒1v^r{3V;y]-rW~Ŕbv[;_j62 KмYK/-4s;2oԘ-g:ڈ_u}6024;O 9Cj)#mUghvZ;UfDp񖱞ye80^o[%aCۓEQ<ԔBEV])&^%dB%\roٴp@iO)pWk_T9ob>bWϐy  inŭ@R :hWЁk+Dy'h#J|Δw҃/I)?/}[ U/$";㫝Zaـ y;O`&h$@tw 3i  }F!Eܹ^"P谜FQ"+ilv.a돓_!}ſc5Sg*6lRbtP;aK2o/uں)7P)Ԡd5鏕XӚ0s@ ?*]t e4!njC9*\0Pb2a7D0etS\n%mb`XMZk5Gs[H{B 5ͣS} Nb뻒/)ɍj5] > *kuwI:!a8bpU}*rL{,v*G{F7Za ԷVDOdt[r&%dɚZ<$r$iUti9"Ŵ$E,4nEQ fm| ^o"bk,UDP_>:y:6e p!iE)j[H2I3JD2 }X ҝ?Ճ̰Y4} y!#N y9 #nq7 ~τ z'WiWuнytYο{K(%"dX\WmYC /9A +~v`ٍB}a=|QnS\Ѡsa ω@ֵuf=ѧբLv{}x>>[>0rOEI)ry^@ r}ٖpb!ps~Sc,ziQ?#5[\X[F^۔ y0 qejGI1X0,%^}./ц3|EU \A씾)*2*|ü*L"Լ\GyPq Q̶hK#z[|H1q6> l&`5EZx^! fv ! b[B{2dS?Kiq9^r"5cS}X1ҌHv>u~jCV_hz}9M VW !i5)gQ埏Kڄ>{,#*gBx^36C=rfw3r6mN^? .XHK(3aZ3\L9 .tX{ Sbwu#af88@?6}?tGLK#.TFPN@Vx@d+Ry u+o.T /Igew~HZ "mG&Mʹ52RQE-2f,Ϩ=(` 4泇K.eˆq\}X{v BmZpß~1Gh, (aFʢ ;}CQ"ǭ`%t@.񘒙*I 2tygZ-ya =Ȗ::&zg~@o򵲆@;IJ W( ұJN _|8JFx[﫧G;Di"0NF@䩗"3 ]VZ`o3 jV?LdN;YK-LޟD]sK&)uE2Ь0[H(\FT ubB9$ȢWIQ*m|7LJflll㌼;:>JDA9/D%MUVB #'m]Y 13D#(ev{\ʄRBgj3 >x] `Lz(ت5_V#TN|`$M]v#k*S%b\fi)l%Y4I(Ûk9?h|PUh)ULN+aƭ(z5)y#]+rd?xYs%Ӫ 5@7M1{s8 %+_@zM}N*4GU(^/ .#IіJAh[OLb7ҁo̳Q7z%V{ p-MbI*qBBǶVYr,0I.h}徍MUXK(gp<ǸZ>k즈0qqz.J*4كΤi*Nr;hޖ@M- ӿv!`$xKv򐢅7=٠$m, 7øŎVi5dn1dP5oj8٤ywkk'|aX+wC$x._;1~'yxPnt c<.L5;==o@LDyCnZS:e|0l_ U5־ yl9#m|(eOhCrw( P捌_x[쇷6@YB>7>lb2 l:4O=:9=p\OsŎ [m6] Zr:!BmiMaZ7;42pgP! .|-*0A<\jjgH6 K $8ލIMxqO^fu^ݮxj\ ǔjAB^u 5ڽ=]7?9,M1W_|簊 {s@5b[sEP'ԅf/`;4*_:NnJs1epg `OmG(3|nWdK$; _|8X!~1>ٹi⻀]橫9lVbٸCG&T% 3\mF[w6j6\)AplL,=f{*9unh+ol +O:ouN* ~st<$j0 'X]_X 읣Po傲< BGW[ @`A$o ge Fq3f/Ea$cK # 痫CM,J.\Ђ+4_븺-R Vj f@'|92*΀ :lNzJh 1xͮd(nѰ=GWfRWRV-tL%u J:6yVިCNswέ֐ܿ5? &pC _ g1a~^*aTkӝHXWZy_nIyl#K3p8@p2@lJ %PѮYB|k2R#ېR>h Jj(}H=@uk\:*_i@^8 oF1 d4'<&Ti:ԙE+>Q} [Y4B<ȷѿ Js~y׬aA >Y.3z9mɝ~U++p#E;J E <ǻˁ|†ўpLsULa)+.H05Ch;]58 >'-55o&|yx'·и*D ?>dDb=e`ڡuYAxAHr.9l"}}X+Tȱ~/b~B7 Z+=a,x5]{7e 8~VH<.>0Pwׇl ݹ"5*#4ĂYso*,]?BB5q < ?H69̹%A4EV#*+CsFgQrZULQ+uZ'Q1h:W0r[`g)>oG@e!£0. E2]3674Msd]JE'e#.MtM4~%\kf _T4eDr ^.&}/[`xZ \I'2aD: )驲u4@ڃeIo@σELyKQQ8q{Y:FCӗM >CyrڟƆ{FeHQ`j>IVb:VrnMeǢ$tp-uNc%Һ%VAnj^G5y',5(+yv"ե]S5[|Z` N,qJ\1 1bEoW 򕍄%<妊rYhG+T\4VVA񲢔q^֋4gU%g2FXLnɭ Ѥf X';`]~}M^s$7],{4퐃TC;}oєBJ֟CBE#sd C]`?~>]ȳ+Dmj3pDz\v%g*;4KvoWC9w 82̞1)ww~SoTޘeUՅD&#ERGڬujv@h uz $1l{5b3Рy^:盪*wQ"\e^q嫐b-1+(/ւn0fq # =8:G@@Q%fDJis`kuȌ ZWF@ۜΐ6vn\'ԯ)^!Ex6xMud}i m7*R&aX8"FҚ Y& U2'KtkW|.0{4=$yAky[¼DmaXw ~'r$uj>eڏ>V\Mqjr-^z|(PezBmIq)]]B6% \0/#q;4ruQl ݨ[Zů.*V6r+"=v6 ݝ/.4\gcɩ}cfKqPK!G{PHAI𞱻 ƼU5k$B]"H\fm16fʞ-)&Sbi&f8 AȴY;!0ku#1Vd}cۋnO>Fr{UP0?1Ef<_7W^]K}I94H|={"v"m Yv$u izV5X櫒TL|I_ CMZ$#Բ"RJ?q.h(i2/y@=L$e]2.sUήEsjAi%CN4 } -2~ʕievRI}avMkL;Sҋm଎hL:nXei $`3c2ݱo8+ $+3wVh Ʊ ܦH7#ވ*=Cy )$Vd֯GCHuG_P]jgXRj%JOb$J](pbܯduk|WɿI%oeFj̒>n-~ 8;M@9YD֮V"pDn;.h*Rg\%\ԧZc {%DMeJ?ocX^:AyYQcMr75aN!q!-Dv |Qᒾp3dhL^SwIexNn[- "C$C8XdX+.cs`DaZ*4M J\A'!Lzy9hN-=M" m&"'z3B&>/pQ _;;Ynużs~F$e:~ں,xX;thMH35NP4RQyu"f;QFsgGDv|L!]f>ϳr"z{ckx"|xo`Lo}Sφܚh8΢.A}^jǢR4\DgDl*R?!Ac )V%R %)P6]$8eApKSbYp:I ,l`&Dc:(=wjd}@Uy¯ҴCqJh0 u-'Z$TbP|\XngVmq*# vFiKٲRmҦҢ=AK ~t79$aMi ِ0ϩpC?]5QVXr \㓵^Xl.?:dfjzꎯ,$>~ե w&X.k&L*S%pa@$?Y51+k"{+/Ɉ3%5W5j5*-xy= .Z@W z١Db'=c-Mfy׀0Yİn|ᄂyFà?(v+T\L ^|ʃl)viȪzcz-q #[oEfSb j$^7f_k(Oε;oڹC_8OߨCُr/tSz* KqxpJiGwWY^BAq?S=r1F]/hs/Zxh`S?"%fݯrZnDxS9`0qB25:?'%3-E;>+.Pdњd,<̞c(XK7dz ܁ ^#]r >}Fݓ>#ڴ)D xp]g4yJZ)-I Jq Yll w8"A](TL# ዪF oG% " bכXQ+Ȃ#8 ptpQ /GT\l98\.NNY?(%`ANy\NMys(:)(Pny-2jw]Bԃ[f” 2?Ӆ<~,0 `#SfKkM␚OGDVa~3 9LxL_YCpBlKۯ, .p'%hi˚aNY{g3®ǯ2Ĕ)F>8^p F%hV~oA"'v1V-q*} AV38my!nLUd<[=y=5])YmswsV4 ]f5`BsOzU`\: /#BtMݥ: 5GkށƊlr^M ӭe2oIΜU >ϝ+s3Yl1ٖUBo;?'l9t>8BBi/y)% `SdvL[+tBsO;2u`ODL~![N_R%"AN!8X3>q\mNǼC.yj N2-֎f`y@uiLxCdRAG18)8vVSfX<|gk6g~^cc $Gj,pc <>uR꾮:]Ψ •mhm>0Fv"W% ŬY~A%7M/ 膰u^-!o,۞F^+ثG{-/h߄{1o\)0$lO5}3weސ>+EM>iq5 feJG@GQ&vɨ9M;Mzad &i-odZ61jA!FkfɶNkr)wġ+iK5_Nf|n/\įeѓHE/]7d ^Β]1WF]\,(v (ZA2}LdQ-_H;4:;N~Mg lX¼_-d kkDR5cigZ%"rsו>ue Z 8 +<-^GSz?k-uBխ+ Sza#&]ݹfrd:Skaj 2(bĐFd&ωm] {˞?I5ϐʂAao"vlzէK"KQGbl|{t"^Cdo,1 ([E )=LЕiN!|RXfz^C1a>C-pӲ\ْQsTH} Cçu¨>`-P9A)wmncCo<y4$YW<2|~>( k4Zx=.h17:|rk7^ qʏqߑYlA)æ2Rn&/W0,;1FUԍ7*Hrlǧ^Rq5[SNCJpe/9;+%xvt_wc[ruR`Pabs_gJ"ujFml׳g-&G^x3 #D|}n }Qofٰ#,xL_a:eN+#AQ%͉IVN6*_<2Tme䕷@/%Q~Ypj߽UB` ڡj )Z$JϹjc8=4*.NiVe{P?rQ >|hMWe."k]~lPFjȕi:$E!#x.+,Z>.ܧ_]ȣ2#吞&"rS o{CUZe5dڨ )^"UpА ?㳯ⶡ1:z؛8A_x lɫlȢRYL.G+=|8qݒ|,D,u'^LN(x5@`gXFcGPU$ӕ/-AkEb"=RgQxI W\m<~]N'eL'b(_CùV8(G*WWpzJVu+qWAwCvi!wwWXwNh$⢃'CS*Xrg S/Sd!zWz3D s^7 Kǩ;G1{X5?UDsA?Pvx l3HuiYΣ Mﰀ3 nm{t Z1TK^B$زp^Wc p1tv(35L `IR*'Y]VT(\7Pp2i6hGrdHQ풙*[^~-]7/wCIB{Uη,<|HA1PtK X=IޑB"L9袬ӒJU,S=1`ϾO__N])\J }q.="#$$OC]pfXfv Ujd S>$6MAN_ @MԜđ8WFWP}!×U-`0]$H]_<}Gq#'H^_/JZx|׺_әsd@pCffyi5y 2-%|Hɦl$Jˆ0X"I=EB7#fo[C>Nֽ#i|9)lKDq4ޣXH6$/=46} 53Xkt?% 1w.ƃufUKH%sc&hYʀ6b &|b]s9CEÔ*GA4BiN,i\j¾R&v[Gj qtk?5uJ#]j lu3m8<ֆtT66}#Ѱ,*q!;B@RB& T[ei|yԫ⓯MKp-]{&kK7)[%xYkF ޢ7;T 2 kV:AOٶzՈHū]s  CmFܪuCӆ ¼Ώ/-#@cb6Q_T3aN4֯w)V5 {ZO"_ɟ/6L[f\Z<}׺Txe@fTM;s`!dĎ;KѮݙC'+9޲X$ 9K֣~vѰOfYO 8amd`N#+'MqI?nX05r1ekA~]i:r~Jt|PgՀ&^hY?<=)R =n)I^XX쯇Pў*5gT%e68Ek Y4E 6,j()T\(ư+c[Ghi$Gv nvٮe-+%ɳ _J7dn"fСvL )qVq 1}^q"| 5 REʴiave6ݵԼlpeys3M.= jQ7wee@% ]Z'e8& Km!/0:J2>abQvR^JŘSZɱZߣd6;&K8K"WͲbj};ZjY߉gҴkXYqSB\Ar,قbi +oey@ [N~dST0-3 ˝\#j=rnxrrbY0z F9u'Vv}lN+_5a 0mz71>p[mQ9Ij1)|BqՅ=&=n0@ t L* ͼU n!Fmgz+IsP-Y+>P`[}`)9Bħ$ 1m=g'[%ag*:ՔpC Nqy"<zkAG5˟)r#LQAZ nFɒBrQEij:Rr8R|ZnNv5m|+vQ>}Vs"UP5[H` wAӊ~tECz_6 |ڝ$uQ%AEy4'r9ū68]YG#_HTDvQ©#Zj3Cċ1j˶U`;ՊВԌ  XVzSIӔn ɾ9-*90v"քWs< Fr$BV7mi9K_ N'륱Ny7TP̤gnߕ>: ^` ɶ5 +_<̭BbQsF%S~ |q6gMX\w[OIs68M9=f( 8U@'#@B됵v= ǩ7#޵` BtZXi; c?`8aB;&tW8ʬ4lp(UaFrleiφ2y98)EXuP{۟"DfwY4$t4DR%6\ ;qƎjE`iLA TڟF"M5cTz醯b{c*}!`g$гDژx)ڱBg3UuSEJ2&UwޡE·-e}kRe H#{$.3a(xMHU%Ya>V%#Pݢ=Bai3PZO43+kG32p:b#VWX$8M`=MXf;iMxTͅr?<-ܒd;v˿a=+jΪ-SߨK$h]fa[ɻ =Z8U=zn<r ۻt9jG4!Q{%rʤa ^KX>z=c# Zˆ`kc1JM7/;itv ^r7ы'*J2E$|Bp{9Wv؉Db(~j ψs\; }8S&kɛ^cN[Gۓϒs/j;&Tڥ(x¹7ޅ[I!Nv4 /}*>fopnk17pL|JHY5xN5Θ)y #zXoeUw>P#x)d$y^8^0'l(Op/ M(-|k}i+`6vc#md7R):{OW-R~ FT 1yod\яp0zJٺHA9b>V8-Hpb7hcJ&8 6@pDZVJ!dm1)j_%}~!ٟnB_ !zY>t^ͼ[6 6A3) l#94J,J!Eȇa=]h~4G=PI"[q]\#j+q؁` 0tN*;U~l>C |w;F?աYFbm=Y,K͠nXK4^o"˒š6tRdᖶ7hv)3,2AuPsT0R 7[竩CWO߿a~,^/y ?|"s ^_%TڿJR__?/<dˑ¶@cn7cm,߉ݬ1Ѻ DU@F[Mɂ}I,xqשU%8ųPFOX+5 ztsMK>mVAO箻iPq_tGG Cٸ-mgG%Ѧn?zWu,xG,2$̓WDֈ "PH aQb4!{_RcZ+6LY. |'W4 Bz tu j!F#E\CJe7)}]k+v&~Hk=@)TMv:cL;=RV|w&J# V Mdqψ;H,oW5=1q`֜i|;%6 'ĐZJKaS^!} - dl̪B(v^m*0dA8s$ST_SIYUX:Qފ/]d~%7{) +` &ܿݱC}B TJܫθgàfP5WH D?Zc(3rj YERlr\e~yoXok ֿusqT@u~{ D,t7J0 +Avvgܪ*JiYbiSJ`UaDF'o_۪k1TfKz_7vnr1P'˗F\[l6\b,0z? `ـNR`b|@!*\ q5ML@1x\2h嗟\`Ku)Ϗ*_jBNA|.46{z%0(a  *^?,򫢀 #ñ;}W é!Πڨ&$!!ħ{oE9OO5Zd(ݲl6|~`C+6]Iˡ/0+5~rE^BuLA]_xՈDłl]G8>[p-BJEհ|PZ~±s{aQFHZTLi2"%XY@Q0bNq\J aָ33J$1o;`Wy(Bv|͕y+4S4 lO(g[LMs`!5zk洬g&qàA>(²]TNWO=7^+Ԁ "ɜZ:'D/ILHD-J/4VS~ou (FwSrJwc09a`M9Z rEŶ'܇6axN zt {vN"CR d%) p 4x|jJIM6H>J%.F+Ҫ8 оLF6Vc`ێh#/Bݯɕ/D R¨n͊c6M%u`D˧XЊ垹6pxgI䏯IP@DzŸ  dyDlLRo9MҢK{ioMMP>|kkl:;>Us2ZV b2Q'V؈Qvg% >K]4Qtau[G;;mrsVمzk?+!5nUۯd%h$'Ȩj{{.D3V&߰Hh"J WcZE.B{LɅ^j!Q@*oHH_~֘cRJTI7z[3^ 1 OC8>1YO65GƾEG~b>U?'RP<4P%(kyy,8cߔ!ZτH#c < ͖7mBڠ R^jNuFఄУB{ O*xi[fX2yp%?g3Q;mw@W( 1H0,4v ѹE.=IAt6k؈B'n@hT/U(m`.&>Z|e,UU 8:H \Br5e$;?)ψ2^q[]áUzps))zr իj&lepz0릐4]ڹ}/>zzCV|4G6";2"GqOq"L74BC,gήrH'&s 憮ŕ<,/@z1K!d|ř DYƩ~X$cYlnidU1x]._ɖ}M_cD8e N&`+"⤠ʾgyfTe$IJLrs"-4~n\pIzŧ&!_FbtN?*]}xgb"sXN0wjYڗ&P9atb .3Vk \.S{&)o{}|iu*%Riy)kR,iv<9hR:{mɲ9 s}ZFڋ8Bʺ\Wj}`x r5,Ȕ3362Dj@[pG@Vuyl2%)A1bI5|᷂qQ]S7vZ 6VGe@$qFLh,/lOA=zv ~7/ oמ 1GM@9,Qx]UoL\i\w*6(M;CPQΦlf%XAx0%]ņ=Ly͘|[1ٻ0s-ˬ|#a)g`l֜L$ ϼ H`ےͲ̻|/]*dրq8>^/P%L7C읁LM &ؽ,s)qAjgo?JXLf7DE>W?kJ.(R3e%u6]gšmh8ԯSMz75"AQXo<2keMBN" !"2%?"sSlveb$Ĩ+:,zR6kHn^(]$'nY3[]iUy@8/{7l rGMH/%M /M޲Q@gєo!J^?I28{G=&vZ̪"RvYI/7aW^!naNLTp\)"L\"W 7:|R~LlQ7v҇H-Ǖ9>MJLTB7S+v$f%>>n|{S-\S*[.et* z]7U· 5urpeZNߌ@[)DМѨ4T"5|mAOcVvo2)ZE~hz|+*[N} &(4oxZPv$ee Ra$L)C̃>3ta m(Oĸ. Yp zǢ a%ya0$ ED9"kܓkrs|mNbj3'RKG TDqRGJ*Wfߖiòpdqo*RmՎF=QPr_yC`sq#:ݨ&DʰoYUX#Eu^'YLV$DK3rZ%+>#HȮSN(t3 yal̫M>=]ut *0 eOʏkYvhEYFLMnuiMIH6yaB'۬fB,$+G_ Tc%uKlU ieQ1CL (xiN-`gzXo} ,yYϪ3Pf~֨=ޘZezm>Ա_^G=B #D3h%j]4\bThZRV)=3{TkA<R̓T%Ξʑd-q|q"X:(/*E Q"_%@pYKzgP+@tro[0ԓRڶ~rG6(J#eh܎LHY7Suȝ֡VBcyk_naJUոC̼jJoL)jy"| }LMәE,gPWc[ac0I(WSZ*HL/ePnj.˺ec|Z`w$٢^3{q)86Ҿ a—vHB5jN3]q[s|!vI.=3f,Bva!8Oɾy2r I^nmL)cEIԽ3Pokz&f`=ifwޛ?<?Xf/=X[*=~ Bvᮃ̜K,c:Xs~v.Vԟ㕒V͐;0ʦʨ-_2ޅJƇ ۙj^׋h w>&}x:ZϪQDFK}LDףiD_|b"oN_5q -yg[c._U_7 uUui`Dۃp:nua]ffI0"%x?*վqAwwg,>LY0 KфZn-Gzl.;}4 )3ulh`Gp %jƙcI' V-2htDGK#Nhs*4;ҡEK?qQ൥=,pSI[ c'Z>`I&TuKݽSʞKtu3CQ+yZCRo#22·6x\E4 ёf-;ʁ.MʟbFHDw;<=Q^Hel=~$s #;Y ,7V&rE?g sLHNs> _M2r q@lj˂(Q S8PR-T|vqGd95 2ceWTl#9H ’S3pn,I KXW ӂ5D|IL66)p_8v}kq`Kv5'QN˧xȦ߳HW)ϸP3"M~Kƺ=-nl)is/[&;?qkW]'iV(Z{5!ڗN, 뚪` <$¢,O'S Ŏ g0E^@㢚ig|j_Go#]%0'!/X# )Den~q jKNgߧ /@KUFut_4=m64Kaxє-:/x0t&n9ꊎkEAJ!00=Հ`/{%XyAq!jw1 c dQ99.6 E8eVZʹL_4d,{&lzCM cJTfu`P'-Sxtfޙ3ēE w,v9p ᒃOuzm dela&krE-9E:7J:IDe e^/ڌ%W,[b oY*mWMd^oj5oJݯ5Lc m :1DݽŸ 0sf[m`-g &Ɣ,Ëq6=?3ۚPHO RJ '~?"fq9'hbyd%aS HqSP6qsU9iT!HAKߨS8| GFQ%Ubq%G"hI7B'-Sd^7ez(~7_\3)ˏ￝|SAQ_H(N2ƻr{+(o9JrVԪ4iQJ?1k/WV9{ܩ$ ՓUwwE_f CVCԁt\%z(cW[~`t E\e|~U":n҂\nJ&b"'W9Z#u0tln{^x47f`1'|tC«6Ámr7C'yQ_Szl 'z7 }Q6å+%׀R̪z-VPheӔPl-zDT$xαy֠Gc!  Z UF~KɱƷY!@!еCkQVF:PiU&^=m=?NJJiAcmfAԡG!k8!!B C!z d5CV^%ϱRV58:}fDwŃ}ʿܚx5C?aW*/*}@y[2$Lwŗ%ibqG spc➋4Tp|UYMHk[}4i9ҋ29[t֌B MRI4rpZ9o,wAи(6cm1!#|^UeϦDjrFqи45uB8$ M]W24Lh[lu ,eݛ*I~ '? h-OB3Eܓd!)3v;\ׄ7K_͙ o}N0aiVAcLWS$$9NAطǺh> /o^W ex Ŕ`֝vsK>c8WϺOLD<˵]EZDLxJ9dm*l)wG5?XEu gAU9v>Snmop/ʈ5@oQZsz錹Tb?"U&I!,sseJKadpcWUg]rsMSS1eB8o.u[bkr<$tckWnCO+l2-GsHgv1l*;UaxY7 D6zd~ <t#q\VҁsS {ufĠu]/?z6qo-EuJ26ln0%g?E#< Dn$ϣvi'UѻK?y۸zWixϓk`RT," 2lDbC5$7E5g/$Nxye ^0-(7eFP>xsCO'LRZ8c~ jtwf krN_Gfvjܴ qcPe9ѧWРQ >be!kA{?5usL1ѽڝ-vBs GGQN9aq@NGDp@y01mh^I*{=< `LGqŌ\nq\>6 =6*-}|t1G<[Qb1.4;-}ifѯΧM|0nó_p~+D?%D zPvz߰l{&r j*ȁ~06sOk%y+iVOx}. BT<!rwj {,q>_QvK..]/ ~΍gKCHސ>lV}>,Q0LkZY_/&Ad3Rf};(v+[赉8mhbi;.=fg\5|Ru\3PI'4t%6(>bC1wJ FuQK'ު )'[IU(,MrJ^q4Dww:J9RQoiKqelg/Ox+.P1%p߈f%.]FbA/4cNV5!5u(IjEZq}Mz |_#٢NW9LMf#[I,{"jWxW,?NRN B_5\h)dNդUݹ5TUYZ5~ cJXQkhL uQ?S`&+Fjy4bͳɹ1:xҎ-y7D,"*Q9/OpZblXReBa.+U7cor^8~3T4 U{Tt "Ȋ |}i ;N'O<:jyiEH5 Zt|$APtVhאϢ5: !Ap]Lj-ֻ~(hok#5q fr;/,5ATtw5V!v-aRn[ ϊ8s }90r2!I>wrˤճd\{~tP  T`|FD3$XDH~אLPkWjɌV,Gi dm}Djx3+^ EP "@ af |/s$/6V"r.!2_*Z#[N 4;~"+]M_[n'~%Ycl"eპe=M0e|D;)l2ygxYԌhvq%s޴6 ȴCxNqB&leEs ES6yy0/H&zr|?Z;Ʒ7{˩*)! &νW|ޯ޾$Q3Sr38 ~%a$] fSȡ,P_e vGXYyIV/ +ӧ+yG,ٗiг 41=m*liViAuu)GȡE]>un>*# 4 vxhmWZhX,~( ]rqt|O-'ϩ }Dž.[] ȃ(-D"9c71!ӝr#>8~E7zBq5jf*a I_=s:֜SQ ZZ†no-\?r%@<7|Q%ysYrjhf_=I)i .xxt4a;'YԖo'K^Qc4ɸR 7RL67n4 ]g+$@LaME: GOl1rEԡ,{\T;\ܝЯ 85'^=zdV2)bƙQ4ٓݽEj#S==s'NF?8=YdUz`v$K6w9;0_"=5a Nh$%+?{06&ek}KU nrx{/-oƭ}mMrjQ>Wdo,IիMTUYHjVֺ(4 qkL ~qmD$MyctI#>hpl ߩ$&Bo3J!*R x;NV]y4d+FjGOvWMh=t>/\W^g(sA0l f)m1xN !pwi\J{`'?7C}]WF^jtJpO9+oJ1G0QYt*WwI5YQ͐j=/JtGZX7=|%K ϙ~e؊?gd*Az{@TTbӳGR"x;#A4ʩjG}ZN[nGݡi`a# ojPG7bxdF# [,p-! FȾZKm8Rz#RzDxFb;6M͌O> Yqn&yv0Pmr!W‡ӺXEa3c1,i>4ˌd \$ fhEEy> 4/"u l3C]fpؿvuA% D5㤙f ɗ^[Zp}gPwiLp-[Dk٪eF7uQ`ӝ%p[vTQTZ ˿(G֢EoGh7IdQ+Eƶ-Q27oBݜgX@ .G^jc) (_h*{ZrE7hu&pc@v@DծtĊhk"6:T+&I̎&%DJp[M2ԧsG;ey6ڿ,?E1!TbGMBW"8Eӯ"=kߙ!IDT|N2tɊ\5˻k] >J+WIV)%P`e3UFR _9*՞$qሪJ駔k@홤%QQa;l`VK/Wo^B,!E’٭Ff=:F8 =1R!ao%NGm3}qzӔRZof$/xDώdwX۲A|mղ'-|bL˽Z'GЖ=of5pzKk"3қFSѸ*4 ᷐J4+ڨ->Ghh# v_{݄.Cnq}0I }[-'E>> "*@2j_}]¾dhƷ}ɹ^Bk.#|d(l-b˸$:]|kaXeg5>N}@D oht4|I>K)I~}h[Dk2X5:$B|n\1=emYFأ%)%x@lYzK5 k} o ~\PpͨYP5u密Kvy3~+b/t V+P+>vj8H 소<̇ *#>yВl}v=}U9C4 8n}t8 s~Dr̷`;Wi(Eo[. 5`mVvE@A=@3a+nDE{)]`ʪ`BQUCnnUjνtD˰eòr[nDYqS"V~NvF.ۍ0Xa0g:=aU+\,B},Alr#S,fWE;a>]G9u;T*te+ҷ9b4j܀;uʑKZF0"":_w(ksW+k[\^=HCyӉC@Xy NpM2" [d}i YRzo$6};cE=G=ЅL+Җbyf)ODWL?e~=#jI;n2*y]hJ gd)UvoE{$d`VfzZ &D۵ƹ[ ̖!~k [<dN!mQq$?v~U=aEG)qyl!Dq .k7x065v*nY8vϕEqyLdݼSE ;y #'LwX!Z4CҝT갞FIbf]Ii|6n`ݪMf3uέM.A^r #Fiy젱 qy̆YbD|yh\nblRЅ5~TsdsׇЏ-w*ͪS Ӓ{9vYlۮ;? 6owæUurͷGkIi0J; ǃǃ/Ye=m/R!.XtSz.9Rz*駬!OOdrȽwHzkȾ//`jV|n43yHHytQ˹[j#H6qs #B [+ɲ-pHv2zstۮxWj0ᭀf@9@: o}(8 Qe-{}v}n:(D8n]}@nƤzpyow3V@8KJs%p|@d. hL10+',x֮pؼe)`H,}{XC%6uU;))Rΰ~-ދӗsB5"TEƢU֗J6k C2T'ЙC2A.%}#_hQޑY5D4Oyl0:;i)4G#Γ^D3č5d[1IąLU?DzMNޓN @y? jeC7nnDVM5񚦯w ػW d;Kj|Nwp]Qg'7f}1Ǯ[9j%'t=/'2vۏhA Ok;k%5f-~EV Or劘pUACl m鷻 %tbφsM*chqX_nzTj[1~~}rO|;Sou= ԫc7{Ohgݢ=0ʎqʃT4ldX;8%꿶_fb<ބ]_AOI9$Zy-b1sc<>,ɋ1HnU0/-d+dp\'L.S {ַ1i~-j+MDJf¶Y+? 0OaҢNu<[\gw"99Kr-aheJ*Z=_x'j~aOCz?S_;&&67Y ' q@9$t/ė-r#j"ߎ;%lFCdcUe.U/\ٵ9zVRths3r }&tA{0Q&4/xjgY ޽_""f_oF6baFkyO0Ry'7_mWu@,n>lrjOuD#LxŚ򀮇r`l1SJX@T(0Ugi᪺"!RbF1/=&tබw1Unq~燭!ȵ#dQ&alA)F:6En4R2zzK Iw#@Z mZmO=J9p7$HH< {,#WX !d6%k=sM 2X? ߘG*"w zrx1YGmۅ7kC/ n{DMq%[4h_k͒B^?y:,WAH3|>a%#:suw!jD}O'_]TQC) 5_ ``'xw@~Ʃc8S3|,:/E XbM^{[#&[ ww }ݯ OR-V-xF*4W+lb"U#S)3*X:ɢgƙh-5?w>#ڂ?gkyGĤM揰*hYoO57Z,IVyJY *24ߗKcfwЦPLG)v3+)Nyv/)-HPb3씜 Q˞r72W #!(v/E)G[ l Ba+6C%ɇ{LE Rf_փq͙BbJ4h e$esP!1r+DݿLZC ,C<Ԁ\ZT;m_u.QC8RX!n ̉k) e*֤DN,|h0Fr<1;#}n gSޑyEtDSE . }i;'gnhțHr 6. wwF8:s<^/ihs`Bd)Zi ֮!C>v j܋:i/Bsύq`iu,' d+:$yGHTT!bu{ׅd@$ݜc-@y` ĐM59fZeioAq55T]m\WG%y=鱊Ҕ ש$Ɓ}3Q 9_7X=ySh[}*߷}{M_Ǿcv6s$W \n\lӰtY=sĒ p䧛ݾֽuL+X`<J;L 2mq2Gn0rE\LMbL^ I"F@WNS /o'M7JI+w;|cHWĻvWk `&...y "ٯBB JJ~598;0tߺv}7P̵QqOw} aƚw bͼ@S[)toƊ LZC!dLgA7I 龵ӸHPh,ӯ?Hy'P94@VcJTߕޥ-X EH)xlX| 5\H= 5!H{|h.Viz3Vb78pcKJE)cL>gďh|pRt^}n#g9oz9ֆZ mwcؕc3ACjatipkBEϧCK9w$zu +bCf(*~G?AƆD~ UʷODc\j)ouyCiZ5~6j|c0vJ#Z#X(= j3O;T|6zՍC :tq1_ݿZ'"D=44.LJu Mic`Ϟ8y|=FH2,A2F3z{X}ۍ?՚`ލ:O }G0.C$trc1(x00F UY ,#a~J8*XfY*l+kh˝B:BS[/4?ul4]Qº .gBbߛV_J(yaGHڙcS>HiGB<ո+ە`)VwZ 'd0Or$&GxH8T1}4`@t{*LdZO$Ip>ˏ$eUH\KCEA`0ae3l|(tJ-4¬c-,_G (%)wx(ae pN[@RdșT&.1a3oҙZ^Tfl@_h x ܱ&;eNqztD+~naUoo!rp3]QS@+hM&yCX!lo0ŭ]멻(\eO5 <\3Yy9#-߽C=zZԍBfq~=AUnNO8/{X_uO&1e|p9VՌu'4Zx]I(Eq75IXS҉^;55!%\Jb d2MGٟڐ?b,%٪hd_0D)vQ;dMћ4f ٽEarpH^~~LnJHr$V0h;wn=K8* N_yw +\!8N#Hh, h"aXj#k i06?M8IBɞCVxCNI=YY_<9n]~/x+R4eQD"j{i6 Ke6nD֑aPE茱jnQeYpEo) (v'4:ވIFُűgA+suf䝈X%Kk Te\QИ骚 6|M+!>{hk֧Ƌ8G{. |mNMc,wԖ # A9=Sv`! [@{ x4UI[iL DI>b?GJ='G$zJxd rlDt~_'#Z`Ț*K2:l5P)! %O} e3!K!֨{Suu.Bqjw1# Z$ڞSTVN>T9>=)\FPaz}B{V;suXe %"%{f0rxE&_e48K*$%|r0b5j5$yyuRA,Se&b=K7[ppK8FaG*Csꘒ˰EOӇP]('Ni=h06R=d){Gv+Y41xlrڤ->P/Ŏy!k{#sŽwR"kˊJb]G;cUSƠeqҏVN<jzt^>sY|KaC7%aQ oQ|Aփ v1 {Q~{c KCnE+g@HYKSbGnPI&o|}tΧZ3M{AFYEkSʂؘ?.ԵLN~8e#=ܡ4 [ (͊`HOF۝颗{Gb )ui;AsسFH (q>iv6q6jqڥfHx*/8 5BJIؗ- (=9nnRݦ/;'bA3fLCV٥>=_EPDh f n{0~7څyH<I8>WE0> GǢ dsZV~N.Ih8YA"]qyaZ+߭ …G?<d3*B.0%vKԅ^Xkp֜b[$tequhrܢ8sX-*_M)N00j%R[Q¯ˮITɽXI'URŔ8$֖0R샸U_fGWco"#8כ ˯2ĠO S$/PWS\ÇD !~gEjM WqTИѣ|ϙ=9g|Ȏ!VS\@3 ]aX;-DȜv,Qԥ$)QhBl| :o0Al BoŰ4Қyӽ(x+n}Wl[KGLIu ɡ`[urQ6ҜW >$$Wj;Ʌ;5->} fYdIoGvk(l~I #B& 2ҧ:[2=̈́$xBի[;k>©ry@GxqRkrm_5%V in:')pűkvw^%Q& N)F)[Ȁ&YtQ> g䂟7G 2GD4sojϓ+xM=tA(j#q :DCF} pHl(v 'g@xr_LzKQ"Fe ),AwԷd8x@TVRW)xה VZFεQ~DeZ+ =ً~\d2"GewN%49wJo~V e%*3FwՈ4 I",|īe` e*ہ#dssGø@S[`9sVuP_W`چfNM@U/^NR4=UC{iKJWR G,0i;کۺ-f pZd+vXYgmq=.CLx3mKӆ_ Q>Wgyy$HZبՄ|o4- @lٔYNVqaj0Q~"=dOG %Sor*+M8)zd̹sՠM8 Ν!tGM~LOyqH\MP[<δDD \LrJ*u>Z1 ?j͎ L:'BRCneUuQh Hz h[X.g00` n Lu16NPO:6\Bo(Z5II[%9b.mL&吃 E 3peۋ_ywVX^/0'DzjR2Nm MG"%S%^3 (JVcH5;pzن^eίyFʞB̜ǣx.⒧x!?)SX_5Ԛ!BBm/'U̽[ svt&/_u,OrRmRmvn`TԖ\+ hf_hAA'~ ZRb3frKt:cJ'ߠ~ 3fn+󖹫 p__etY2Q sSZ{"ⵑ>ܓ#4lWh%.aYc=vI}l0KѴƝ*>83C33 x wJMY.KBiv4 4ᚹ-ty,u#.Hj15DUĠ8}R+Qb8rM'U'pZݨ}KzAz<@ja^:1dF%朶 hA(v%s;kYOYbdmYslYcow\&h0T@:*dUL0/۹&S/%EֲqC;}`3ms"A5 hg}'I$k#&@ۼ~rZ0@c aѹa+4^wPլXkΕa8ހvkyvF[:V=~\ketO!?xED>H-ϜR-81%$UD=_oZ%}̼[ɬSEpr14؂xn5]FTO* R[[m. 鏆Q9xu=܍OAgGHd2s];Yxto_w!NMMy7.?zdQ|Mz.Q|l}mh)8{5GY)FۑHD_e۔tGҤ  n*>MT\W$Li_snIC;ԥ [*E{#;I! Bi9ԟ`F4;rr7Yr1 }jYӘUYlVn!?QJwUԇIq o.hRx%eysdu9yá`k89u*ĮPt 7*7v-s!y-hktc3_:2=c:NdtFK^b ú'3fSZ>=.R_r w}4w\(ZOp-L~I+M`aQHihsƪ|*IIPove%&,5o@KȟSSfF3fr6x|BkuU (F=j[s?e\5`wρҙ7<qy7Rx֔Io]Od &'kc KLc.v{ nmLyd ha(Pj%3s@z K!)6Oّo[P,rzBxe.|$Mq[Di L2"KÎtLs]⿝eG;c_ N),NZgmގ?",hTH#v Dr" ݃ { bRO]H.y;iV9ȥ/_Yi*#rPTCW7'q3Jٝ U:NN\3v0w\V:|O?mq=t ?KUPʷ;ĵwq}JX_lmax'$x͆\t~4P$V())Kosm60MU;Y>n\}5Ϯ̵Yܲ'DZ[N3$xyWnm*(D\ ˑo"qLdfؔaZhN`OCygOe_r'֩WFEs6AVX•ֺ}bPpdR{򱡍jŞ2P<*wƇd4}b?Sa1h`% z1dοN:L>PJ."@58&ϼ27N;X)+}|[57"wO?"( ?r +zpa6-z]4a}9PI,'_yAR#331ʊD|.fIʖu3WeVߋ1سNDYhe ۿrKQ̞x6XX[)oba G)vL!|KAM5ߊaNrgDq챨t<%M9{^ T1`UC}S+8O㥞fhdC?/+rsWQlOu]Qd/5aMS=-B5n!=" AZEN.PԤ`}>?,[ *iYLjQ@W!:(?cs!Kijod%{"yX0W؍%vb2yh:[)Fp0r]բOcnRg5 NW5u)Ѭ\Ù Ô$JY 7R Ty4e>aBD/Bq*m;څJ owsWΛ*@4ԱZG,$4 +Wc dW&r -kɡ׃42Y]t&ggK 4K/Ȕ[[&!HhGgxjn]k[113$yI6M3%i*~LnRPˠ>*aL'jMF. { ulPp6-e< %3HiL5h<l|zPE3Σ5wkӻFZ!n $;;xZEq޾ Da=X/d(/@ێT,RD7"{{Cѐy$p`p!3f"|=iDE*̉-ϥJ}v.-İLH5Ou) 3⍩]ee@ς/8򽨰F,1:AĘBG'J^Ed1.jˠ6k!j\Z!%xC_&3| @(8}5_GK$~[csnzh㮎{呙iI+ll bWq8:Δv{Ϡ.,`^x.BhjĦ-dZw !ǘ$yx.bB-[J8|AO"ΔI)Y m!@zK^IoKlX%p@9\l_#%(䉳i4/! :T4* s5@.@|qbNy %יDB|zi>t abPer>2Xg3+d?ED(OyyضQct&\⟖NMS:zKǍ o_3~*F' ʤB,⇝7|1[i-ࢧyv,U[ź2bWePy)U_I# T?%/:T06بM@3#gvH_|zjb%7hW/`7 o ?!F=6V!I3, (INUr용1Z_QJǃt9Or+a&osEu`uJPλC-0{#PCx _tv6 ^|Q  TvP!LLsȃrc+nkC h]w?^yp" G pt4 )Z*B!/R{y| -U"ElQ+j}]"Ơ-2WA(dE_p 1NK@{ 9#\2l^V|#۪7m!h=ծ]?F5pj$u^hQ0f;tD(h0|j /lloFPw|LFbJۧlJ~{T;1\3FpӲ\n5Do~t"=ˋ a`ֆlʎƶ]]EkDy|ǃ}>JT27lDr huw1u6en?*IU6`Khh5? k+\Թ!'!?r.vןPx $y0q.^)G(wȩu 񔜠 3{]3wE\_dE1=&Z㪆~Lp%H@%+&q f5KAɵidV&FR_8[=hf&C2qRt M&GN&FIܻo^~8[pAir|Ey"R 8+FY _<)"?H 1%C/H~Ѹ 85ɬ8 (_+ݠQJ^o[?ܧ#KOٽ}hh$Y>RkA- wa6r-NXM; ϻ|C| RSژHzU@#} .n۟zx͍J5Mj^O72P:2N hRSJ2 d,!쵛׾ -UG7U&F݋2Ch=*ꕿ._wFT7.-.[ăhT--+L_G.JYZo}wiۊSIn 32cb6e'1 d``Kz-NQNOvg[E1NjqS%! ˌ%(6G\{s;秼C/|2YnBc̊&j[ qbP*l7= uyKS!E)Bwdg y8 o%Z5-T#3GH>p1KJ-'$:9#PR/W2sm 4` 2-uX> 8G'Vudst6TVFUEaYd`lTO{92'bv$@B/ﭩO֑!#V4TJ ]BSSzv_YpaD eFg'3}&\ȯc9$ox>aIY5JQ&j3<5j#o(]9\Ŀ`āuG[$ α)>i@~._2;]Fo[%hӅdc%cGJ +Tf>H gc$ۢ+<,u1JQ?bowmDn: *5{mAja2rBw-/V܅u½$rZTpL\o/k'_ MU1ӨtϨNpRe Yݽt aG@e } 6J_:SՓ|rK?ZFD7NP{&ѡlxb0 'Rׅ'W1z=>]^< hWKr<9RP$x-gr἖Hkޓ-܄2,gb4a袒br49yRWp+-U4g%5qq&ƶ fMl 5'x ( Kec_yGY0rx;35>wxz *i^NF(d!`97GVѩ|H(lo̖^ѣA=幚$d{=#}KQz$!s8MTi D8\ *t3_6ɜ;uY޺ <,P3_Gyk?;F.eݗZ*﶑MoMY!A#7п LA_q)ߩ+xi 2ڜ@y٠X<&t'$M(W l=ljHu|Hhrdj-v7@DA%(cb3D͜Y 17u/ka37gaKu(NYv(`ȡnaIA ɯ=Y4šH gǻgȰ[;OZޣKDnt4~97$AƲuȄ$ɋm̧Ow9oLj&t*ےOIsf8]4vkV" #"BpKM*65jڀh\Ꜫg8yjs2#cn=^11mW6(vUEjb0S 7\SV͛@$^ C[|GXȆ7w Ufĝftq3lG42kw&ܰWA)9ԧ9>A:*ϓRwL4y%01{`2Dzf7fkwZᒢf B.;^9gTh?\]R '6 `{κRV౱)FD T>jMFzA"NyJfCzTXۜEm_9;.`Y#jTf (pSKcTϦ4#d> 5غ\-#Rc(WEY(L\zgMކPz'mꊏ;7$IH~v}&D}%5&O"urYD_ƀJJ(|ēW&Ϣ<7S*+ ~#F{|#vŲ&H{ DeHR}}R2==tR X%\RC=-TݾxRa\ö Eac˩g'MQWmp q?Ez̳ ^i5Z XMHUlY1cXӸHwI(`X~os'goYԠˮ?WsW6вe_ƎF$ҿRGi$ h}؈ʻ&ˮsq&kX]0iYeUӅ={؛4cw5v2w-G,!'0Q+.85Yg jB 8wLYE`g뷶Wϑ`l f܈]W'il(&+܆nGeĨva% z-ٟ!&}JuM3/!ۿ_Z?ԝ{:dBi>'bs 4V9?1bp$R. m41 @ PG H"(~`ZہhoMlV8N3a$AJ廊-&^@1/㈪2:}(BZ> wͼ^}ڑ/Fei'&]}`OF>* Ǘ280؎hَSܩsscfQfmC&`@ h w]R}Fۍn6s'L?DLA$:e^fW{-\Awɚ%D>Soxͭ*+ n.NpuV{ /8wU?.^K<<`R, sR6aN0<1ϑ}AKf u)u--5/(WߖijȋAtZfI4`¹x!>no:(JL~ޔAVtMS$4Y{ȋǑ T2.6rifEԚ){m4_L[ȧUzm(~+FTѪ·xX/~ dXbՠi*ܑc+o[qwnkf9ws,7&;9HʻT[5J&J6DHR ʴd9TT7;4 n*({}ucٓM!&~^;cT3Mǧlp&^ӣ2}PI1תc+VOBODF|4=5/h;@Yl9&mNi8_ <VEc%|h>2*)+ت u)~n:.|(p:[2}s-־gY;%Um(̉%wpiłPU/[g컺r&6nnp/O}Oă0X'l sS#7IFL U>sޒ{[#ݍ tkѫya>ژ3L]B) 8G;}T8I̾-"Ð0NH[ v:3 dlW(nd#4DTCUjpl`{爘nM5aJ?~@27er/`┢̾@, |oWt$xNA9tYh̪i[#T.DBAb;"QLlT f4 I ޜXR'ͺhyeʆE6ى{qNX0p"C<֙!a'SoyM,bJC%PO& (v > F֝6Tulm 8y"y^.=9eP+>A[̵CCx/M8<-طR,}5׼{*LEx׺7"٫uB.ޏe D>pg 6 QȡߠtIq҄VOm d QnQКnǕ<Y@nhb@odPj"u(I=^b׵UtU5v>4lz3gQjM;:KG3\ cUX!xpI7`W5ݢVJ $ZpSϺ 3#_ pPrT4}eE5^5{ }).EtJ;Hjqs(뇒s 5~T1`*lm{g&p܏ =.MO  H[mc # 2pM ZfJIiOkgZMq\ ѭȿK߃j:Zh*X@mCRmKVXdCw:a奱'pnjq;+ÉвfVsQ71 ɇ qHlOf0~^ykațM #j} ܡz"wkO[¯[ŊN`f?a"Uh kv1UߘN?u+^I߹q y9P {Sm[ 4s 9/Rn6MSqvѥ/R8 :~8Tg`ˇ>#8rܨ8eHdPDq/|~|m:.PFMj+ĵ  s_P-bӔ&!;K^]wG.uډ IfL/W~m\_]U_n`JSⲹRq 0@I*@>5Ec){;*_bKHᡪY:JHw%t6Qn<0Qv)\Q_:g>qm@-*+t\"ak\UAʹy/lA0>&DoB|dg$_|-mo;q}3:~Evgpu0'^Ց{)"L^i-f!+?ea!WROr;B@Rsk ;%NZ?钇Yi99IM|#ԗTYj7:W΁w kg⡇lpP\9.:kulƈ0.\ͭ '5Y] js)]1T V ')puBa% -D/[KKŌ2Zg22Yfpw+ P*]ZON]pkK/dB[8ay Xm8%hgq\ЪLXk P٪^۱N-K4!'v@n/siϪ+\]a!mdbڝa\|b^}!| tMd?>mҀXj!L?hW^E+M) jk. <=Nˍ^(bu󋬦l ;D[~m:ߎTÎ:|yow#ٱ?Vaٷ>l~5b;ø زI<8 4fL.Vϑ{4*_Yb\r$֙&fx~miz'4g!U&<Wφ|P,)WkMSx9aMoRd5>Y`TlKg.Q(_a6Â2H2yP.q!!iDsr PT&&ޢ`ժiAqxCӟ e&ˆK(b/JێH/yF66wQ?(^ ZmuwƎS| m\{ҥ kv;gڎj& Ϳ+F[ ֧T4~B~<.̌Amb®:^5F eDJ"ohWP d r+!pg흎Olrk=r~rVd'v"gNtzZx6Ꚇ&\~յDNXv])ɧS':U ׿a>~hYSѶSC.0 2imvD#U"5wچ B ay91\"| vPqM~@NCS(1׼nEioF!J1/L:X; ޘ£qZf p҈M0T[0q\LG[pQޙg5m0/s_Hٮ"ꅀr '^-8k~x-A6ɐw"K a-pZvqi')9RȜysӿXn&5R8 dXzO:rh0WR.7l0^f"6M"'3kQZNmi0x=44T-ޱ$7\ zzwdLyHMp?Bd*Fw`9ZH"uT`FO0ϸlm&Mש;OҸH֋f~ddߥ:#=|KjЍ)ϤW3s^A} ;E2a#&cF$xRtG[ .1CPCZAaFuD$3]d11$&F؄0oDMJ6=Nʫ$zKB@fkǟaRF-=Exa"iEm֪8X̰C/?) `HR &,57}b:]atmw[Ɵ(;cGD't蚾w d .?zA"V6&W7TEE64Z$U^ŭF%M۲{n ŏ,R+UgLjq/ KdޥZ6P;\)rZ@]Ol'ڠQ%-k`-hM7?&sf a*&nvLu=}LR +3K9%]\8H/L!U^W-b{TB e uFP%񆓮+rXS۔T*yv@.laLCSI*I,>Td"IX/'z~ Z)>{ EZ;u/k|ʓ <3`Jʣ*^DY5o-=EH'-p9!5L|oew\KM~t =(u! GIW "4hy*w7zY=/Jx"I@cxG N|Z/ɐt?a2[yya)AA{v{lDQX#J1e9O*nm,j#\YA]*:γ?#?7a@֦PaOa(˫p>s#騝:(2 (dj2g#e;:H(LWÙ0 Y't4,\F[瓮bQ0V|AvnkݛU5OXu^O8_M AMQR$ɔ'r_<(#T\=l9n#- EUYk+z#|JWVՏXa9o X|6Zp\=NPEIi+RwQɩgEyj9 b 3/5*vE `6p%Ѿ~Wruk=Ʋ `rRoD%\ԋwᒂ9^m)N%vJk(a{RD/j\uBpLmAIcڶ mpJQ ok@%c@R,e(GȺ`gy.NP&vk[<KwzF᫳ qyDjh8Yц>MmŚhH6oיlK{a+jO|`;F6a9abܝD=ZH-n?tj(0A8"\"by_xFN B&T 9QwHZ۞hDMѱGM~$SH;?b2oh(TWٽQ -};aqM&~ ITvɠ){ ︹n[pdR䊋 Wpy_:knQR%ىEʿdD<73fF=P(ϨDorḼê=r)igsq4Q!I6FM歲o䊊\ӯ:%T0fxQ`7'8QR(cMYbRr2(` fLydd?a,z.jWZ$(VKwZ9f¨w6߆";淾 F 5Ԓ*iϦ_^ySg~B60_ؙƌ"ٔx}MiH_a5ˉ&s#HHwpJw6#dHjٲ C<]2o(J? T";Ϥ yKvU1z{DyFcl:?s+sB̈S>=}`Pu:O=T/z+>uޓIDFS,|~R-^U9ιn8d^ E+8( V*=0Kc\9{1&d:[P@ޖ8yѕjfQٹ#qۍȎxS2"~#^sπ";I?jhgdvU,G*Re2-!> ?m:W=; YO.c|Y>]":bmf=!Lz[} k1^^'㟇oTKƄE @ooĎ@wN5+IDq}=R;*1 +xH z@qfφa,O6sH:[r p@]ֵ TP>[rJ? ʍ n@/[KKġ0?>]1yݧߚmWZSHRjy襒3U"I ?1\O>?+&C9˵%Zo{HwW]Ww*Ea5M!l Ԟ|:Cл<(50Ҷ^M9P! aO"y#9N@^5qE~M> .  9^)|Qy M ˦+[HlA'Y [,ٽ,NΟ9.E8'grVi Ly#Iq1]!(PBОIKFe"R# ѪXF0Bp6)"=EDԑW=CfaUC0LY{w~ƥPO|9 >-fcIcX4sMU!yӱ~*Ge@׼}1%_G:  = 'tC}TfbT[*[zޤX3嬠pQ/H=MW3Ob|*uF/7tW8|N,? j,x* Ƙ^EfEh FAF*h&ʪor*~wc6rNHiEP#8D)J9aٳc:SXˌ|>uydZ!y@_8 3! eal3 U1rk55)kP kxD?b@h$8>&-RX =U3$B{vl[ʟl9j.1A#}BRGKHzn731 Oma:KDBT z뗿xMO3),ZXhB\"6.`לP'F%g6J~l%^0ͮ3m(kS̜Vc=qt[V"x~\YErF8S|RHsT.?i*z:cE|+o 3~8D8 N=N_K[*a(')՗-(4ĸz'^4wjc+GHϮ/R)A3nG0^zxܤџ2Ma^q~"C:F/5hHz8UWxrc]F,XYM9f~NhGQtzk}ΏOLœtb_}s"քE[\fl3 ntUۧYaDoq`w+vR|yZLP"f' Lxi<=*MZ\s7|j`T3AݪڷyF! }Th. -;|cY~xr`=D5P.(CGp7Mi'X0*MݵѳS<.H gΘC=#zLz⪩qs{ w%q贜%j$Qhw}d@H6HG[{KBzBIOk}6LZHi)e2)B' Q\3ϿZ /.! 8jdn0}\j ,ymKT1P6e旕кn$`eu Pș L)/P-à }wdCPC֟GgjY†FIk5m:̠QxK`y;rUIV.f5.,/=b2xt, 0m`UV2Dɠ=B]{u1BoAn(fL K]"a㶝SGt7zJs6d֍K@ ǿJ7-$5dFȅCppD_zkčcfԂ5|,DZUj;>߼ O8Z^`qCzH^C&㬀Oe[pPM}Н4k}kBc8by)lIWB}i8,,O$wJ!O 1l|$3/WoJ /kk|ij퐹W{$H⠼cq ϑ.%˻'Mlkſ<&7L2 |g76 "?輐TF&K -ˣeS|s_}`É32,ʠ(|ۏ;I4cv. _`p&\b놶Pgbi\*{wَoʣBg{R7R찗x0b*k}K\op(ݬ琩db@SX^v*&Q?qX+X惗XY?`ȯWyV[\,(|./iui.2z1؃eH,_ ~)]."NV8;i]dQɋL]Fhg?j,dvzwB`!-XZpuZYWPςEL" %tedoV$EV@XJZS!j@̑ዚQŻingW#DFYn$Z|p*s4x/ bcv;M/%CyE/3!9Ӱ@SKJJ|҂4HLPR\7U{h+4B)]U#RxPKiV)7m2 qiyuK] +EZQG0a nh3(GZ23M3 da zGOQf t\AJj7'I"3pi ǘAs49<_݋N@H4]W'JT9KrH >h~B mxR6R;s1ӍGGc4mâ" /q~>D3ť}M; :}LP~6j)!%0!k\}IҟeMڑMۇcf-2У K</; ]h+alꏸw]Vq4AùD 2#O<.p\?$pLPF9Ƿ@(8kVŠ%5'Fd^v&|Lm \XCc ifcw`zSDm݉Q}66oywMzSQNźPxIW&UJ$.,Zg(Xp2&=pTE֫{(rq?|GJ:aѹeaie喓: ]0/^ӇUJang PAܑXyyd뺓m|=5< ]^^N&j)%3DYg0y cb}1 %4rlxzZƭ*A;a"CEUcq;(,M=7k $N`h<3X cR=΀`$nj*3#lT qX3VyXd8I> 7]^(ːn]vV؎X>e *n3-mbuX86] J87olYÍI QZHF%Weo&0i8تԀa(Ey0O:,:bpQӿv0-KsZ+<5Ix<n@KDk⪀hPYQ]Wݕ$QKݘ䷶y6X:uCmkl`"'I}J(H&ǀ5iLJ>y+zɣ^.vtc'c5@3d($XWL?/*4ݷ85Ɩ+0mCZSdLF^_{ExZ &EKW̵i{\! ȹ^vs%}@z$8?q6PuU8۔.7,Dq ƙ0F1G4tƘZߞcX5R`EHH<:s^XJ N) !oBsFa9."T{I7U`3FO: +ًL;3Y͈VΒT9@yGThwC\|/؈$+4̈́juq<=ڤK;Ywt:^SY0zg*UG9ۅSSMkbs<ϸG 2¬;wJ DQbK稜VkĶ6鷢]w"w5X9Yg[4=efq+A<šB8H|>XDBVFUrd+V-h$r1$Ipi>B4}˼Il+kwnGbL4W$X8NJ`Dt3y]3-V˝=-3(н5= 3znDpBK~{b6f,/_8 ;*S`dX\xyNl@ FWqHY~5j|Ȼ^y+ۍ츬*`D3-xF()B;108?ÏYzLjO\HJpG-{;bԟ$n!cX*wNO %^{b6M+fM@^j;V+2]bx5aHavbō@)][@nK7f|j,Qlp ~/}6p5r!&D}c࣭bCu,W[tu4g- wNSUz#HC:$ AW]u"sLR'ν`Z ]"e .޻͊6DAҝ>͝AEr?nPw6/?:bg^J4p Wt7X0.5ܛT!}%K4M5Axku {YY9.u3!e&󱀒Ɏ_OYҵOUIuGL6A#\ݠLjdn!ٌ(:$RZ+>&|xs|#:sft*ia3UQdFW+ѽ3jaEIBr=W"ڕz蝝RӐ DWPm6lI8TS"pOin3uYJ$R 9 =1"2Z} H6 ģmO8W{;Sؔ˽|.i=zΟmX>@77GG.rH̓NP&ɂ45҇`/깅פLza?OHAvȈR݀YSUL3Ui5NIV(Xݕ㌏c="9yQw~8p9jǾ_`) .hxs]S2* kڕmlmE=Uy_xP64,]Y4qHtPGg}壴бd&7d ,N[%eJ`PъR51Φ0xIʟa O.g5cY|l&D"Bfo4T$6%ɆI>r̙ч<-8>c q^iBY߀cE 6C~] jCxƵ[k]8Y @_dv<ofYZnC6JOT @tqXuR:0kKw1[uiAji K \tJ'.YA 3k dNbDLABBY1Pۢ/P tKpg3q-×&A= YGnD@.BIw8V5Ssr×Q*,\&iM.QZa2r9$cj\3G}\Z>EJ;q!KNѸh2;j"CD n `q+ 3_cO,9cE^IO p짶YZ}.R$)߉V@]OI)swʳѝӌ1Q c:gIW8.-ò{d4WDa&&AG#\W_ɋ*RPVx{wBr)NH{dQ VK$D&1Bj;3P;^?T:r`<Ćt{\ެu.iXL4;SR-9I,h.Jϔwv`bhT\2ny k ̒r$+S>jie7ZFB:Pj'uO` <Y鲐%(>}^w}4mr&*YF(&C:<1ۗ ) ts>3[uXr1Zß_qF\ O˟!dExEL`IlW*e1i!n1 [ē#MXT1N_UX2WcihUm\XF0qw[=xWS+&`@ Ώg ϥ`)ePf;gmc)NvmxW%h HoǔY>uZӟS?7+9;l\츱< ~4:ЭDʽcsX,S+ɭ6[?Iz'SL~kx/1JZnJ0.foO܂,é4$ew7`9IOŕ9K$|a2o,kեfO+mhΜʟ,|Qh\kUض"($!=CFap(ė2A?i="` bޗ%OWu\՜k z!3Tq;$ AOwG@pSnsF}9KڿfQ16.wGv}Gv4j9-jbQ²(xWLXpvC--/ĹT?^ +S/Xz4zw!㞋rD8L Sk9z!APc=qG8v`eSW\շ(7`̓mNur'xd#0*Ȁ#s,D_p*1G)CI$l&s c׸!>ʘ . ^pKuwT* Lf|3yUpj;Jӿ4vL牦QybzKSi-3=ޭy'WR=br=k?KN׎'1'X /"?{d+Z@a:_=@1A {&6 uJe檉)yJk}woV-gږcnT^(d03f\;0{u_@ - qė׹ZӾ cIPL_H A~oB-`X0UIRfۦ]Xz/W&/Дu/rF&xIDlT@plC0:jK6<Y=6{)'1EI)OU]-H)D8! ($35ƗQxuǨx~}CpůO}ٳ7IgP>`݊s;*.) 7(lG6:<_4ٌ]v O5PZI d\=Z)+a8>x'/7h"[p~CuI»)kUVѥ,$Po9Ho +kU GW 4.UB}63$/Qd~5ο(zGd!Urfb"{QDŏJ+ Οr-O߄xV6,"W83-++Юs9V"DU=t f/)O QĂt"{Ap|h7Zt//0ei鞃 $Ge4[N olV!J171A O)HuKDK# IݯٞZ{xZUĻ=-Us .yo!c,^l iS#;՜y'慎i#nY0E0 %ĖԟUd4D}'.ž>, ^\䙐D)Jּ$WDZplNKMzrͫ\q3ʱq\_W[Ur#"'W dI?Ս!Jz:>_ v,tTK ,d]،sĘyZ ԭ @@(!l5-$-vl ־sMN j, I^P~1)fڍNRq;}XҎ}^Xm 8S%FL#<X6սx_ke?n;Ew4 Rmo\'щ+3B8uW]Xf%W+cC,-t]ٓ}\D0(7Ow[h_p`'ZXt>55Jy߼R RXH|\`1.}Rg@dj(.(e2j R*,REa&@(viMڞ}q'u`ot8HnzRXǦcIEdȪW8?5$hTV]R°Lnz\ʧ GcW50>ۨ=CSZ$kd1Bd70A W{Iu?,6H2݌Rm0՝Ga  {#;UWT% T-ʪL3 IJlq)T}T ͹ aw:KaWyi5^ (RnKTEp*pĖS\cu*ivh[z 0;Y.oh&YvK3 ?!atXb4?Q7dmn Gf zݘժ%}+D&-t{VQBe_kd6d0w"U(2Rl|\ orzlA7ԂA.+4Ļ@o4ۮFd1 0)A^9E&Ջ? /U5ԶBR @3׏lDRxsh(ʟ<06ŽLj0q j>ݯOr^ffO~7tD=M.YƥBBF>Q8!iH^O''PcT*mPI2) >n v[\VoPf4ᜬ/Dx*ߊ5aD;Cq]cj g5Ω04QZ>R)^ƳSwdYUiEx׋Q-Yk-o+M54OכhTav|fX& aa)/S VlhG5<~/ £`675g3aoclR젹%pfyE^2?͎E*}1>~8M_oRSX:Dx$jϦ =ΆMQ˾cm/]fFUo|4x{He0&:ϢM$ ֜ 9bpaF?@TC.lA FbZAk܋rs̲ 9_KP.*R<܀Z^'azxr9 0aD^’38?D'"U=N[( xr S}S3}&zgh_eK13=;.h%P V ČxtiHY+MrB]q2}P4A?8NreR?<0!iGk5O=uhĬ]`kp,K5B2xX(^7p<^aeWwCBZe>GJW`MNpn 1Ft~<w^\vDsȚ͡žM*{1ղʚVZj,?Й?tOyk/D-P5N"iN۝-ޔaơEi:ر'bYZ l:' <]`HbI'Tm6P"ߡ8iddձCip`o]U.X{82%wԐcIk|t*+!>yU"(#mCFnw|=Ɂ<W2 H]z%lu%<Β6R4Ơ Z7Ԇ֝xN{ɳ2?Oۼmҷj2lsίKlBnc&s [SUZ#l:]TUGn=jEb=֎*H][:LgЫBޱ(0gr ,w9d*lsSYfΜfpY 4}Z{U+&+q2`;UcF5A. =E.E%EIs/`lgKXvtjuKr<2BK GWn݉xAh*Uz*]o aS!a{qmsA0O<`ΚcѢ!RHGt3]frR9u|hCH{tE8;Px{IQ^AhCݚH̳\;_`?T7ΨdĚ,̈́QYT5g/C!6Zy#zf8ދM͋M#U|a70f nxjÎ?wܹǽmp};jVr!XDmZbO$"'ۆ]ufBx19M/J9 ynjY6ئalֱ L/\WzUjQFj(6dܭfѷpj{yC  CϼzAb9{"adYض8JoaFȑ}3+̾6 C)/ Pr0I^:N+ L[>0cO h$Z9}uu+ųz;\=xsq˶\ n ([U5~V/a-Sx# 6 fܣTF. _%~>1O[$i*ʐ%F?z}@lo`>o7=/E6!ijP\Vs&eE2,ZjI: ;}n*}{3]PM@X/dFV{1P)Y2bM)LDytr(Wf,L|ʀ q_X]' >>\-8XhOdeLb;U-dV[](2SN{11ffB)V*?{W"VViؓnt%4M_ >$j CUO1+(4j6SxBB<ܱ`v _C0O/4j|B/GtQC+ZGbAK}QށbR-x]ȸLrt_2E`e"p鲫wu2~_;42'^kHi9,β)$ۑ$(`%N_/ x5(@^nT|@2uc{o'W t9e$1gUm㘁-ҝaXGweV QF|IyN݊AO9<̰D,Ŏ!ϔ4`(ཱི,sO'[Ԁ7C9E눳}vrѳ=r\؛3j*wߚub<_}{ig(@DTU sWюp65C C@OH<[{xLebuP,T Sa硫C.)A,]}ertnæўÞ蜼3RpL[qq=ٿt#iiVl> {0'"?7wf3㓼~<7842e̿nrp^1/}9U>H::~9R [%-*M0רF-8S)~6aqm&||\dFJ/W36ˉ= +?IOVHAң Eg6X,P|RtH__;̮Rх]==ޔL'Ki\udc[^UWg|qSE;sVs_Nu%"7x@wu[m*U4UG%V.Pq>+߈:qM]J;{B ,Z^N%f H滆n.g&q͝pgit^>zҁ^tȦͧ_GF-n]z * qKy6 ~ ~u T z{|xOX7d;OwIM. ƹӧv.NO tCƦJvƞb4He}_G>;f%G)dħk2|ʞڱ%jJ3>(H/Jz(2gSDU, Lg_ܣ3DCwIŨ,-]P~5*7}N3rm֨<\HŜ2HYfgA(< _}.k" csJԼr._E(#}ocNTd3!b  q0m\W#0Bĉrd>njg*t$t!y?і7}qW{/5 !#`qG؏+~C㳝|ޞU|``8q$g2y Nt)DXV& j._ʌ ?Q al ŒټLH^VKQ,kДs%8~wVS0$yGbߎtld5U6}TGIBLI_`qsF)pf!{1Bi v.eN}gd-ޞ0Q B|ӛK2H uH9̂c_m`f|$cVSeSFgwf(Ӆ3^‰Դ({d"cIi>ZCXXlU馁:3rʜU\ 6 %oN4,@}Ha1S~^Y&s5d*.![H⒳ ݍ} ʠ:R[ OIJun7 ccHBGit& P $'2v@)i?$a6u=yoTjJ%IQ7EF R~MjHRn#;(ѰGats%=7,030(W2<֕k ٪Ϭ+{~۱]\¬afow:QE2RKQwKθ+3ϝi \)|CFn ~P/!-^jӢJq۷+`O*(?*)L(,g:y右PcDTĭ2q (J2hKV&gP0D 9IB<_pT+9"NPr꽱&goܬԘg{uM(DbPPQ#wNǧD.S5dI?PtbxD3Ɯh3\$a'&- 7C+G4SW67+非b{OY6w;@`̀1O4Zjʤ6.Kz46u1B N= 콜fG:sĎrUXO͇bғAt%9E||I6{cAͰjaWu1ճ3P 4]aaħnKu:<C5>p;xvEVoX' usIŞ'iwV)MNZw"OAzX!{a=ͽ ۆQGUggYSw:р{% ěJygy?q8{'1v13(?7Y_Z&e-O'&r y&۳o҆/<ӌH|U 6g"<]l-ZTCvfK?z,u‹-}AOV>GM (q񒥒7#h׆O|A䮈m˫+Ȫ{ÿUQy7̢}Jg &nG&H %[m>if>t+Uplm"Sh(1`$m<=h)7i{E2mX9ou,D,~l&o15 G(;k](!%6_h#W>PЯ*v]e_jM78=;nԑ[_HTĞI[,xD]+Ux887|(ظ {mM 3Ji.f)k@~fNdder\ KDg'(\0PI/ MNXxIlI-߷23/Z!BXKAXLF+ޘ.ˏfc<y(tk"m={] nE yFyw:fJE- c쯼q(?#ӋX\3SA;djT#N{2* 9iipòhYyϝ< !H@F+=U*AG'FVZ_Iе9AӒƬaG1@zyXsC~w=|z9*|ϰ|mue#UE'ޭinWQTYga/OfՔuD2hIk#=u{Ĝ cWmTIl Ŀ^Ok!{&bs;_Aֲ`ODn;5ʮDm ^#bSy7 j"|-Ny䵑=_0Qx[+xQ njf'BlAB☵iSUB*Fe#(R&69u_2N$%h;^v$}Q:tMDF#s`#{< Ic%g \$&^Ƹ?ɠ.nqX}gI~/)RRZ C#<- Ay\٘/ – j^uiAMu jUL1HzFnr;ʍE TncMpMg}V+Xh;FN_$89-E(wx$W)Q^TvWe HY؊s^]JcDy2cXPc5lu[ͷ7D?o#ă_ ڹ!E~ØM3b: XUQ)ٟC2xn M8]: 5u;#2zd iv ˡnUQ-j,`Tu#0gܦ_}-\J}*'iV&ߐwS ?jq2E@T=$ &45kB# ݨ UYVz+"FBsu1' nV}fy^:/v8Qp kA]*[֧q1u]G̡eˡD`v9;wkxTB9z\.[!kq;,J{5Rxy֞VɺsW[^ yD }.8uvHn)lŭ]=uu?+Ӆm`3}?Ay*<~p5 ۸iLEXK㹛,Hҩ7) kbCE.[P~jҀH9iS{DWF+͉B_v˸+BY^Ѻ`#.I(J|8%r_"ݨ);A1rd~tOt)gDA~fVߓO"Hh҃NQA{iʾq%d!KM!,|aE5d|`>v#4#(;-aUW{r֤&οm<>rO#RsIٷR\N+Vc)r,P%Bw'w&I7XVF~:2"!]X1@Ҏ xv WqMѵo5 Ūؼ&8 dK '{gJ]HZ -I 4B҄_lu$ dzr#ܥeJAW|@Џ9cFm]y]"l=(FE=lBeYw9g7ߞ@wtݔ2~і6-?јMܻ#thw [Hģa_'(*f=ͺF-WY{%pEQ(x?G&5 rՄS𥗚ΏDcӍTAsoW$]$HS:ub .;aX՜ȼGQMp l"IQ],r7VM]cǑt_uvzEq ,uTzf75xU?ܣcl` 1=%09Gyݮ2W $EUv0Ks<4̆nMQq7엤Y.%˥! ՙKE;^|('K@bn99cM3Q|羬/r ˥P$eFP t;iN|G-cU Vvc邸 moh/T6DCJZ!:t䜰VWY|ֳMOTǻ }-л%(>prڀ?q4 XM\= WCB/`KcN%Egg eNb4-kCJJ'd"OB10 e7=L`4GX>ma$g}!\]ʲz*R,H$9s#>[G6MJB P`>YA vٖkyX#@q (~*K|i2#&Ue"~ga,m۞)nE\Y_~{$ؗcҴͦBoMS@nKmxaa8ƒP=%Aw_!Ъ!yRnMHѓmd4[n9Uj#ʗ_h,*6s1*Bt'XDmϺ6R5K")rOCp7'uP*L "y!s>PG?qFBdS8f_+']d+5eMi -q2BDTIFÝJm |B-D%Afט"iV+aǠfFjNUMנI9̶tuE6y'L"YCA~y[ʋ\0PO2;qllH'%T؅InMݗ͚Lݧz ;ڄ#_ %h9sK,f߀.s!#9،(@G)dQg!ypt̩75E8` 赪l[uV\EWEW` ;!<Ȃ ـť&13&o.=HP *;5 $Mm1,|C\[i \}?9oƊL,/F+SyJ 6!—B 1)w$.wdύ.UBA^ [l84(ako2B+AMYתfqslCCyzy-r2O\IcNk1w} &t}gƄb=y]E$EF8uC2Y 1]֪~vQ8UW,+/ c.7=)䡲2B_\<@iEحl p3!fc jGa hP©-.@BRϢEA})ww1%l5·_2YXĚo99.]m@f4)мtxQCd%pB*嬅b`CfabYuG*%;տ*n+^sنiLolpGmtB%lo&TTk>;(ed! / _5))'CӞ`Ke)wod%J*7pͿ$0%(Gk^^dB?<IWt+3x eR=~FXJػi /: Ű^~O#Jͮr04q;&`F {ђҦr :(s)T[+h6Q< MDur|PQ^ۦ7S64 ဠ&j!97kl96I-;CFrZOh%eiQ8@@BgԤ8DŽ%c_摛 m%?”|HIC"L xD:yձ^x\,ePdQ]b$YWwZ,mUa^YveMkN jC6n2!Lr 0zڤv.lepP0h*ٰўh?u%Y%b@^ z,xم'&2<_6'}?԰_ "dR=lڭLw`D>kSYN3t>nRwxVr?6Q-MHG)ϵ| AU5jh[A"xrÖ;;djsjL?tY;L\'=|QS`Cq6ڽ?kTP 'Ғ_8n61s5={Q<-Lvn#_u&0A 6&wVre~y 8 iuN NPweWSk|@'O@ ', 5V=c6Ji|2V΂C6ÿ섚:*~=찢3Ȱpivڪ j{Rs bAbue#򦟘( rWH N<}@30/r^r$[z/Ɋgc:$c_554\F mj#|?_)s~VdVnшnZ=bbF !z>ݚE"Y_o+X+|$fCp<:a/1_cYkɼ\Lzb&] O t[ѕâ٧=rAm¯VőO!3kOd125-^g`8*IXYr Vv@4xᶛkK (MNmVgƎ!`Zu\<bT%:1d]ccL:,H>Ӡ8Sz~Zr_(┐>QN:XߴaehhyͰ@bư<.B|vl4|uZ+h^6}ԛ _zg }%+44KL$Lz=' xˇY U0%XgHe2,gICn˨}TOjIOY Z.UO9hޗ*NEcsger{~o>ce*4(#Qӡ>cgx*l4Vs/֓ygK5HYQ_ջx-B1*`̊7Ƴ>*F\+[ŵeo{;^O%fw1flbDQG2a{|Fg'B;iyK"|縅JS]E RfjGưj dZc࿦â;t0hإh!.xcFOo& vnT1!P4X(R&BVUl eSr 1}ez豈\5UI&4L௘~|$24zS>pC e@Y@ڂ/< mf`w/WOnMtxc`K=@J2v梌7H\I?~NF5ZfTBO s%\륍*qck=yn4 cB,ksQz mOcDEC?#e@R[xS:7&>BJDIXJa-Z?8MV,4$ ϡ=[&D)?ęU'%{go'1FMM_dUgmQJ=s0{>ʆKDe99/aYBf )54]qsT<:-A9qb3 Yst9^+5(:$8Z&73LdD|*FoUFI2kVc wՈԍ" #.ܗ~q_Y*.4Y]!Ze#ZaBʒ1 !M4U3%~eN+&]cUǩ@c\Aw"LٵƷ"i<bv3D;ΠK4I'N ě ƀ*IQؒ1Rsɺm8CȣлzCrBOhyrqP:[In\ϯ߭(PVQv mď@A׵.;HRw.=7UGi0K0~F` [mOł13{~ 3(^CL__ILDž9ŇVZLphWL0NVfkQ*&PMtbYYB t֓iNNA> bCVm|f}V&‡_rbUĬmpMu; |La'>G/-.zc.*ͪ[$ *aOU[(ќQCZc; .J'Mc_ŠHP/&k?|ιH3|&h<{!K)x t+-qT'st f,!EXdmPgA`tp@qzR}s]X2 {#l8`afLMɠ$8_ j-SNQ2]}42Lɒ.s95 CFץ4 ݰ^ y|쫢x 2Y5 Qc©՟NO(,Ǐ./U (-RCR3[8xğ❛GMߥE`VLjO*@`xTn=/Gp|{q.l(O6VxN/4 DlBTNRKn\b+%($6qD6c>Tzٵ$G O,,\Ue4w>Xdde ս᣺V>hvz)R8ΐ U,Z~ę(Eg>I %+;pvY+InC&ƀ} RϹ4 ooZAv"J̦>B0?4i%[ɉؽ㎠A J^J42#:~1ί?7A}BֲB$g7M~WKƑtjg%FMgo(4Vض024cW/":5H@2yW||@E&qRo63JF$Q "ٹu!( +rv#~dܷ5ys0ޕ)AzT1:iiH]ާb{La) x]50LhzI 4} _ySFTk  S$,rA5FT!-_$f~hA:;u{hU'-;xMfѼYO֍c:QaH!9iϳݸ^}rASTT5Jbo~Qatw N6Xʸ2.ح|R[`eb`J|'XX =xYy6Xdk^_iۚFwfY.1w7ܪ rZ1jŸ5LmrlQ6Mqv|Ļ8o˱+fuaK{;?䝲m2_.Do#:'DOl7:%z} s(ꑝ!،Yjt :X)IX@|(7n !.X&}Ȼ:h/11WoN-T/+%rAr8)Z&!W{ᆱ:x$-fEcme{l(,`赟k^tkC6 U`>" tѷY%(6q>LLW8΃IB4+vt3'zLT= CĨIji$]9aƣj0 G< &SӜ1H5ʿQ| roEY .L )j5w|)"ԼFQoT#)⩳*Ӓ#)^ԕOB~o_5;ݽ|=cfo?%EjQjRYkoֳul11hLw  ?A+4 ;%,W 󵚪̘1l  ֒@P1aVhiVJ_~D5l0W!8cnNRZeQpREU tÍ4vʪ'(H^vd͙)܀,j^o$7Ovr26i)'"ޕ`}URv7xd>wq)0"1jsۑ+/-N&Mo< ac|5> |okd韚ggk(FL(Y_VG}W'S'i߀`A 2rJ^қk]gTʹ6kĺz'a«!a3],L ooL@H @ܔ'4#|!tw cob=^*y}HADs{P\~IOIf.JmvS` |%=b N,aZRݐMSfg QCH8A`6˱[WTB)[LY%|D\K 3ﳉUTÕ{5^|2EA (u95Ȥv;(r jgǨ˽O2!i6&rGjM8ZW<~},Hll=35mnBrs22QKU+|TDtrapU gʭB29{UnI )|}(0L )pjRU,BG FGhoc~)q[2?zC׼u,׊# 3裏cVjCɒ>V+NLR -B)"2B1'4 iWꮏh,bj6*̋ܡOﱎ4•1VZw.p*Y5ed^P9ͱ ,^t47޶px8 w>Li2y=1u87] :jVNyo_ר\[0n[H,/ i+D=eDԞOhcL Z^ e"PI Jy*FE;~h}9͡XGG~]݉&=N3h K9 ~5% a*ߩo ; CP4rP{}b}fX((7f r9q% ch_[+Mz{,ثvet )k3ZU5.mFsm*Eشq*L/dTty3?vɀ{S)%`(kt8ղrnsbXGKQnr?L[xAj@Fv❧ I ;h|U3<d.'{y3>T?| f&(SJ~_2d~d iXFuThU/a2J{O"s(',Bhڀh@PGKߒIle ?Ta+Џԡ13{/-YT l<ޛ$HQ&Wm V]@rA-KM|V.Q19$uؑA}KP$r_.{dxE` =-l'H:h=%n:E/*7$Ȑ lPvkG(Ci+S`omuj7 ↚Bbo=1˶ -`svh.I'A#ECe%ײѭRոC}8MbBTJlrG] 8Al:M%ă#=]"z"c&v{|迈L0^&]r( WKiL\^ :mM +5÷Y ]'߻:6qedܫq]YحO%0'ۮq`'] AAryaTh_ט4Q7e o$zcd0sj=Q[+8}ėڢ˜Ee'M9 RD.Q ~aD]{)M*Ī VODS4찝W @ޚCC+BW(eѪu"7Z^1U WRF%ׄDN${=14:p(d)LGf7M` 2:a[$8l{išp‰"A4r1Hg0SP8'F‹&J2Y.w9Ōg%'5lz|ZEnJd_v:hMs֛G9 ]P=Cm!' yc9ku)eG3 L#  Oe?u>:삣w/1 pBI[)* YJv|$Wk/A*׮7S n@B/rx|G~n $RF,.q0:5@w["DtaNpz*DSJKxS܊xء+*ݳwxp/ \\l._9v0laxpqvZdj׃h#o'^t B*S9An O^ZE@"rdϊ>j<wLHaZ%o6<ɸ10*wZyωŮh6FEK)yOVT۠mp_5$Τ~t0Nմ:ņv\ J z;ܕ|+fÖi69u(sӎ,ywkzXD<FQLQM!^hg};qpKB@U YQ6mHmx cϝaΒ΄h+GϿ)']Maq:R_ESڮX#trr C}*o+D"T-1jȽꦖER:\=-W JYq ؉tgLlCJ1/՚xK˿ΑAp{~\ Lє}`j &bHmh?EkI aW՝0}B5%XmAR!~u s{qbjczfey`?Űv$ c^'qyrȎ_c&?G&Ӟ]Ե翞Ҭ4j~Qw o&fNt%C`XZkJ忕nβԅB`Ɂ6%OʙcZ}ӏ|y+@>jAT3CJryjȠgng<>3n0S3dׄWf2=Zrʶħ<trN!RMd#fDb8(3%tȅSHjĥ){=oVf}urSF ozH:Z S:bne&/(o"p㯦̷Z>gpݪϑDG`7Ip {eHRg@mHmBz\i_ ? )q)IO,fS}$MsI"1UiEp>jq ` 5IVnRj:(kv)i1i[-#%3YSAKSIagazMq빀]e?3Idb`[aȰ9@@r)Gmߞ9 j*Bu}I>goNsZu9A5>ęE<@!^01?Jɜ|[7%Cq.6lҖ ztL^ D> t0]TdjOgZI/^|_ڃ)Qtgd 6c.ktHНn٠)7]{kع`Y68 m}NV־&/xpLٍB&b<+uBMH]U; s7͹>:`_{ODqȕ |4vrİZ\úmA>{5r_;TեV|P?;zRcPP7LѦ-v93[՗Z>au V5)O5}JvhwlX:ucN}-.͹g38KYnl'"ϣ(6 YZ