lighttpd-1.4.55-lp151.3.6.1<>,T^|b/=„Ajj} w 0yJnOyxgߚlr`KM܏Us]j]^.TtH@ࣹ绰P 6äJoɤ&Y'0A8 ]G `6z^M;a2Q^PȶGS>A:7e \GaLws&FK4.k@l2/q#5/<N"G.Fh,|=-*s2:2r_-(c>I8?(d   V) Bf <Aj4j j j j .j / j0j2j5t5j7@7.88.;.(ѽ?@FGjHӐjI8jXդYո\j]לj^bތc5deflujv,w0jxjyz$Clighttpd1.4.55lp151.3.6.1A Secure, Fast, Compliant, and Very Flexible Web ServerLighttpd is a secure, fast, compliant, and very flexible Web server that has been optimized for high-performance environments. It has a very low memory footprint compared to other Web servers and takes care of CPU load. Its advanced feature set (FastCGI, CGI, Auth, Output-Compression, URL-Rewriting, and more) makes lighttpd the perfect Web server software for every server that is suffering load problems.^|blamb26*openSUSE Leap 15.1openSUSEBSD-3-Clausehttp://bugs.opensuse.orgProductivity/Networking/Web/Servershttps://www.lighttpd.net/linuxx86_64/usr/sbin/groupadd -r lighttpd >/dev/null 2>&1 ||: /usr/sbin/useradd -g lighttpd -s /bin/false -r -c "user for lighttpd" -d /var/lib/lighttpd lighttpd >/dev/null 2>&1 ||: test -n "$FIRST_ARG" || FIRST_ARG="$1" # disable migration if initial install under systemd [ -d /var/lib/systemd/migrated ] || mkdir -p /var/lib/systemd/migrated || : if [ "$FIRST_ARG" -eq 1 ]; then for service in lighttpd.service ; do sysv_service="${service%.*}" touch "/var/lib/systemd/migrated/$sysv_service" || : done else for service in lighttpd.service ; do # The tag file might have been left by a preceding # update (see 1059627) rm -f "/run/rpm-lighttpd-update-$service-new-in-upgrade" if [ ! -e "/usr/lib/systemd/system/$service" ]; then touch "/run/rpm-lighttpd-update-$service-new-in-upgrade" fi done for service in lighttpd.service ; do sysv_service="${service%.*}" if [ -e /var/lib/systemd/migrated/$sysv_service ]; then continue fi if [ ! -x /usr/sbin/systemd-sysv-convert ]; then continue fi /usr/sbin/systemd-sysv-convert --save $sysv_service || : done fi test -n "$FIRST_ARG" || FIRST_ARG="$1" [ -d /var/lib/systemd/migrated ] || mkdir -p /var/lib/systemd/migrated || : if [ "$YAST_IS_RUNNING" != "instsys" -a -x /usr/bin/systemctl ]; then /usr/bin/systemctl daemon-reload || : fi if [ "$FIRST_ARG" -eq 1 ]; then if [ -x /usr/bin/systemctl ]; then /usr/bin/systemctl preset lighttpd.service || : fi elif [ "$FIRST_ARG" -gt 1 ]; then for service in lighttpd.service ; do if [ ! -e "/run/rpm-lighttpd-update-$service-new-in-upgrade" ]; then continue fi rm -f "/run/rpm-lighttpd-update-$service-new-in-upgrade" if [ ! -x /usr/bin/systemctl ]; then continue fi /usr/bin/systemctl preset "$service" || : done for service in lighttpd.service ; do sysv_service=${service%.*} if [ -e /var/lib/systemd/migrated/$sysv_service ]; then continue fi if [ ! -x /usr/sbin/systemd-sysv-convert ]; then continue fi /usr/sbin/systemd-sysv-convert --apply $sysv_service || : touch /var/lib/systemd/migrated/$sysv_service || : done fi test -n "$FIRST_ARG" || FIRST_ARG="$1" if [ "$FIRST_ARG" -eq 0 -a -x /usr/bin/systemctl ]; then # Package removal, not upgrade /usr/bin/systemctl --no-reload disable lighttpd.service || : ( test "$YAST_IS_RUNNING" = instsys && exit 0 test -f /etc/sysconfig/services -a \ -z "$DISABLE_STOP_ON_REMOVAL" && . /etc/sysconfig/services test "$DISABLE_STOP_ON_REMOVAL" = yes -o \ "$DISABLE_STOP_ON_REMOVAL" = 1 && exit 0 /usr/bin/systemctl stop lighttpd.service ) || : fi test -n "$FIRST_ARG" || FIRST_ARG="$1" if [ "$FIRST_ARG" -ge 1 ]; then # Package upgrade, not uninstall if [ -x /usr/bin/systemctl ]; then /usr/bin/systemctl daemon-reload || : ( test "$YAST_IS_RUNNING" = instsys && exit 0 test -f /etc/sysconfig/services -a \ -z "$DISABLE_RESTART_ON_UPDATE" && . /etc/sysconfig/services test "$DISABLE_RESTART_ON_UPDATE" = yes -o \ "$DISABLE_RESTART_ON_UPDATE" = 1 && exit 0 /usr/bin/systemctl try-restart lighttpd.service ) || : fi else # package uninstall for service in lighttpd.service ; do sysv_service="${service%.*}" rm -f "/var/lib/systemd/migrated/$sysv_service" || : done if [ -x /usr/bin/systemctl ]; then /usr/bin/systemctl daemon-reload || : fi fi5w@iUfF</P{}O(`I((xjJYYIk(X(8iX9(( YP((88(((x(`X((((i)z 5_.JzL &P K~.VQ Np&nAA聠A聠AA큤AAAAA^|J^|J^|J^|J^|J^|J^|J^|J^|J^|J^|J^|J^|J^|J^|J^|J^|J^|J^|J^|J^|J^|J^|J^|J^|J^|J^|J^|J^|L^|N^|N^|N^|N^|N^|N^|N^|N^|N^|N^|N^|N^|N^|N^|N^|N^|N^|N^|N^|N^|N^|N^|N^|N^|N^|N^|N^|N^|N^|N^|N^|N^|N^|N^|N^|N^|\^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^|J^|I^|I^|J^|J^|J^|J^|Jf45d09334766ce774c9dc90f00a1a645fa64de14e222e647a464c4307a4976d9aec61660e6a34dba4079420341e09353746888da8dcda0c1e5f8b0f57488d8c86ab9a143eeb02c106754b8c5e38685ef29adb774483e1dcfb8a482d65e8cba005615542e73a99e25cecf6da6db128046476907d046319bf35441e8ea67c7df5e44e10f874c6aa9717af0be89eec4dbfd3747e92fa2572d42b18cb17ca35c48f9e67fa1c23d311c01d678c65dc971e4ef6988a8dc6379c30846a69a20f4448c31395adfcd8c07307816fb6a0541a11091e2f1b599d61192a1e4ae0354d5cc4dfb3eb9f7bd00fa03269ee834f1fe22c0f9a16b06a64745baa74ed521dcae7df7cd74b3906e82498ada1ffc02d5d2b145f502aaf191ba9189fe13c014dcc61f5f7509d6405336b5881a03ab9408ca17e57697ba10ac9638704774ac1b6ad32e89271d50c95afdc2ce1bd53e2817a2edab374ab73ba0011f769994da167cd6e6db7122ce54a7a4cf8b8e52ce06a5b485a0e444e67865ad044f68e8262d9708e6cfd25caf0df87385952b4800edb4ed7113bae33a668b27945ec9335ee80edf6949db7dae00d74566f9ac7713a4e251d789191bc662003bcee7e5ff568a2b135ee0163865c44af5f71df24e05171a6a70b1d8daa0e0c2c379d508d4bc36ac7c36f1de3cf5ac7ed07301a8affc51bc3bedb623f49c2f561bc0796766a7cfad6a7a46ac0a481920acb16c6baeb564d9e1c17b2ac84bb79ecbfc06227cffb6f9bbcde7f0e4b410a368c42aa45556d8987870f112bbe7539fa8e0cb5285a7b34ba43e3b92d1a07df97e931e98a76f2c18e51f69197c0744d24b555cd474c4f9b04e008d9a764f9f1735e6d3e8acb3b5d9ed5facf6120dc18ef6aae512e964f4444c3761e4c41e60fbb6c36fb48146882dd278a9a3f158d7aee074190e4eaacd0ac0f455322037d1bd92c0451d4c9c10a8aaa08d48d99081befb74cf6dc71c9106de825f1435ea2859925d3e5afae2332cebcb7951531d65602c8411839bd015495285b98df322028ee9b4db6f837f0d9769b3fe7985716a120fd10e0bff77582fd66e859df064cf46d1f646532b0f34f88460da6925d4319de348cc67be3b016bd2ea456d4de5cd9c61c6edd643c66bd2e95b86f041446668fdd209eacd0b9c94f70ad0758fb86aa5de8ebafb79d933cd6d6813442ad05de60cca771a3b38565fa941cfa2037dd28d0a0a7f50ea4691f19126184bb06223748c2936d9f4271286c331589e4c824e326dd11bedbdc7c0dcb9522f63e7c59c6847db83c152f97e2b9f278c877d9d6b2a98eea2b05872d5c0ae546f03e7d2093f4f7ddf4987fe88d9f82568dc7a5911e41d888f5f8503bb2e2285b3c0ca2a714df4893f1196b47605c45bdeac2ec66eb8e1250d107c1e0faa0cd5d272e2cf0a7d77ffb91cd65ca61c78c357c0aedba9ed35cf0273d29dc80844457b11deb07c77629d3a3d149fce71758ef03c62ac0d2467302de09ff7553ec16a9f5896cbf1b281c8efc20e7e6aeeadec3d576a118f4676a3ab5093e19ccf94b8b9df2094cd0982f201dba6eb30a722745ae42c6505dcc520ff2c6fa74b49836181f29c0d6463912ba19196f0bbd544e637eba736e472d417d2b2118756de6da13e936436b74186c0fabe6e2998358d809aecfdce5118ddc1b66bd874bfa6f69c40ab14fc6759281b3c6590fe7f5e62cf32f9c47d6312ede19571b0fc623778b39da7c1213772daa7f3af36b94e268ed39ae3ac1fe1b651de70ad7ffbb21424dd7674b9a578126dc49f3e439f796d24276a99bff4c8f06ef00fed6f9de91adb6ea13246478ef94f770facc72470a779f1aa033d62821d62761dc3b3493514741d06205d6202681a64544bce2aa622326ea7d4f6daf6039499f595e71d1c39279f0fecf70106d454dc7840b0f08be6453bd3dce53c85048451df78bd22823d9999b117839118ccebc077da872dc9deb9094ef7c0e059765e69ecc2b073a0dfbcc11bd2b3346589224a391e10ee0e3f1ce01c03fe5c56c7fa7fa470fea60ee187c9e3af75caa0591ef6668e347988d8672836198441291d8671b58e2173e21aba89328966320fe47594a71edc039487029f9ca3201cc25710b6007720452a2205db276543d157848e5d680f9b8a6efc70e4d07c085304e2cbc128e44bfbcb62f726e050113c948cdf7a421b4797f83d9622e169f405a720dab7db02a71039aae5db909ada81940cfad310368079833b0e60c0c6b38a74e654edd9238a7b18837855d7d01cc2d962c4ca1bbc87caf1ae1783da24ee1f0acd9b57fcde881f74fc4359cc442cb5fe5deb804126683b0104e023c1c0590da3b20b07e0cceaf8cab0b8157fac6215baef34d61dc84633a9ed4109995fe5cd1695e675bfa4a68bcd05538dc67f418df8125cc887da27e2383b60838ce57c92821d03cc50c2e6301289040c85e91535c74ce809bb34e344adb07184b7872f0cfb1e365b527fa856c26498ea26ab4cde8df54a81a8fdc4ab4b9b6256ad597bdc2332bb27e6b6ffe94a4e31fb986486dbe2acef27a9c3f559e30bc9079a906b13c98542c5647988ee6844cb2771466a2201e1ada7b27f86d00df22a13e7565ba5dd5c9a283121deeef57aafa082ca6f3dd0dafba2590d759eabc16e80f42f2086fb2df4fa996473ba81dead842b2d4413fa19cbc58bf1319618127a6c4e31762568e47db2e54b6e636544f054239984eabf9269311f0eee78cb0e39198aea24ac61a4dc4d05d70eaee89a94d12d4b7d868ec0a22273ab5462a906d229962cf55ae4d7eb2bc6e611f009667e2dd0cca3398c3979cbd5ae54d3d193afc07e164c1056b9221db1bf4c10a41402bb0a9453f814360f6a67863c195dacb44785b1f387e664325e981ce1db887cddee41b99915fbb47e7ae430ffef1c30c88218478e51b4c826e58c18a48cffa96e5a510e2bd05000d2cb076fa3322b0f5645fc2e46dde49bb7f3b1ff4aecb6ce388c610f25618c410b3313050fd5ca11a8c7f7dc0d8784f48ca50de8fdd7cc384d50204523f7aa541ab4480ea5154e71b2b6c2e974139fc1a5d4e9225e11e47764329a402a0051373a50e23216c5f3fb49c4cbcd1c0b5c3ef283fca9ada4d69aa83309c5139377b76e0abdc30e78ecf531c18d3177564a071a51c69df1bff4c34ef6115be29ddfac2335a3b53c8d318e532784b3e8ca86f118f333b49c07a1748e8812b2d1499c30904ad40c57b6ecfd36cb8cfb621054db8c5bc6e36ef10f23a1ec6d0667bc2032f7bab5d7101322041ef85a0256f0da59b3b32172841f272c6cdbda9223450827b0bf97a4d642870f4313cb2fafa12b4b6ec12972305b30546c9ea5c759411bd869885e5fe1dd216bf228dd1ae25299868c24f3baf8ce1172f29487724fd7f257d7e5540a2df25b52d32dafa7b02119e00cab53851facfef4d2681ef49ec0cc388c2448f84411e5e21badac7ab6dc1ab5926f4c0df9d1c7a8c4fe685feb4e15911b0b646fd40a29ec2afb7c818853631fbede70454c3d9e0e97a3e4491e80fcc3b00cc853d2726d940328e30967474c29f243fd140d51fdc5361c75e56059d03a520030d171558366263815a658ae3db848a8feac19b9e4b264a64be0b5e1b7e7ba58398ab0567c4ba317d7dbb1e4742323773f34caea9f1baa28b34192589434685887ad18efde3a5cd89a3342eb2ac783e253ac404c6d8b6b435e1422bdf0bbe3a4992ff25610181f7e3fa22d540f1940729bc6721839dc9d364b8d4c9629e472b09d9f42b8f1aa99e17e2f48a756a0d9732306b4d13dc563a1e08aecfb5063b0fbb18a0f85e7d5d9250a180a93ee36bb70637a7b0e74d7d8b14ae8a475d98e28cf8f1f127cc3e3ecfb1c8b4ddc32bc6f987ca9f4bec792d4835b4457a70b3679ba18748ffbd0a38c62bd082261305a4f7b1ae9d61246c2b21680adfd675eb5ff3730db086f33c5cb14e558422ca504e4e8899575bc02a4bef009aee00fbf47f1ecd1dfcadd993b5194ddbef469649bb8df455751b644432cd79a5810fe03b94bcc227fb23a98c7c545c5d696d600e332ccaaa5831371be437031332b716d8f45fde44137e5ae30c2f1fe59171f49be53bb2c412a430f9d5e253b65594fefb5367ca7bc974ecb7e877463d40a459d97035861604381019b1ec47d5163ecfb56f406f4592182cdc53f2477d2192f09e73cdd947ec8ad37328afcaa4ff2e5315ce014c8ef8a87934589ec7123293a191566ddfa4a575f142d2e26db998622d95d5badd886e4c63a0f0c73e397servicerootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootlighttpdlighttpdlighttpdlighttpdlighttpdlighttpd-1.4.55-lp151.3.6.1.src.rpmconfig(lighttpd)http_daemonhttpdlighttpdlighttpd(x86-64) @@@@@@@@@@@@@@@@@@@@@@@@@@@    /bin/sh/bin/sh/bin/sh/bin/shconfig(lighttpd)coreutilsdiffutilsfillupgreplibattr.so.1()(64bit)libattr.so.1(ATTR_1.0)(64bit)libbz2.so.1()(64bit)libc.so.6()(64bit)libc.so.6(GLIBC_2.10)(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.15)(64bit)libc.so.6(GLIBC_2.17)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.25)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.3.2)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libc.so.6(GLIBC_2.9)(64bit)libcrypt.so.1()(64bit)libcrypt.so.1(GLIBC_2.2.5)(64bit)libcrypto.so.1.1()(64bit)libcrypto.so.1.1(OPENSSL_1_1_0)(64bit)libdl.so.2()(64bit)libdl.so.2(GLIBC_2.2.5)(64bit)libev.so.4()(64bit)libfam.so.0()(64bit)libpcre.so.1()(64bit)libssl.so.1.1()(64bit)libssl.so.1.1(OPENSSL_1_1_0)(64bit)libz.so.1()(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)shadowspawn-fcgisystemdsystemdsystemdsystemd1.4.55-lp151.3.6.13.0.4-14.6.0-14.0-15.2-14.14.1^b;@^6]]@Z@Zb@Za@Za@Zx@Z@Z7Y+@Y@Y@XCX|XzXzXs{@X^c@X2@X2@XkW@W!VU@U@UȒ@UU@UUTTTT\@T_W@Vítězslav Čížek Andreas Stieger Andreas Stieger Dominique Leuenberger dimstar@opensuse.orgi@marguerite.sumikhail.kasimov@gmail.commikhail.kasimov@gmail.comjenkins@lighttpd.netrbrown@suse.comstbuehler@web.destbuehler@web.destbuehler@web.demrueckert@suse.demrueckert@suse.debwiedemann@suse.comstbuehler@web.dejenkins@lighttpd.netstbuehler@web.dejenkins@lighttpd.netjenkins@lighttpd.netstbuehler@web.dejenkins@lighttpd.netjenkins@lighttpd.netjenkins@lighttpd.netjenkins@lighttpd.netdimstar@opensuse.orgjenkins@lighttpd.netmrueckert@suse.dejenkins@lighttpd.netjenkins@lighttpd.netstbuehler@web.detchvatal@suse.comtchvatal@suse.comtchvatal@suse.comtchvatal@suse.comLed - Remove deprecated GeoIP support (bsc#1156198) * drop mod_geoip subpackage- update to 1.4.55: * a multitude of bug fixes- update to 1.4.54 (boo#1111733): * behavior change: strict URL parsing and normalization (configurable) * performance enhancements * bug fixes - includes changes from 1.4.53: * TLS-ALPN-01 * systemd socket activation * bug fixes - includes changes from 1.4.52: * performance enhancements * bug fixes - includes changes from 1.4.51: * new module: mod_authn_pam * multiple security fixes + process headers after combining folded headers + mod_userdir security: skip username "." and ".." - includes changes from 1.4.50: * CVE-2018-19052: path traversal in mod_alias (boo#1115016) * security: use-after-free after invalid Range request * multiple bug fixes - Fix build with PostgreSQL 11 in Tumbleweed (boo#1153722) - Switch to unmodified upstream tarball, add upstream signing keys and verify source signature- BuildRequire pkgconfig(systemd) instead of systemd: allow OBS to shortcut the build queues by allowing usage of systemd-mini- Revert that pgsql workaround for tumbleweed: pampering over issues like this is just hiding problems. A real fix was submitted to the postgresql package instead.- workaround for tumbleweed * update-alternatives not expanded in the build VM due to unknown reasons, thus /usr/bin/pg_config is meaningless- Updated 10-ssl.conf (TLSv1.2 only) for lighttpd.conf in lighttpd_1.4.49-1.1.debian.tar.xz- Updated 'SSL Support' section in lighttpd.conf: TLSv1.2 only bsc#1087369- update to 1.4.49 + - next is 1.4.49 + [core] adjust offset if response header blank line + [mod_accesslog] %{canonical,local,remote}p (fixes #2840) + [core] support POLLRDHUP, where available (#2743) + [mod_proxy] basic support for HTTP CONNECT method (#2060) + [mod_deflate] fix deflate of file > 2MB w/o mmap + [core] fix segfault if tempdirs fill up (fixes #2843) + [mod_compress,mod_deflate] try mmap MAP_PRIVATE + [core] discard from socket using recv MSG_TRUNC + [core] report to stderr if errorlog path ENOENT (fixes #2847) + [core] fix base64 decode when char is unsigned (fixes #2848) + [mod_authn_ldap] fix mem leak when ldap auth fails (fixes #2849) + [core] warn if mod_indexfile after dynamic handler + [core] do not reparse request if async cb + [core] non-blocking write() to piped loggers + [mod_openssl] minor code cleanup; reduce var scope + [mod_openssl] elliptic curve auto selection (fixes #2833) + [core] check for path-info forward down path + [mod_authn_ldap] auth with ldap referrals (fixes #2846) + [core] code cleanup: separate physical path sub + [core] merge redirect/rewrite pattern substitution + [core] fix POST with chunked request body (fixes #2854) + [core] remove unused func + [doc] minor update to *outdated* doc + [mod_wstunnel] fix for frames larger than 64k (fixes #2858) + [core] fix 32-bit compile POST w/ chunked request body (#2854) + [core] add include sys/poll.h on Solaris (fixes #2859) + [core] fix path-info calculation in git master (fixes #2861) + [core] pass array_get_element_klen() const array * + [core] increase stat_cache abstraction + [core] open additional fds O_CLOEXEC + [core] fix CONNECT w strict header parsing enabled + [mod_extforward] CIDR support for trusted proxies (fixes #2860) + [core] re-enable overloaded backends w/ multi wkrs + [autoconf] reduce minimum automake version to 1.13 + [mod_auth] constant time compare plain passwords + [mod_auth] check that digest realm matches config + [core] fix incorrect hash algorithm impl + [doc] NEWS- Replace references to /var/adm/fillup-templates with new %_fillupdir macro (boo#1069468)- new upstream release 1.4.48 + requires automake 1.14 + new mod_authn_sasl module - remove autoreconf call; was required for mod_geoip patch, which is now upstream - add cyrus-sasl-devel, package mod_authn_sasl- update to 1.4.47 + [core] stricter validation of request-URI begin + [core] fix 1.4.46 regression in config match + [core] normalize config addrs for != match + [core] normalize config addrs for eq and ne + [core] fix 1.4.46 regression in Last-Modified- new upstream release 1.4.46 - drop lighttpd-1.4.x_out_of_bounds_read.patch (fixed upstream) - use systemd, drop init script - drop support for suse_version <= 1210 - add some new modules and packages - drop __DATE__/__TIME__ sed hack (usage disabled upstream by default)- use php7 for TW (boo#1058101)- added lighttpd-1.4.x_out_of_bounds_read.patch: fix out of bounds read in mod_scgi (debian#857255)- make lighttpd user own /var/log/lighttpd/ to be able to write logs there- fix some rpmlint messages + update FSF address for lighttpd.init + install example scripts without +x to avoid pulling shell dependencies + W:file-contains-current-date /usr/sbin/lighttpd is a false positive; it only happens when the last-source-modified date is the same as the build date + I: binary-or-shlib-calls-gethostbyname has been forwarded upstream- update to 1.4.45 + - next is 1.4.45 + [mod_cgi] skip local-redir handling if to self (fixes #2779, #2108) + [mod_webdav] fix crash when plugin_ctx cleaned up (fixes #2780) + [mod_fastcgi] detect child exit, restart proactively + [mod_scgi] detect child exit, restart proactively + [TLS] ssl.read-ahead = "disable" for low mem (fixes #2778) + [doc] NEWS + [tests] update test skip count for !fcgi-responder + [tests] FCGI_Finish() final request before exit + [tests] give time for periodic jobs to detect exit + [mod_cgi] check cgi fd for num bytes ready to read- lighttpd-1.4.13_geoip.patch is long gone; it was replaced with mod_geoip-for-1.4.39.patch but is now included upstream- update to 1.4.44 + - next is 1.4.44 + [mod_scgi] fix segfault (fixes #2762) + [mod_authn_gssapi] fix memory leak + [config] warn if mod_authn_ldap,mysql not listed + [mod_magnet] fix magnet_cgi_set() set of env vars (fixes #2763) + [mod_cgi] FreeBSD 9.3/MacOSX does not have pipe2() (fixes #2765) + [mod_extforward] fix crash on invalid IP (fixes #2766) + [mod_fastcgi] fix segfault if all backends down (fixes #2768) + [mod_cgi] fix out of sockets error for POST to CGI (fixes #2771) + [mod_auth] compile fix for Mac OS X XCode (fixes #2772) + [mod_authn_gssapi] better resource cleanup + [core] compile fix for Mac OS X 10.6 (old) (fixes #2773) + fix race in dynamic handler configs (reentrancy) (fixes #2774) + [mod_authn_mysql] close mysql_conn in cleanup + [mod_webdav] compile fix when locking not enabled + load mod_auth & mod_authn_file in sample/test.conf + comment out auth.backend.ldap.* in tests/*.conf + [mod_fastcgi,mod_scgi] warn if invalid "bin-path" + RAND_pseudo_bytes() is deprecated in openssl 1.1.0 + openssl 1.1.0 init and cleanup + [mod_cgi] remove direct calls to network_backend* + [build] build network_*.c into lighttpd executable + suggest inclusion of mod_geoip... before mod_ssi. + set systemd settings similar to lighttpd2 + [doc] remove reference to Linux rt-signals + [mod_authn_gssapi] fix missing error ret, coverity + [core] rename li_rand() to li_rand_pseudo_bytes() + remove #include "stream.h" where not used + [mod_cml] include lua headers before base.h + [core] combine duplicated connection reset code + [mod_ssi] produce content in subrequest hook + [core] remove srv->entropy[] + [core] defer li_rand_init() until first use + [core] permit connection-level state in modules + [mod_dirlisting] render dirlisting as HTML (fixes #2767) + [mod_proxy] replace HTTP Host sent to backend (fixes #2770) + [mod_ssi] basic recursive SSI include virtual (fixes #536) + [mod_ssi] implement, ignore + [core] consolidate duplicated read-to-close code + [core] fix segfault when parsing a bad config file + [core] support Transfer-Encoding: chunked req body (fixes #2156) + [autobuild] set NO_RDYNAMIC=yes for midipix + [mod_proxy] proxy.balance = "sticky" option (fixes #2117) + [mod_secdownload] warn if SHA used w/o SSL crypto + [build] compile fixes for AIX + [build] check for pipe2() at configure time + [mod_evhost] fix an incorrect error trace + [tests] mark tests/docroot/www/*.pl scripts a+x + [mod_proxy] proxy.replace-http-host enable/disable + [mod_cgi] fall back to pipe() if pipe2() fails + fix SCons fullstatic build with glibc pthreads + [TLS] openssl 1.1.0 makes SSL_OP_NO_SSLv2 no-op + [doc] NEWS- update to 1.4.43 + - next is 1.4.43 + [autobuild] remove mod_authn_gssapi dep on resolv + [mod_deflate] ignore '*' in deflate.mimetypes + minor: make packdist.sh more convenient for me + [autobuild] omit module stubs when missing deps + [autobuild] rm module stub code for missing deps + [TLS] openssl 1.1.0 hides struct bignum_st + [autobuild] move http_cgi_ssl_env() for Mac OS X (fixes #2757) + [core] use paccept() on NetBSD (replace accept4()) + [TLS] remote IP conditions are valid for TLS SNI (fixes #2272) + [doc] lighttpd-angel.8 (fixes #2254) + [cmake] build fcgi-auth, fcgi-responder for tests + [mod_accesslog] %{ratio}n logs compression ratio (fixes #2133) + [mod_deflate] skip deflate if loadavg too high (fixes #1505) + [mod_expire] expire by mimetype (fixes #423) + [mod_evhost] partial matching patterns (fixes #1194) + [mod_evhost] mod-evhost.t tests (#1194) + build: use CC_FOR_BUILD for lemon when cross-compiling + [lemon] standalone; remove #include "first.h" + [mod_dirlisting] config header and readme files + [config] warn if mod_authn_ldap,mysql not listed + fix FastCGI, SCGI, proxy reconnect on failure + [core] network_open_file_chunk() temp file opt + [mod_rewrite] add more info in error log msg + [core] fix fd leak when using libev (fixes #2761) + [core] fix potential streaming tempfile corruption (fixes #2760) + minor: coverity comments + [mod_scgi] fix prefix matching to always match url + move script to doc/scripts/ax_prog_cc_for_build.m4 + [autobuild] adjust Makefile.am for FreeBSD + [core] check fcntl O_APPEND succeeds w/ mkstemp() + [doc] NEWS + [autobuild] add lemon.c to src/Makefile.am + [autobuild] build fix for lemon.c + [autobuild] put ax_prog_cc_for_build.m4 in top directory + [scons] workaround FreeBSD11 fullstatic link error + [scons] only apply FreeBSD11 workaround on FreeBSD + [mod_cgi] FreeBSD 9.3 does not have pipe2() + [build] move some build scripts to scripts/ + [autotools] fix configure.ac for opensuse 13.2 + [build] fix warning for (potentially) unused func- package new modules - remove mod_geoip_for_1.4.40.patch- update to 1.4.42 + - next is 1.4.42 + [TLS] SSL_shutdown() only if handshake finished + [mod_proxy,mod_scgi] shutdown remote only if local (#2743) + [core] check if client half-closed TCP if POLLHUP (#2743) + [core] enforce wait for POLLWR after EINPROGRESS (fixes #2744) + [core] do not enter handler twice after read body + [core] proxy,scgi omit shutdown() to backend (fixes #2743) + [mod_dirlisting] dirlist does not handle POST + [mod_dirlisting] js column sort for dirlist table (fixes #613, fixes #2315) + [mod_auth] Digest auth fails after rewrite (fixes #2745) + [mod_auth] refactor out auth backend code + [mod_auth] refactor out auth backend code + [mod_auth] refactor out auth backend code + [mod_auth] extensible interface for auth backends + [mod_auth] extensible interface for auth backends + [core] better DragonFlyBSD support (fixes #2746) + [mod_auth] include base.h for USE_OPENSSL def + [mod_auth] support CRYPT-MD5-NTLM algorithm (fixes #1743) + [mod_auth] terminate salt for CRYPT-MD5-NTLM + [core] fix crash if ready events on abandoned fd (fixes #2748) + fix mis-cast in unused code + [mod_auth] http_auth_md5_hex2bin() + [mod_auth] remove empty mod_auth.h + [mod_auth] mod_authn_mysql.c MySQL auth backend (fixes #752, fixes #1845) + [mod_cgi] permit CGI exec of unreadable files (fixes #2374) + [mod_uploadprogress] add to default build + [mod_geoip] add to default build (fixes #2705, fixes #2101, fixes #2092, fixes #2025, fixes #1962, fixes #1938) + [mod_fastcgi] Authorizer support with Responder (fixes #321, fixes #322) + [tests] test coverage for issues (#321, #322) + dynamic handlers store debug flag in handler_ctx + [mod_fastcgi] allow authorizer, responder for same path/ext (#321) + backport mod_deflate to lighttpd 1.4 (fixes #1824, fixes #2753) + [autobuild] test_configfile might need vector.c (fixes #2752) + remove unused sys-mmap.h from stat_cache.c + [mod_deflate] fix longjmp clobber compiler warning + remove unused array type TYPE_COUNT data_count + [mod_auth] structured data, register auth schemes + [mod_auth] mod_authn_gssapi Kerberos auth backend (fixes #1899) + silence warnings from clang ccc-analyzer + [autobuild] skip two new tests if no fcgi-auth + [SCons] define with_krb5 for SCons build + [SCons] fix syntax error in SConstruct + [SCons] define with_geoip for SCons build + [CMake] fix clang -Wcast-align warnings in lemon.c + remove excess initializers (fix compiler warnings) + fix errors detected by Coverity Scan + performance: use Linux extended syscalls and flags + [mod_scgi] add uwsgi protocol support + [mod_auth] refactor LDAP code into smaller funcs + [mod_auth] HTTP Basic auth backends also do authz (#1817) + [mod_auth] ldap filter subst user for multiple '$' (fixes #1508) + [mod_auth] permit specifying ldap DN; skip search (fixes #1248) + [autobuild] update module/feature report + [cmake] build mod_authn_gssapi if WITH_KRB5 + DragonFlyBSD defines __DragonFly__ (#2746) + [mod_auth] fix printing of IP in error trace + quiet coverity warning + [mod_mysql_vhost] support multiple '?' replacement (fixes #2163) + [core] make server.max-request-size scopeable (#1901) + [core] server.max-request-field-size (fixes #2130) + [core] optional condition in config "else" clause (fixes #1268) + [core] restrict where config "else" clauses occur (#1268) + silence warnings from clang ccc-analyzer + consistent, shared code to create CGI env + [TLS] replace env entries in https_add_ssl_entries + [TLS] set SSL_CLIENT_M_SERIAL w/ client cert SN (fixes #2268) + [TLS] set SSL_CLIENT_VERIFY w/ client cert (#1288, #2693) + [TLS] set SSL_PROTOCOL, SSL_CIPHER* (fixes #2511) + [core] rand.[ch] to use better RNGs when available + [mod_cgi] fix pipe_cloexec() when no O_CLOEXEC + ignore return value from fcntl() FD_CLOEXEC + silence warnings from clang ccc-analyzer + fix SCons build + build w/o compiler warnings if no zlib or bz2lib + parallelize dist package build (packdist.sh) + [doc] NEWS + quiet coverity warning + add random() to list of rand() fallbacks- update to 1.4.41 + - next is 1.4.41 + remove long-deprecated, non-functional config opts + [config] inherit server.use-ipv6 and server.set-v6only (fixes #678) + [build] allow AUTHOR, KEYID overrides to packdist + [mod_auth] fix Digest auth to be better than Basic (fixes #1844) + [doc] update memcache references to memcached + [mod_ssi] fix #config sizefmt="bytes" + fix some warnings reported by cppcheck + workaround clang compiler warning + [autobuild] move inet_pton detection later + [core] #include for FIONREAD (fixes #2726) + [autobuild] clock_gettime() -lrt with glibc < 2.17 + minor: spelling changes in some comments/messages + [security] do not emit HTTP_PROXY to CGI env + [build_cmake] clock_gettime() -lrt w/ glibc < 2.17 (fixes #2737) + [core] avoid spurious trace and error abort + [core] stay in CON_STATE_CLOSE until done with req + [core] $HTTP["remoteip"] must handle IPv6 w/o [] + [mod_status] show keep-alive status w/ text output (fixes #2740) + do not set REDIRECT_URI in mod_magnet, mod_rewrite (#2738) + revert 1.4.40 swap of REQUEST_URI, REDIRECT_URI (fixes #2738) + [core] permit IPv6 address scope identifier + [core] consolidate duplicated response_end code + [TLS] better handling of SSL_ERROR_WANT_READ/WRITE + [TLS] read all available records from SSL_read() + [core] try AF_INET after AF_INET6 if use-ipv6 + [core] fix result copy from getaddrinfo() + [core] set chunkqueue tempdirs at startup + [core] check if EAI_ADDRFAMILY is defined + [core] set chunkqueue tempdirs at startup /var/tmp + [security] ensure gid != 0 if server.username set (fixes #2725) + [security] disable stat_cache if !follow-symlink (fixes #2724) + [core] fix buffer_copy_string_hex() assert (fixes #2742) + fix buffer.c comments to match encoded_chars_* + [security] encode quoting chars in HTML and XML + [cmake] always define _GNU_SOURCE + [cmake] enable warnings for GCC and Clang + [cmake] set cmake_minimum_required to 2.8.2 + [doc] NEWS- update to 1.4.40 + - next is 1.4.40 + [mod_ssi] enhance support for ssi vars + add handling for lua 5.2 and 5.3 (fixes #2674) + use libmemcached instead of deprecated libmemcache + add force_assert for more allocation results + cleanup dead keyvalue code + [autobuild] fix lua configure error handling + [mod_cgi] use MAP_PRIVATE to mmap temporary file instead of MAP_SHARED (fixes #2715) + [core] do not send SIGHUP to process group unless server.max-workers is used (fixes #2711) + [mod_cgi] edge case chdir "/" when docroot "/" (fixes #2460) + fix links to online docs in template config files + [mod_cgi] issue trace and exit if execve() fails (closes #2302) + [configparser] don't continue after parse error (fixes #2717) + [core] never evaluate else branches until the previous branches are aready (fixes #2598) + [core] fix conditional cache handling + [core] improve conditional enabling (thx Gwenlliana, #2598) + [buffer] use explicit integer promotion to make the code more readable + [config] extend duplicate-array-key error (fixes #2704) + [mod_compress] case-insensitive content-codings (fixes #2645) + [plugins] don't include dlfcn.h if not needed (fixes #2548) + [mod_fastcgi] 404 for X-Sendfile file not found (fixes #2474) + [mod_cgi] send 500 if CGI ends and there is no response (fixes #2542) + [mod_cgi] consolidate CGI cleanup code + [mod_cgi] simplify mod_cgi_handle_subrequest() + [mod_cgi] kill CGI if fail to write request body + [mod_proxy] use case-insensitive comparision to filter headers, send Connection: Close to backend (fixes #421) + [mod_dirlisting] dir-listing.hide-dotfiles = "enabled" by default (fixes #1081) + [mod_rewrite] fix return type of process_rewrite_rules + [mod_secdownload] fix buffer overflow in secdl_verify_mac (reported by Fortify Open Review Project) + [mod_fastcgi,mod_scgi] fix leaking file-descriptor when backend spawning failed (reported by Fortify Open Review Project) + [core] improve array API to prevent theoretical memory leaks + [core] rename variable in array.c + [core] refactor array search; raise array size limit to SSIZE_MAX + [core] fix memory leak in configparser_merge_data + [core] provide array_extract_element and use it + [core] configparser: error on duplicate keys in array merge (fixes #2685) + [core] more careful parse of $SERVER["socket"] config str (prepare #2204) + [core] accept $SERVER["socket"] without port, use server.port as fallback (fixes #2204) + [mod_magnet] define lua_pushglobaltable (for lua5.1) and use it (fixes #2719) + [ssl] support disabling ssl.verifyclient.activate in SNI callback (fixes #2531) + restart (some) syscalls after SIGCHLD interrupted them; should fix LDAP problems (fixes #2464) + [core] log remote address on request timeouts (fixes #652) + [autobuild] use AC_CANONICAL_HOST instead of AC_CANONICAL_TARGET (fixes #1866) + [core] fix request_start in keep-alive requests to mark time when received first byte (fixes #2412) + [core] truncate pidfile on exit (fixes #2695) + consistent inclusion of config.h at top of files (fixes #2073) + [autobuild] include first.h in make dist + [core] add generic vector implementation + [core] replace array weakref with vector + [base64] fix crash due to broken force_assert + [unittests] add test_buffer and test_base64 unit tests + [base64] fix another crash due to broken force_assert conditions + [buffer] refactor buffer_path_simplify (fixes #2560) + [http_auth/mod_fastcgi] check get_http_*_name() for NULL return (#2583) + validate return values from strtol, strtoul (fixes #2564) + add NEWS entry for previous commit + [mod_ssi] Add SSI vars SCRIPT_{URI,URL} and REQUEST_SCHEME (fixes #2721) + [config] warn if server.upload-dirs has non-existent dirs (fixes #2508) + [mod_proxy] accept LF delimited headers, not just CRLF (fixes #2594) + [core] wait for grandchild to be ready when daemonizing (fixes #2712, thx pasdVn) + [core] respond 411 Length Required if request has Transfer-Encoding: chunked (fixes #631) + [core] fixed the loading for default modules if they are specified explicitly + [core] lighttpd -tt performs preflight startup checks (fixes #411) + [stat] mimetype.xattr-name global config option (fixes #2631) + [configparser] fix small leak on config failure + [mod_webdav] allow Depth: Infinity lock on file (fixes #2296) + [mod_status] use snprintf() instead of sprintf() + pass buf size to li_tohex() + use li_[iu]tostrn() instead of li_[iu]tostr() + [stream] fstat() after open() to obtain file size + [core] clean up srv before exiting for lighttpd -[vVh] + [mod_fastcgi,mod_scgi] check for spawning on same unix socket (fixes #319) + [mod_cgi] always set QUERY_STRING (fixes #1339) + [mod_auth] send charset="UTF-8" in WWW-Authenticate (fixes #1468) + [mod_magnet] rename var for clarity (fixes #1483) + [mod_extforward] reset cond_cache for scheme (fixes #1499) + [mod_webdav] readdir POSIX compat (fixes #1826) + [mod_expire] reset caching response headers for error docs (fixes #1919) + [mod_status] page refresh option (fixes #2170) + [mod_status] table w/ count of con states (fixes #2427) + [mod_dirlisting] class for dir (fixes #2304) + skip spawning backends for preflight tests (#2642) + [core] define __STDC_WANT_LIB_EXT1__ (fixes #2722) + [core] setrlimit max-fds <= rlim_max for non-root (fixes #2723) + [mod_ssi] config ssi.conditional-requests + [mod_ssi] config ssi.exec (fixes #2051) + [mod_redirect,mod-rewrite] short-circuit if blank replacement (fixes #2085) + [mod_indexfile] save physical path to env (fixes #448, #892) + [core] open fd when appending file to cq (fixes #2655) + [config] server.listen-backlog option (fixes #1825, #2116) + [core] retry tempdirs on partial write, ENOSPC (fixes #2588) + untangle overly complex control flow logic + defer reading request body until handle subrequest (fixes #2541) + mv funcs from connections.c to connections-glue.c + defer reading request body until handle subrequest + always poll for client POLLHUP/POLLERR events (fixes #399) + remove handle_joblist hook + handlers can read response before sending req body (fixes #131, #2566) + [mod_cgi] asynchronous send of request body to CGI + improve dynamic handler control flow logic + [doc] add mimetype.use-xattr to conf.d/mime.conf + [doc] enhance error msg for backend server config + [doc] add ref to RFC 7232 for conditional requests + make (compile and link) cleanly under cygwin + [core] compile with upcoming openssl 1.1.0 release (fixes #2727) + fix some warnings reported by static analysis tool + [core] set REDIRECT_STATUS to error_handler_saved_status (fixes #1828) + remove unused con->error_handler member + [core] server.error-handler new directive for error pages (fixes #2702) + set REDIRECT_URI in mod_rewrite, mod_magnet + [doc] add server.error-handler + server.error-handler new directive for error pages + [core] support IPv6 in $HTTP["remote-ip"] CIDR cond match (fixes #2706) + [doc] NEWS + [core] http_response_send_file() shared code (#2017) + [mod_fastcgi] use http_response_xsendfile() (fixes #799, fixes #851, fixes #2017, fixes #2076) + [mod_scgi] X-Sendfile feature (fixes #2253) + [mod_cgi] X-Sendfile feature (fixes #2313) + [mod_cgi,mod_fastcgi,mod_scgi] X-Sendfile features + [mod_webdav] lseek,read if fs can not mmap (#2666, fixes #962) + [mod_compress] use mmap and trap SIGBUS (#2666, fixes #1879) + fallback to lseek()/read() if mmap() fails (#fixes 2666) + [mod_auth] skip blank lines and comment lines (fixes #2327) + [core] fallback to write if sendfile not supported (fixes #471, #987) + minor: add missing #include + [core] preserve PATH_INFO case on case-insensitive fs (fixes #406) + [doc] add mimetype.use-xattr to create-mime.conf.pl + [doc] NEWS + [mod_ssi, mod_cml] set DOCUMENT_ROOT to basedir (fixes #2383) + [core] cmd line opt to shutdown after idle time limit (fixes #2696) + [network] separate addr trans from socket creation + [core] lighttpd -1 handles single request on stdin socket (fixes #1584) + lighttpd run modes for idle timeout, one-shot + [mod_fastcgi,mod_scgi] IPv6 support (fixes #2372) + [mod_status] add JSON output option (fixed #2432) + [mod_webdav] map COPY/MOVE Destination to aliases (fixes #1787) + [mod_webdav] improve PROPFIND,PROPPATCH (#1818, #1953) + [mod_webdav] improve PROPFIND,PROPPATCH; map COPY/MOVE Destination + [doc] NEWS + reset response headers, write_queue for error docs + fix typo in new cgi.x-sendfile directives + clean up oneshot_fd resource upon startup error + minor: fix compiler warning for extra ';' + build with libressl + [core] fix IPv6 address + port parsing (#2204) + static build instructions using SCons or make + [core] fix config merge of array lists + [core] simplify config merge of array lists + [core] add default modules while processing server config + [mod_auth] preserve WWW-Authenticate for error docs (fixes #2730) + check close() return code after writing to file + [doc] NEWS + adjustments for openssl 1.1.0 pre-release + [config] support include file glob (fixes #1221) + [mod_evasive] 302 redirect option if limit reached (fixes #2199) + [build] enhancements for cross-compiling (fixes #2276) + [mod_accesslog] report aborted con state with %X (fixes #1890) + [mod_ssi] fix SSI statement parser + [mod_ssi] include relative to alias,userdir (fixes #222) + [mod_ssi] add PCRE_* options to constrain regex + [mod_ssi] more flexible quoting (fixes #1768) + [core] wrap IPv6 literal in "[]" in redirect URL + [mod_ssi] fix parse of tag across buf boundary (fixes #2732) + [mod_cgi,mod_scgi] X-Sendfile sets file_started (fixes #2733) + [mod_fastcgi] no chunked response w/ X-Sendfile (fixes #2733) + [config] opts for http header parsing strictness (fixes #551, fixes #1086, fixes #1184, fixes #2143, #2258, #2281, fixes #946, fixes #1330, fixes #602, #1016) + [config] normalize IP strings in lighttpd.conf + [build_cmake] use MODULE on Mac OS X (fixes #1761) + minor: quiet some compiler warnings + use buffer_string_set_length() to truncate strings + use buffer_string_set_length() to truncate strings + [config] server.bsd-accept-filter option + [mod_webdav] create file w/ LOCK request if ENOENT + [doc] NEWS + [mod_webdav] getetag and lockdiscovery live props + [mod_webdav] create file w/ LOCK request if ENOENT + [core] buffer large responses to tempfiles (fixes #758, fixes #760, fixes #933, fixes #1387, #1283, fixes #2083) + [core] stream response to client (#949) + [TLS] release openssl buffers as used (fixes #1265, fixes #1283, #881) + [config] config options to stream request/response (#949, #376) + [core] option to stream request body to backend (fixes #376) + separate routines for reading output from backends + [core] option to stream response body to client (fixes #949, #760, #1283, #1387) + drain backend socket/pipe bufs upon FDEVENT_HUP + http_response_backend_error() + remove excess calls to joblist_append() + defer choosing "Transfer-Encoding: chunked" + asynchronous, bidirectional streaming options + fix errors detected by Coverity Scan + [build] update Makefile.am EXTRA_DIST w/ new files + chunkqueue_append_chunkqueue() + fix errors detected by Coverity Scan + [cygwin] fix mod_proxy and mod_fastcgi ioctl use + use con->conf.server_tag in modules + [mod_webdav] remove excess SQL param to UNLOCK + [doc] NEWS + graceful shutdown without unnecessary 1 sec delay + fix error handling for portability (NetBSD) + [core] disable Nagle algorithm (TCP_NODELAY) + [core] add declarations to fdevent.h (#2373) + [build] add $(ATTR_LIB) to liblightcomp_la_LIBADD + [cygwin] minor: fix compiler warning + [tests] remove dependency on CGI.pm + [core] fix s6_addr type-punned compiler warning + [TLS] fix return value checks during cert init + [core] fix server.max-request-size to be precise (fixes #2131) + [mod_webdav] fix proppatch mem leak, other fixes (#fixes 1334, #fixes 2000) + [autobuild] CMake check for struct tm tm_gmtoff (fixes #2014) + [core] remove assert in fdevent_unregister() + [mod_uploadprogress] fix mem leak (#1858) + [core] make server.max-request-size scopeable (fixes #1901) + [mod_fastcgi,mod_scgi] check for spawning on same unix socket (#319) + [mod_fastcgi,mod_scgi] check for spawning on same unix socket (#319) + fix gcc 6.1.1 compiler warn misleading-indentation + [mod_accesslog] %a %A %C %D %k %{}t %{}T (fixes #1145, fixes #1415, fixes #2081) + [mod_access] new directive url.access-allow (fixes #1421) + [core] fdevent_libev: update use of ev_timer + [core] fdevent_libev: workaround compiler warning + [tests] remove some tests duplicated in mod-cgi.t + [mod_cgi] handle local redirect response (fixes #2108) + update lighttpd -h + [doc] add self to AUTHORS (discussed w/ stbuehler) + [doc] NEWS- update to 1.4.39 + -next is 1.4.38 + fix packdist.sh output links + [stat-cache] fix handling of collisions, might have returned wrong data (fixes #2669) + [core] allocate at least 4k buffer for incoming data + [core] fix search for header end if split across chunks (fixes #2670) + [core] check configparserAlloc() result with force_assert + [mod_auth] implement and use safe_memclear, using memset_s or explicit_bzero if available + [core] don't buffer request bodies smaller than 64k on disk + add force_assert for many allocations and function results + [mod_secdownload] use a hopefully constant time comparison to check hash (fixes #2679) + [config] check config option scope; warn if server option is given in conditional + [core] revert increase of temp file size back to 1MB, provide a configure option "server.upload-temp-file-size" instead (fixes #2680) + [core] add '~' to safe characters in ENCODING_REL_URI/ENCODING_REL_URI_PART encoding + [core] encode path with ENCODING_REL_URI in redirect to directory (fixes #2661, thx gstrauss) + [core] refactor base64 functions into separate file + [mod_secdownload] add required algorithm option; old behaviour available as "md5", new options "hmac-sha1" and "hmac-sha256" + [autobuild] fix missing header in tar ball + mod-auth.t: no crypt md5 for darwin + [tests] test apr-md5 in mod-auth.t + [tests] do not half-close socket before having received the response (fixes #2688) + [mod_fastcgi/mod_scgi] zero sockaddr structs before use (fixes #2691) + [network] add darwin-sendfile backend (fixes #2687) + [core] show correct crypt support result (fixes #2690) + - next ist 1.4.39 + [core] fix memset_s call (fixes #2698) + [chunk] fix use after free / double free (fixes #2700) + [scons] fix fullstatic build- Add perl(CGI) BuildRequires in order to be able to pass the test suite.- update to 1.4.37 + - next is 1.4.37 + [mod_proxy] remove debug log line from error log (fixes #2659) + [mod_dirlisting] fix dir-listing.set-footer not showing + fix out-of-filedescriptors when uploading "large" files (fixes #2660, thx rmilecki) + increase upload temporary chunk file size from 1MB to 16MB + fix undefined integer shift + rewrite network (write) backends + [cmake] lowercase commands, whitespace cleanup, remove clutter in else(...), endif(...), endforeach(...) + [cmake] cleanup cache variables if features get deactivated + fix some unchecked return value warnings + maintain cq->bytes_in in chunk API; keep bytes_out/bytes_in synced + [cmake] don't put date into config.h (not used anyway), only unset local vars for disabled features instead of clearing cache + [cmake] fix FreeBSD linker bug + [tests] search for perl in PATH instead of /usr/bin; whitespace + test config cleanups + [kqueue] fix kevent call + [tests] fix warning about newline in filename + [autoconf] define HAVE_CRYPT when crypt() is present + [bsd xattr] fix compile break with BSD extended attributes in stat_cache + [mod_dirlisting] remove sys/syslimits.h; base.h already includes limits.h + small README for FreeBSD build setup + [build] put --as-needed into linker flags instead of cflags + [mod_cgi] rewrite mmap and generic (post body) send error handling + [mmap] fix mmap alignment + [plugins] when modules are linked statically still only load the modules given in the config + [scons] various improvements + [mmap] handle SIGBUS in network; those get triggered if the file gets smaller during reading + [scons] fix crypt() detection, other improvements + [scons] fix build + fix some warnings found by coverity ("leak" in setup phase, not catching too long unix socket paths in mod_proxy) + packdist.sh: use fakeroot for make dist to have root owned files in tar- do not use the full url as we are reusing the debian tarball.- update to 1.4.36 + [configfile] fix reading uninitialized variable (found by Willian B.) + [dist] add dist-xz, remove dist-bzip2, allow ~rc appendix in packdist.sh- update to 1.4.36~rc1 + - next is 1.4.36 + use keep-alive timeout while waiting for HTTP headers; use always the read timeout while waiting for the HTTP body + fix bad shift in conditional netmask ".../0" handling + add more mime types and a script to generate mime.conf (fxies #2579) + fix typo in NEWS entry for #2579 + add support for (Free)BSD extended attributes + [build] use fortify flags with "extra-warnings" + [mod_dirlisting,mod_redirect,mod_rewrite] abort config parsing if pcre-compile fails or isn't available + [ssl] disable SSL3.0 by default + Fixed typo found by openSUSE user (boo# 907709) + add NEWS entry for previous commit + [network] fix compile break in calculation of sockaddr_un size if SUN_LEN is not defined (fixes #2609) + [connections] fix bug in connection state handling + print backtrace in assert logging with libunwind + fix buffer, chunk and http_chunk API + Remove chunkqueue_get_{append,prepend}* API + Remove buffer_prepare_copy() and buffer_prepare_append() + [tests] improve valgrind and strace TRACEME, disable condition logging in normal configs + Use buffer API to read and modify "used" member + rename buffer_append_long_hex to buffer_append_uint_hex + [buffer] constify some parameters + [bitset] unused -> remove + remove unused stuff from server.h + [crc32] fix method signature (const pointer) + [tests] fix undefined index warning in sendfile.php + [mod_auth] use crypt_r instead of crypt if available + fix error message for T_CONFIG_ARRAY config values if an entry value is not a string + fix segfaults in many plugins if they failed configuration + escape all strings for logging (fixes #2646 log file injection, reported by Jaanus Kääp) + add some until now missing files to dist tarball + minor spelling fixes + fix hex escape in accesslog (fixes #2559) + show extforward re-run warning only with debug.log-request-handling (fixes #2561) + parse If-None-Match for ETag validation (fixes #2578) + check pointer before usage in new etag compare + fix memory leak in mod_status when no counters are set (found by coverity) + #ifdef all parts belonging to the connection-state debugging + [mod_magnet] fix segfault when accessing not existing lighty.req_env[] entry (found by coverity) + fix segfault when temp file for upload couldn't be created (found by coverity) + check fcgi_env_add return value (found by coverity) + mime.conf: add some new mime types, remove .dat, .sha1, .md5, update .vcf + [mod_proxy] add unix domain socket support (fixes #2653)- define and use pkg_name, pkg_version, tarball_version - use debian orig tarball - fix download url- Deb .orig.tar.bz2 -> regular tar, hopefully it shall work.- Spec-cleanify and remove sle9 support fun - Fix rpmlint warnings - Use tarball fetchable from upstream - Remove all obsolete conditions- Remove the debian changelog also from the .spec file SOURCES- Remove debian changelog as it collides with factory checkers- fix bashisms in pre script/bin/sh/bin/sh/bin/sh/bin/shlamb26 1585219682  !"#$%&'()*+,-./0123456789:;<=>?@ACDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijk1.4.55-lp151.3.6.11.4.55-lp151.3.6.11.4.55-lp151.3.6.1 lighttpdconf.daccess_log.confauth.confcgi.confcompress.confdebug.confdirlisting.confevhost.confexpire.conffastcgi.confmime.confmod.templateproxy.confscgi.confsecdownload.confsimple_vhost.confssi.confstatus.confuserdir.conflighttpd.confmodules.confvhosts.dvhosts.templatelighttpdlighttpdlighttpd-ssllighttpd.servicelighttpdmod_access.somod_accesslog.somod_alias.somod_auth.somod_authn_file.somod_cgi.somod_compress.somod_deflate.somod_dirlisting.somod_evasive.somod_evhost.somod_expire.somod_extforward.somod_fastcgi.somod_flv_streaming.somod_indexfile.somod_openssl.somod_proxy.somod_redirect.somod_rewrite.somod_scgi.somod_secdownload.somod_setenv.somod_simple_vhost.somod_sockproxy.somod_ssi.somod_staticfile.somod_status.somod_uploadprogress.somod_userdir.somod_usertrack.somod_vhostdb.somod_wstunnel.solighttpdlighttpd-angelrclighttpdlighttpdAUTHORSNEWSREADMEaccess.txtaccesslog.txtalias.txtauthentication.txtcgi.txtcompress.txtconfiguration.txtexpire.txtfastcgi-state.txtfastcgi.txtfeatures.txtperformance.txtplugins.txtproxy.txtredirect.txtrewrite.txtscgi.txtsecdownload.txtsecurity.txtsetenv.txtsimple-vhost.txtskeleton.txtspawn-php.shssi.txtssl.txtstate.txtstatus.txttraffic-shaping.txtuserdir.txtsysconfig.lighttpdlighttpd-angel.8.gzlighttpd.8.gzlighttpdcompresslighttpdsocketslighttpd/etc//etc/lighttpd//etc/lighttpd/conf.d//etc/lighttpd/vhosts.d//etc/logrotate.d//etc/sysconfig/SuSEfirewall2.d/services//usr/lib/systemd/system//usr/lib64//usr/lib64/lighttpd//usr/sbin//usr/share/doc/packages//usr/share/doc/packages/lighttpd//usr/share/fillup-templates//usr/share/man/man8//var/cache//var/cache/lighttpd//var/lib//var/lib/lighttpd//var/log/-fmessage-length=0 -grecord-gcc-switches -O2 -Wall -D_FORTIFY_SOURCE=2 -fstack-protector-strong -funwind-tables -fasynchronous-unwind-tables -fstack-clash-protection -gobs://build.opensuse.org/openSUSE:Maintenance:12187/openSUSE_Leap_15.1_Update/eaa90769400a9aeb91e18cd49f842a90-lighttpd.openSUSE_Leap_15.1_Updatedrpmxz5x86_64-suse-linux  !"#$%&''()*++directoryASCII textC source, ASCII textELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=ceaec64e8a202a40a4420eef7f1fc5731a74a8b4, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=b52b4dd5e54b0931bf88282f8166ca4dafbe1845, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=b6e353e3f1be37f283b59f6368f673e1faf54889, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=9d4ad03f93e35f25640046783099caa38b4c12df, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=e9543a668a32b8efcdc1ac545583e9947b96a2fb, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=2c082504e5f65907f6da29ce38ac4e7cd1434cb6, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=f96f59692293d9ed861d472f2e866c8371a1809d, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=f4a2199d826db52856253629bcc291ff8a86ad9a, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=73ca9cd775ed8fa6d12f9b05d5a2ba712ce5c992, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=a280c9e076d710dbf58df08e556e8e5c2c1789a8, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=fd060c29bb23b6d6727454413654db7554846e6b, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=6c55ce7a46423b000571234f2e8772304522434b, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=fad7c6f9b0f2921d03ce2b15efad9343ac1ce91f, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=73512ec73702b5d1cfe988f221af5c8e3b6f5980, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=df4cb59b0ef9cd1829d75e3791fbd68b7ea5b810, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=40b6752f3812f87ec8a1201a6e36bca683e7d4d8, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=715308f6375fc375aeb8a0368b2dddf521ba8bc1, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=68b2e779bbcaa3606b5277cd4450c9fdf58b098b, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=d8ed96a4868934c992f32577353c8f79873a6383, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=1739a3d48306a12e28373078cb17223c4bfe7718, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=e69fe60f2c74eb6b9b4e7d1588746439d2fb40ca, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=9b0117020f731e28ae8136e25a25211f5c22ea61, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=543724d9910770761ef120bfe1a081d7c600f596, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=0f23e2e96e706402ac03d6c66fc3c192ad8d61f3, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=381fecbaa743c6b8c5626b2dc1f268b575619036, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=477fd4def2a0ae5398c57ff4a22de2c17ac990b5, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=8799a723ded4778dbfdeb66404921a3100c0d6e8, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=da8b09b103f2531d1a2c04b85a4666b2f8780249, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=22c0ab375dcd3420916c927adcf1db8db176e352, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=35469d5cdeae381e803c5628ca304adcfa465dad, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=fec02fb70538b6d7850feafb8fd1f09ae099ce5c, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=ade581e02cecc9dcea77a6ea1e03900c26ef1375, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=37c07f8aaa75681968699111670ff974985ae3b0, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/l, BuildID[sha1]=eeb2e5f22d83ab8f5be993d767308ab8b08c4885, for GNU/Linux 3.2.0, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/l, BuildID[sha1]=a0c79c3a26ffaa55b008b4e7622184beaa9aa269, for GNU/Linux 3.2.0, strippedUTF-8 Unicode textHTML document, ASCII textBourne-Again shell script, ASCII text executableexported SGML document, ASCII texttroff or preprocessor input, ASCII text (gzip compressed data, max compression, from Unix) "&(*,0468@CEGJOQSUZ\`bdgioRR RRR RR RRRRR RRRRRRRR RRRR RRR#R R RRR#R R RRR R RR RR RR RRRR RRRR RR RR RRRRR"R!RR RRR RR RR RRR RRRRR RR RR RR RRRRR RR RRRR RR RR RRR RR RRRRRR R RRRRR RRRRRRRR RR RRRR RRR  gh O7lighttpd-mod_openssllogrotate1.4.55utf-8bd990f96865bd1f5446c8b904ed517076d0bf47df3e1da9466337ecb81d2b7c9?p7zXZ !t/]"k%{U}g桙Ⲹ9,Y,ځ_q!v%djȇq [J-z{cf(*E T:ב@_3U`l#>](٤M%s`Qۻ=kv 9b8s8@j6 J-w ocRTмس属e9q\pCqis*5!bZ^zϋ֗<q[UaȲL4p&IPpG=47Ȩwp]I1{Ȓpx MRqcZ[_?/*6B=M[ĪͺO!1]V) ; 4T<@IY'67SУW'qz*"s)|22<(Q23!+#n~Jևjnr{ MdYS*1G9ʐ*M|Ҏ2(*_?)?[E2ݺ6?Jը_+BX \zeۗS n[APȿjG'6/f1D959@T.fze ?\\rhcRuy& 2)f%~9,{kIU1C֮@vq5uʤM_ޕkͣh'TM|շ)^1:8ݜ!>͟7;L.h[+zǜ@vJ,etz[]35RTnC?WjtC$ES U] ȅh2বP0d~JS+wGL$'s4 DQT 4NS`ߠa{G@E0/m=NLI'ˑECK@\̆Xq|HyAQ߂&MQ̷}F2^4$_xq#s(ƇEw-!T9&9OY "pPį "TdлArVfY7ZFjZ/pyDܴO|e( PI< Z)g\PBʥ ODsMA)Oc*˷Cm{0;z?2/Y ƹOc *<;SXv#yD͜`L݄'{LAJDQ+K)լr({"+3+ecr0|)_VT԰-MmJRJuD5fϻU/ke΅`8Hx+ S'=;S|{*x?2fB\ jG@Rvp#M\(sxEܯDa[+& L`$dLE 8N$iO]We+]`*.&;3Ϊpw4@hD{MrC@zO[HMFwR2,F/3=M>I<э4L fR؟6®/EJzg]wҢb}ITHzi 3e/AljM,nZC7aH|<<RZ.WɄfXϜ݌+-7_\#.h4ׁ%Шt@ zCk3.E<j?Jlz2P@'2ۊޭV҇;Lnb*Boa nW jl`-o@)ewТ<r#>nujQʍ`)_!`Li_6#-x4kvэzh:3 |s#Bp)a0W uЗz nM)y,M`.7F4ybʙ7`JMbt86I'i',D5X)^]F}(YϜT. T>#Dr`nI.9;O*#0+9.C O.)Q޼TuGf[О'Ô[~(}o toqG"2o_ w;ɳyX%S+ze;5eH;& ]|hÊԴ`^~5-+'bzyC:׊zo9QFQ4/UQ\ 8JiznTQq0:-"e](M3>uJԮ$OɞHCӓA{e(~b$,62ܷnKK)7>B<0U#-9 )1)F{)c˟Ӻ0u8]d9FMwRBTP/ko)!]6v}"왈&"j :BK(n(3M&|+7K 'VPgQ)b,7nS#%҇z%k*B&>04\^2GEKY2rwUSA$WZ6RyhkCZGe [95tPBYk0TQY.84I8/z >߽՜ zc&>W7Ʌ4$\oIAxk /^a%. f) MP>GoY0޾fUwVL" f"m(o4Fkl$$amj|!֏4`{ OAM<Ű]=}H9lwML'lOv^$*å)&m1Gɴ׹BpG˞${iޤk86 #74.>/K-6oF&tk9VX2Pn c=–z< [|Ǵnax,}[C b$:닎~t$j;*p cO,ꕳ6l= O&kGu|հ.h.!\eC򓡗hNCn`|tq(HV |hzAa`BsBׂ4*53P^%19+{CkD^DکsɉH)d 2=o13jpHE] ?g9yKyI@0X:fo(haH'bl0mp +ظ*]QdcG0 yjĴ+H4qhy*~Sd1h1%BmP"! 3hS$^cU-B 8R3UVY|svfE_|x( KՃܛA7u"; tAJqOb4fiO-6jRvhe~<6ؤ͡HyO1$@yR'>ܑŎѻO 5DIg_]&U8ȹQ,=x_:>!+ `dhN"ha 8+M-$,^ .(n.e-m\JQfd2]Hu6@j"'bmM7 n ,F} HZrgãf#+2ucïWz`aEK2HkŹxV,9]sEKe'eÀ6B0$UM&l?ij,cfJp@U+%1<^ VXkN.Q3 0T~b`jb+fǮEA G|SUi$!N:uCDƿilڶ$`HyNɆcѺIJ8ݱv5~#b_ 2iBOo;{1QRTKS k"Yo(ew _>s } #EnW7xV>g&םF׬wi] $31 ss\:\LYh4u(`gGpȻ GVfi\Jl1*ƀ1 |_Eff/9|1,|W\SÒ䑆7nj4cV62?}tndُ+9xu &~U;=c w҃-v2W>cR>!H(qG JoXj("a JiҐ܏NNfqxoqA|CM++T Gtpdg\s| ERsO 9a؈Ns U96Wѳ~tF7qa3pAUR8NYׇ'!be"4ԩcI=:kd;)HM.]KfoЕT \Af:eg'2%ʌ'T -q_MjͫQme Nа"O:2Vyg麎ji('x+y A5U;,b vw!rMf{{]A4W 閹I<*5 9* p'ɢ:wk켷Nji?7NnZ/-t 鲷-׮ȰmIZ Uϗ/3N$8S+No13S,ձlI'1m}3w^,(h .O!TAgYC ے.BoaF?"?12߬iy |)(~h WQxu<9ݾ&γ{t彙Cl <7fjib%Qٜ|44n~?!N%(xr̰LHo_8~ g:+qntDu Dq"^n0A%{ J^7jš&N`W7RRqbq~֬*(S,^<7r~=)^;^mR\uR.&#LBi(vMpzzC8ciQ:jjW^]?51/rKuWz)KNW(P]}iQ,-tm/A<ԘE+]fPgYڕ'TS 3q9qّc22ؖ><s۸•]< y?;Q͵?-a5q(1c}9G}7M n2v+0* Ʌd&ѿs &(ͅ4L:z>ҬhyM~p] Y߱+YD\_K;PWKf=77gb#0TU8REՀo>(~$^ݾM`֕h~b>ÿ!sg0z:n/FnIg7-?k:1!$oJo"R4r"I-&c}56xSo uIm,pvIeyLCL#u4{;I]L'`ܷac#Y J Si@Q#:#\W=2{7[Il`\BS6|\'rAS^NAi?;[*6y?4SI<ߦ,HX !MⰶS-'6P6=(Ӗ4X%s dEvf('5UG 4.&&+LY?6M6)x8pDK2q^ "?l#:/qȑ|e6/Rp6m%ntڳy`%L `# <*uF&4kIT!R9{yvk{D=zGo9t )w3S;Iu5CiM%ʄ͐LfBm6wMf G͑Eq.*p)oZҎ֌??B+*[mx!E".LRAK'#+[w|EKq>r{YnZ~guX6r+(|1)Ym&o|vJo}m(xIH})qJ1\de; \cINZWNfk{+f0EhNhFd^O{AVLM{0fdGkniecj9?{ܲ ^h՝ꡂw]2g-cĢ B¡=*k)Ғ͓ s^wo6ҷ~<&Wfቪm :Jb%.7k њյJm(|#a1"\fw)S %a2G¥f$ 7rADYBT(SO~^sM֮z-PȃzH<xHCzSn&R< 6CYLtoۧڋ+* 16`vz9iII]~ėKoCUݭ< Zo3Vёt3 fiCV {17|Y5ej : aѠ|װ/(H>Q1vr8՚|0U]LsAU ,<.r:Oc Uε&Ӵ!F6+afi#vr7~]ľUzVql$^WiV=,t[!s3N8_$[֓`PtZ-S*/$>$| ]0&&@5E/"d/7cgKj95!}3IprdrVfN67,1sf/;:[WdVHj) *Kj5B4Eh (wС. xDg8Wo3]m2AWSCJWb"WrF-VS{h;&lƣlkNj{ lc-(mhf[- 6S(-RSs-Xv=M=>v&Q_P+yzyGD _kk-k"sѵnjw1(XdT\JNY;O/Z) -F"v`&AVħ^z^Gb̃膥X,Yrgy };]E$?<8/w{!eRLšс1ođJ 2H5lij6/o8y.>+d3c3< PR  ,zpiC@WJ7Sk'obO~v[`tكf|\ui I>N&@eև 1P|zJײb/-]{9 M{ VxIWP,uhmȕ@CZIqӦKWwѴk?]&Fia#z81Ƃ ߁=nޤb-밂íy/Ƭg6HJ0$25RppiHIQT*?<,:k>h)dAҨ?fKTSfƛRWPMq}TqFY\\nyXW7|/Op !K|XI~xV)5iT ?G\fHtfq/+o]i(`wJeCWQA#v gaOQk gjEu><1e92WcvXɳ lWr>hD+JAX} CiVXK$ ȸik١K̯u]~:3InOn_AyhKb U5jMUL7~tī[L= )[OZ#_{ Sǂ^*A:S# J?B2ŗ@˒ޚ?HQ`I0o Df:ʎOsQEbqTJ M30<_K>]6&NxV6<{J$ FX3U䨡-xDڊ&T';7q;x!{%$'PoMN`9XZ9 X G}8gΑÌ3XgHUj#vIBiXn0`&{`}JgIT#w_>E=T'N##J&F/a@pT{|-Z:|B&M46Q:tbTŕiW-%pKh+quf|xt{1%oVNÄ&1ՋKV6'a":o\4 ~JBېe^cWQx G.1m7[.a&5Yq;6/b}D&# CK3ہ_P,U.c,rK~1\! r. 0!ݛ&Oi,3 Y!K:kgyDm {q܍i\4?h ! {ooN-3;kQ ?~i~mwXeEFdY~JfTumWik!BIb .}ﮜmj4:oo#8*}T“g;Se J;ia!farkqM;Pb!%>?l<?aIYh1CXfY-{1J5R.A{G+x~ [QtO֐NQ [x텡kڬ4kd<݆DM5{m^q6eH͔M!DYbbIhm_9{5L{){h6kuj{L O P+w2U >8%ྣU;FBOB'=؞ZR ej I^:#7Y+ۄkF!W9;Z~̻:A :l%0"6{*Y;!:%S - zsɤE:k:*xFhr70D x[QYۮGDu1)q2u9{.x1~fXSmBgȓaD7d_ý "70,ϏSye˘YJ; `״)moM?4H 3E/g赻<[ 6b8' xj C{(xϰկqҚg 1UFEAg,@Oo;viCs9*x]Z䟔Mk76-.$.yZ <13I/lj揄TI@փ}&ǿpdp$9k:Ac3-x ]%Y8,+vީ\-$cyr)`d驄S 8w Pboq-(lxx&f-3l8.baY;>l *A +ɵU!v)17U^j[bD )Ydg$$/#(&w.#pDl];`tˮ3gsGݞKc"x $vҌ$d#D#&1\=\X%7GWۡ%{1^G ?HkF'7Isz((J1dť0|90L-:=HliI2,>IMmyO Xb0%$9KE[r`RF 1XĶw K D8\S,1L s6ī(، VigE9ف^-&چxfMX@ P2Mӧj ^wg-3. +W3"*&g9h//)ykhÏ`+"n״ iu )s΁ǜH5]GxmxkPe,=DL7+x,Vm.ɐOZ˖ uMqm !^4D4ƱB.(_CH56IP}FYoЛq;PZ901fC`>#ПS4R\ۋzR_F(KgJl '#*zC=LCկ&ݚ鯐$ML Θ/5ر@ZԳVv( ͈m呠oWf:Iķ*xQ5P`D)XQdcЫR׶3B0Ae@8\`u%TAP|a J(=:ü_%']Fg#lJd Q|jQ+TVv-`x3 3BYan}bH̢9j"%v֟(VZC U0 Wr vP[9si쉝pesw䯔?B.\+cٿ=(IAx)ڽ| >MP*_M Q5ݓnŢ*;7Ți]0v&4o,L3`ٖekKWjZp yk@'cI}%AMH5ffOцMr|pBBDX``KtaKz^d#]۠7Ζvը<)*heasa|O l=–'1(y,։W\FqC :vN!BiO?o +1+|"Co+TI2U'LbB` _eroXBM({H(0#~ʦQt1i{mz6lN%l\쇭QO#ݺjُ ÜDn!*ӄ^g_5O~Y~zI%NVT 0p'T-蒩!l2ФiWxU҅Ԣ6ۼmxD?9ȕ$"53 AO__iU qS,c֚ M;.#0q}s]$F 9JCmt^u(4lXOdr W@c:kd%0jU-+J Xt `O&d|JuDkmqGŕրщh{7k}"*\tc$J+azl3T9yUP08YcWO\5U04z38+"U2 ݈ܒyP -#ϥeN qAssyF%8s嚆;YLAGļ0œ9u_Ij'I1/߻maӝ -dr {Q5qXEj5`?ZmRɸWzI5 Ǖ( =)KBC x/agPSI) ՟*&ZO(7iWQYXsFG΃%dbV~ CR=,ʼXt ;鈷/"fsivVKlpz%ӄ u:Գ5mݒ`;qcM UeQA xmutsvNwyؖdsW d[?&ʪ.9+\Wwz_Td悉Nt7*k\[qHV:kaӾrO0eM1%TXP{@%?NLMz8>֠ȏ BH-@M/\jD pSjC1+de:sq,%C_#d23MjsTxm>(.y67`xpG9(M3|~f \d41b1'iO^R>dia6hTyWҜ$ݹ#r#}QpϹB݃ZiVH.-rSG٨݄: tX6F@LY߃XgSpK9RdI /_z? $m4#yPj#-l'd)l5mmO2,5<}WaSu-S3Q=l<{q&XoP3[GmZpK6O5F}2YDJOqweRo"<>5%^PџYU9qJ;nG0e69PTs;s$a^85iDS -ΡaN MIy;T|ҖXJʙVsn&v3|j@H,=wV)۰Yu]nD̋JTwt}|f}gfOCRڃ=6ߴ,1LZ8&^ln gk* C吪D.vɢ%']X3h/Dڋ ?y@[xǛbC~@4~/Oj\hVm<邏 ,rp*ji˃=gvx5nM,wʄ; t#!\xYT5[hZ4PZ/'T!),fgSv̜ Qqe-; O{Ǭ㐣j"GB#ezL=8_]&rb|\ˡ̾X<ĭ+@)[c>IZ u&w&@ƃ( mE- ڐ[93!ɸT"];Nk"۬]TVɱ" ϟoF'q4Pkey_<- xRhIDŽZ;9S*Di y͗_unRm}{wAĩ`K0+k 6OA agJ?B*hVYHDǟ@uG1e2I+Tx`B|g=e@ '[休)ǟ$1 ԠRy0g lQu{y5:qEF `ߕQ. gU@@OƐѹe:E*0)UoUYw𺅶V8nSR2fqHyK%CyRhsN#f<`6iDB]suo(dj dzD( {|TfI US(yw2B9?:+Ĥ7jLcW_EG\5 Whɛ~WzTgnz me dq?76EXjFi.)\{ҢNϩ瞍۽9KOQޅrАHs=3eR]!jAr}9+W{ ԒwiB掻lBVG{K%@Ckݛ9B2sZhDYEJX 2S;! GCl'AA r/~EG/OqM4ӹіaOb@z =NK*6aZ4\k ͪ$uܻd.rqIGjVutxroOq{wOeDo$$p迲?|4Yk2/YkN6?ZD\ ډT"HYB( ):W_[*Bi> Zw+w/jvӎ4I:x=^;1_) LR-/H -"*9я*E-?8.nJ=NjT/JlM.pLNx"f0^/[co);XݩV4uߢ}-EYDWN. {\Pt*j@,! O\E[EYl8Q8*u0x7Y Za9V iߊ~cQjOY馘z4P鈠?[G|M9ssBy͊w&^^ 2J"~R@R4>ģ<_^̙MR@L)Ijnvӿ(T$~?L%v# g8i ~MNoe n%f`ݪr(4!H4["^ٝҀ\ bVzRH;10\!(油6rR?7ģcPHѾRM U%&*5m|HC~-6uD^͠Ɲ ˀIu/fRgC ٺ*%m!4կ j-"rhTBrqgZzp>@o1=6 #< Cp[ `^<)d#;-ͭ VCu=h7œ/k$cbR{ӷI>2tՙ, ˿xc ~9W宋WL Ni4>Y\g [Nu=.DҤ1ElWm f(=ZsX;eHx@9*;VӋoN2Yߪw2k{y86@8 >ML,Gv L5IE)Xa|S1c 3>в:pTF+V½R(8Q0hyoF7X'\ a7QA;T9coa<Hwlv_cN->cV ޅ`;/Y dTZb$z.Pa$ߣƹc܎|]RTAs=.pr3ZyI܁䋯 .<33Qc;|%}8g^ý- lS}(-B ']'a"VoMz[jK3QU єM.x%<+XsC ՘L<5os!s0ruȹGY6.5;BMGU#$Gm,_z(>'iu,PPٔEERx[4lA "-Hpwq.]xՀX\Of k-zZm`bwME_Oy2# ^++K \ 2]*ș"lW9%j$וíF̖]F@ N'ț#wIPس{IpΖS @ z _orp;Ҥ?u1=\% v C~rɧ5dZ gDXD>1SRsJ*g}'H9u_N3K.H, +ډ9NN<ڽe %N+拘c!Bj"vgT["L׬>Z8F QIQo֚Nv2Om3,;Mx 4qӱVU O:4Nʎ}A"Mwcj 4wVگ8sMcHGkɷ;[F=@Fx=JuXxY NfKR`N|&yB= ٤wu!V6|s'/~_nG4@h ;~ԎX{$*&;&`ϨP1PKu yodGb 3:c0ڷ.i0afK'Òi:2.qme"W A5TUjU=#`+:\{5 x(rP@_GΌ L]ExY{P^iD *#Lp* 8U\CkJH>of )ɒ]VȦFq 8\~;\a\"J#tMb //ΓA>,y8g|5"LGlX@@Y94^%#!. )a=;il_cW \ 32T+?Kzz69"!)im|f8jZ :jF*N/0۳-g5ax""EnmBq3 yZKt}|F&%) 4:tςܲEՀl:A ;NVƿ<z+Mh 9n1#od^˝XĶ-Djm,ΎǕ_,U!ޣ-:1QK CʻɤLL`WEI|ͽG}? `;3Wl8Efe.> r Dɪ9=9*]y8Pglԍ'%gչ#8,R/}0}u^8lGsS: /t>p6-Vbiͭ]!5GMaZW,V 8)b]~E>M 4"ݔ, %vzn\ɷUJpt[?Uw™}xj;bQ#D>?PL>Gi s8#`lG1Sޏ;%M|lPg (YL|,`V{JψhݑXv̻E9ګ*D|]h&DQ}$XA_my=TbU2:;/]h]z{*zJA=8{K.6Hƚٞ_=}(C{ʟIבqNϠo=7GCs7sN`gRǷ5?TȚ$YҰqan̵9z9(Qp A}*f{A  bP,žk*Ѩc'[QnoM6 }vZ)XKղuɸ'|؄|f6vx_wIzLA>w};'Y{Z *ӐB{Ȝ0iYn<6́#)sh5?SהqϝUV,2|pݤ\u;mvnC5+V>X<bWE-Ќ6>53/_`iP4b@5+Sg=wZ PhW>t~0Miߙwг6gšni+&6"ќlӔqGfuH0 /qGo`QA;yUɡ0|#YҔnD_Dk "СÎ\lңB0J s0w?Q=C/O hdz| M;FHcedn"yb`pl,Hm+/#]#žּŖRԶX fMvJٸ PKTF{Ph' EvGZuoh]PpFQwūaS/lL7葞ٮ=p{-\ tZ !qRǽME&B;o^x=r(ۥ*?k3Pྭ=&=A ~)+"nIjckBUnhC3Ft9C,G8~wLϣ^)7ki#:%=Pf,Zꠉnq2v [&QR{k[VisXgd6v!ۉ!<ƽki0,OBOx7lZ@Q߇*i `R6Â1qzrUC ju6ɞ(ȟ]7"m*-wrIIS ,2%} "&|'pwZzRcrW $m\/+}% 4m?U׽вh*O#S7ybf1W9ݷQX`omAn?#Cs/B K^lm\v}#/i*P5Kx& v(yt>Q-Q2JJ [ Grf`ף@r)o!Wk U%|,eIѳ  Ğ  7˛O]&Xbi*F^< |[ +ʗikk Q՛j*/4/ `Y,yp9h^- LL&>䲡y!$D}9jl~_H١3nf-cAy=bṘ9WٵBU%Mn]!Ys;V5)V/m{4~ڙu*Ӈ|"ޛZ8\mB3x+腗~ar0 ݇UO[Χ'2 Gsh-F)>nO%q1tDI:!ZO%{Wǚ޲R3gVZ7a<&s%ky:)묷țy]/ wa^|% $l+ /󐎴xسq5C$#Oz ֶ6 E$ ߪl`+S "%s'mN  8%`{drs 4!2 SZ:U.Yu͒YtkvS1;%Sv Bd \DTlKN[a^3?#*Cvx'*w?*|RYis@O`LĖ_i }#sAbuC[ UDUըZV:xs/ A֓`/qbͩڢ'-ȂH%+d,4Vj &Xv8>ޝPScG ~y&cU%sdt#;^VɏЦRTao6󈟖 FA.\WrbbFht?­"ٶ] 6ec??*pCvWDŽD^@5# t~8y&LNݦرj}+j'I{\2jr0=qay R؞AP+OHYdBwf8."+m9`[JR`2)%sGS7r yY1ʎ/] eh9J="YآXՀ];A!&f>n/Our%+ϫW_\XŰ!bt2NQ^KmãuI9UKJ6uՖm:+5dRۅd2J8 \h2Bxv+}[b U=gdz{s^FVmA׭8fo[{\tl&q.`[)ndI^'R( l/ ϐL^qWCvbtɾd9~IxȈ  ժmb3 GGw{7>5RGߢl|JPV+H!5V'.&0$p fX-"f{{Ƚ&Vv(%+NBc5If J0&4v|8X*Bid$$a±풏0`(!(m}DZ\,/ )G-E5EڭNG8gr(PqjD^LG> B]pk4f'j[_'%Ey#58h2ڮ 9?yhuQF-AgoGG1K ^.,wZĪPrэ(.Vl[^XI2EIik'v:uh}}٘'YUR"Jj<׎ @BLd]}jrfWKCafj_v$.V4UrSȵ;!R ?+c,^U?5.$eHEL>훶͌5p*;"6 r=/G?)uPȧ˚|߰@I!rkJHM Ye"έ{a:)Dih7<n|&Ol2 Q" fM3df @4:*O^q( ܖ \px\3$[|"HB|+Sε/p}\=+ zTy."|h:t au8Y)S@'Kw ޲B̋NQ{xIuL~`aw3,R&cnmd53X3~e]uhěk|pC~ZF0O1-G?נ"8s[; o[KfTb@ l^\8%}"J2v;FCttWLZ6Z@KjZ"+p8G6X@zVVBTCE\ٽEVy!,8Y$jLj.3 eV$5}p"VBy]wb;ĸibAr*Y~cs=T=$:"q\݊]KPU??Ϝ[>nƀ*flqP8qQ0i&ÊaNaSmn*%Er;ϷI7_EpR]l7 Z]݃M7,Z7)U\_#PYCc-z`b~]X2&1 b>[rD됶$ Qf{mBL0AZ*e͢CDX!k Uǡ`d}Y[u1"\..qo}K#ߌkOR$/6IɽK=;$8Kć7 &]vm=Ylm180gnR;IH^z4ZןR6`F3$ zfM=PTJ:x5[w/`2j*0d9t᪁ݽb$vCL_]1n!HmYB8`HHRLnlYnd P vְPxXb(ynq1t%+CR|Cntjd@[BGTX B>:g)Mzoՙo'?>vT¶dS;v*p[ޚƫ>]R-.o9Imr;bu/z=[Q/Jgb'4 7ae8*a 3"ՅbȪԟi[;GklYk5 v*Q2kj IH+DL qL(i/[%٦,OC=ȟ_ WM?wwu1LHo: NYX'?֕Rme/@L Qxk;Wqf^ +CU1H- T%_ϝ"aiEzPb~*{`^:T3&X8~wS@j4nh㪧asxכ16 g7AKj՘_Re)O4r@ krQ! !`sC.@ns<PJimp}inɪ}6]L騿?[Y:t1iu[HD%F> 8e+sjI%}As_ 9ONU^1q;BF$4V ֛ J?ڃ{z-'J&u}$$-6lvL+ bx庭yEULx&#rVv2A1124ll?W^M\֕ckC烥4i+ބr0.KR,{1Bho,j7 z:ӥ[5,SF)O'9"6!7pOR4@CͯCv s Ė)BύNJCi"/\FgEحRn>i'X0uDky}(R0CjBz;'hI>z >RYat.7]w- W ~$F% +uX(Ȭ$YGK$]4 uxDMHCuyϫ]hjZ1RMD׹B.)}v8MpL&ꖘ.4MJ7>Pv$QAy-nj(_}d ,묳»p]"85/ [xO_`Pq$S3FA . .*M0WI=5ī:Ќ#A;*=//CԾJAXLEؤp*NK9ClJ`6r~7BZII+2NsUZfՒm>tlqBH 5f&0Wpy[/nQCjͼO@V&q9SR)uܳ" AuvP Fș/G@ )wl#mHσ7?C|L-4(LPibLF%@ )KT+EHu6N.WaEcf>?VH^3r[-xcHLi1])Q `ͯCfp8)6]w׫ Me3u>1c0 `0б`Ads=W2 ˆ py"d)nfhq7of+#WEAWF( Kj.WӕCN n}If\b;i#eCRᄱ^Wn`\pqo<Xymc"av,'c`UjT_XPTDzfO\ҹ0r6f\? *BIHjɳC ݧ{k"Ҿr?8ѹhyܚǩV0S|:||,92@h #"fQs-C^=ǡrh l)rN蕖UԒ\Maw}PI*?06gE]\'+Rx,Bhy 01ʻж}aB]I@7B yrhB;L8r~ ʒ?kQqͯZcsCBv;DZ@S~Aط.(5!T$jl!/ ϼ;}󈤯P{ +~- [ =Xzwɜ{}!KB?1?dAҬƭ t%X@z: 0Rˊ>-|.j4^uﰒR!,zN9Gz^k KI,ǥEdXڞ_ӖLv+GĈa SW%$ ED. /@8V'ٷsڙGJSZ:c_+͏U̐ ;nHb{)zu+*?-jo+и`b4ږP(rotӼ>%|z7۱_psƷ澘z6z[V+J2RY*JÞ' Ync<#5[![P0%U #l?3 ̷Qʬ ,Aiw<޼ _!)T\X2"X&Dl>Cxr%red"S(A<1m0`u7=9sAٜrw!XX:%t_ x;Ku KzXXgdYh3=庾(Hf:<n)F"&S㵲, ',Yf*%5瑛dPNULs_c&mwxo-ַG%·3/+ʤ?UrAAڊ0_|µp%u÷ c> %-ӟwqȘSL~j<~襧$SԠH`q.#R%' %mOVۍ4`PShGi;vњr 3So~"WL1BOި `}x }hK$?`d^%zN FD1v@L+#?Ɯ%K& Bԃ f-AZyPO,bsūFp:g.kN'T-əIED6q:SZw>Ҵ{l'U*5RY/m_gb1D%!D2̊H͸L.1z -Gc9 ]ˡMeuA6i',O=+K(5q@+pĚ+VZn TTW$S @^5 Sbl[KCJcn/xBBΓ毗-b2d N`# =QXەq5SEOfo>9.wo Kk\Z@/wZ/DNi0;m7ĥl)oDHZ3J~O ='-[/œfhgq FO;WXA\uQ{:7Ul-A"dv!2V$k$dEֹ2,W͟KGiDmhD]Ap?GsJEUoǒ(Ox/9J/S\;˄ d*'vVrO͵`q 4TD~^,-~9$pa.rs=Z ǿC 7o0GD횀rC`^hgֳ{]DQa\f̶.7Z3b﷐l8FsF+,iQ_fMީ3a4=xND:.BXk"^y*g-sT}!]˲ t-RF LO0ޕz'B#\ ~1kFcoe4yeHH+ݠz{6ty3 ʢ\״VJ 8{Z[caDohjM6!_EdYָXSxCFlܚ\M&DM҅SX+rcVޥKD”sp*}mzs8op-n[L[ᗲa-ƨ ô4Ng <>/ k9FϿjla<;Rf} 'ך=lW/P/ǝp?pC1m6mtd~((3G3o̊Tb VG$q6;eV0,^ю=w7zY4Ү3AQd #w;Vc_=@] iPywX#{Wt݁!9(ًiXjb7(݅X;_T0v1wj,s;yr}CY)oRR)zUDF1w6wuTy.S漷|V?J%SI:yqm!ˇWHG+87*C~KTG嵩 |dSsGf4☚?t֤,YP25_Wbv?D,|'|6,S @* ^KI>u ȌrF@˨WgKupD*݉jiSۥf0!mM^FJzr.Jslx\R}y/ ,y2yh"ɰ.E$o-*aʛV}>1A ZzL~cL,Ќ5>i5> ƔּZ /m`-Lbۀ/ھcJ9M?1$ E"U * JGUPqW%VUq>J.YO\nz_;RJlf\0̷}w6ZT; Kؘ93P>WYՌ.=[N{*hs7G+Z>cMڼЈ0{}0/niqD~$jobȗCXx@c6] 한먮7B@ӈW_F2[,Z_|[j_Stv>kTDc. vWyZ0ak= YՙѥUOqxZٯ_{Wa0W& =Ԁ$|+]-{dw'=Dl=jZOnr>I(8#iX]W)x1Ms8IS눖φ(/~'伮UezbrQc/ҕU-jm8t! I*ekZ 8k,n4RʴOpْ/#/z{B;uOJP!u~Hf^5$ pAϵGN*#{c!`B jwMF ̻ɭ/x˛Iލ*PO阶cs x|2S\EeK܁lT9Wy=etE@.ߴٷ'sȚ™pD!H+^~JgDin*a(<>$ 蠎ui] iЗGU s}Lș L O׸|:W[TJ;K.|dlKdH2q<_k0Bפp{]&Q΃*|SSeH=W۵V!mj;I<*8fz5cĜˁǧT tmP,N+P@pAN7Q/=ƞˑ"kJXSFfړ B~]i;Aƹ T<6 =ׄXD1eJk{X ŽY *1<*8}6Ͼq?2"F Bx qZBk&\א)܁2&̄YS H`Ƴ9)]mWmv ~z TBFaȽw+0'}/Jm:._1hOzj" Dl)1,p]v~,V[b_ء{w<⢒ (: 5YPhl[ؾv,Sv.g^tƷs_48ETޡi49AQ3@2T@7{/8ׅF 8Js߳ԇ#( d0׾ 쁙h~b ZVcf'AvJ/eGe66O{ kqkDY>q?&cuMVK0dDVt5#<$FZ6?PYcҳ`XE1f=H!\x_릱ρfŰꚄ@ j S/N.%s̀D7`B ׳?|Vm.t+T\/3q+Y:*8 `8z??U_*b8nX.ŕ mU-T6Jt#8_냱*BdPP6ߺ3y)?dPdP`<55Ƥ&&X3AeiZC85f+5#,2N:ASՂwϾo=9ϓ0-P[e =VW05TV"8ذb2j/L"Y|J#fD}mo'ϫ=r2}"I爫04 sS"$uΗ c8čGCcSM5O^1E on׽ vkò] ANOm?_nSA=h WWL,sdL<^ZluЅGJTQ!k^Ѕڠ*tkY7bGyG#ZqY7zu:, =29Nza]%cl+ oϫ:2K4V o īBURq$"(ɟq.) r?B*nq?{9KVo94CO)6 lz 1T_X`z-ȶ)qKeliMFfvF4>H573%B7d:7mwi Zk d5%|hӛS~%#C!  eE[=ƺ#Oj#XIK? T4NmcU.c^V|ZѥpwZp/'GCABěW(BWHS:` [zO=Sy<+ITֵ^'Vs\C@,R4GͰEteIzD뻰d+g rLpjG(*`kaJb0%\GIԼܒg_R-يLk۾R[Gj{*ݽâ d*M)MvxxCHo-/Rt(sʦLL{̥?FYs $րS1[QڊP2gqAN! {@6W (9wzC7lhW,C״T"es5/LXC4孠p<-jx96 4xY)LG)٨pb'op[Q4޷vvS:`KkEFrmVh+E"+1>2W7GdVEB)2rp/ i&6W&+]ZbXs9FRLa_TpaXua[P3n۸=1xNZ)MaeFzuV*aԎsd!uHTL,F"t@g{S$N ,e,2ybivrsMJvYPoE\lJk/'S zyN2;p+^Ɲ1>O T%a;"o;kԸ!W놲T818IN;!jN "7}-T3GHiNN4"$^+DOH6to"c'qcLIS`[ȡr{/۟3NWY_@Qp~*RZ]C \y4mtC؁j6o9 \3G*ߡ㥾 5vϤa_~ KQmʯݟ;UUV:5ٽCGlG-0&-g?6YպM:uyS,RxQp\%7ʰ&=0y ( W x>4ɩHpXR=FL9gz\hsmW֍z6>^,1{m_Gd3y-U jqO>4|ixɁͳaqH%M% Z$E\͙XKș(rAf,Vwk5a{Q )HF,:"?&Uن;ckM"*+5a+%sKG^3-'u>mxj#Z}z\!#PUq(8fD@̅:^ElUw`5FHbفL[;p|9G&^jvuW4;TԾDlǶK=+bHfCA D$#_6:9F'׸u_|Y:FI2 mYoԉ.ke";oS95p ֊ٙCOlUG0_X($]p*Qzq8BlXWsRz"܅FXNLߧ}G_Z'qoӲ %5|Q^o`{,r^YDmk$~ TsaCu;WV6b]GQܠ{.c'@:_?I>+ +-EeVw$/^:L7S{|9s.8mQV if߳**RsGXS|O܉DfLvh8& B˰,h'+ KT!K:>@g[ho2 |" "GøR`/hE[J)/xMK@/i+=J8Q(h>Y8g=Qfl(t0'VCSeb"?.%ӽUL.(Napq"sj Z"yTaN\RxW21eK3!BL%/E$Mi 0u<砉o_X2]'+v"[x^t…FaИ=Seyp$Yz8Գ*YY&(;VO6 YH@Vb^rx@A ?8RQ1#M8(1j{Y3\yկYR9l"" >T7cC}`Uċq|<:z@hACb}l/mo vu#Hz7eItg;y:*FUDܷ[}/9[>ܝ5Bţ[,U<:&wؾ3F{M9D 9lWVB:2K̝~u`v0\}x/7Ǝ?k-Pұ{/~3F'B۱R eݨR?Ƿk[M&4vfrfƢBl:LYWd"H "N`~A` Mb!ȓ`n]gxdmU?5 Oޞ2tDEhB-ڞA%ހ<0j *e;E9?@A&H˷vbnܔK0ݒ}ܴ`V~c..QiB7`3?׾v,̄dA =XkOaBwi̴1/ 3 ŸDfE*M/FL"d^$n>oMCf loϿ1뢋NIA)i`ܖĪ"v>@d!vT/ktM$T:pת )L(Vm&J=PPx9 Hek\\^ sBOC]=tNjs|Y 6"]㵰sE+[1@Q*‹;rnȠ7=2%=Z7G -k4ü3pjΆ{z݈"IsK-g-6U7;v,{&[b4`dӲo8Ye:3_DI2p!EK}v;D 2SwV։oup-\V3, 5*NRhEH ⊨ÒGUeVeýQ Rhy_sT4ON'o%%!-`z5׃ 6 Kz޹VUgP$}:$f2cZ,`Y*!wY U[XZPe>9tzGcR J6X>ͳK۽3Hp9J_q B4%Q0W"oSJ:pᩦp\u'bK: \4wue$4- ǒ\_nH>uۀTXtѵ?J{(:ҵFh ^'XbÉ&o K{5iqusEG#Td#[뻭zXv''Rn}))H

Xya|#Qc_YEouݼ}{ 8{2".^^a7oF$|ah:Wm[C}꣧2{+ DEEGv#*4m/rWQ:$Sd31Ǣ3;fQZ+B1E"I!7>Q֥;%CR8En^%cנ6*,W/I`qQN|s[u2Z*~tj͊B|?V`WAçK[j 6 h}&0 &:lM8PG 0]CN(Xi -GlzzAd  7¤jJdNyV}S3TY \0rXIXoƛ>bBaoޭx]#8)Q^,zl7\ܥ7S-Z ,gA_?!CImPYĩo%&]~sld!Ίg2tLMc;ɚ#_'6Vey,!Y|vK\7n 9Œ8"^ K7.f b{AUdɀT4kPxLskW(4Ւ,b2(:pGHl]VO)M6jSʥQO~rN 8fޗ4Z^, gm$>\:g+*Bf%zLdAïk `Ur&"o+R8Ev}LʈAUY 1,FQ1G1@e*3:ghЀ2C}rxqTք8x9@$RQ9%w:+Mxݻ_&6xvk,70j<'0H E4v^h#$#fB/%FoY+({!{7v<91FyacT }h믇hXx QBkRi(^ I?x)d.#?qS_^xU.&S~jGr@,4eּx- -)|C9(}wVD̰96,jt>}ҦGcV\3OS)=kf$Ȧhlm3AK!s'Ym*` *t0*|KYGv*% j[,AFOg3^2u0/*B޸җA…ˎ'13d_[P͵K=v{P1F5k6'fdx͋W.ӨR+t; P&F7Er?1'a#6qiXZ`CBWz&S=iK\ 9E%PVoQ<=Y17LDɇJidl:Ș`,BcNlqXZ82lhIΧO ehGvŒJpѮ/O?Җts;19Ұ7TQ~-)螔A&|x0#&X{HC49 emW#$:'ď*ϟWR%8:nmh!xd3UϦgF+BHNjXbepw'D=%\_Vɫ"v5Ӭ!b.+Z'\_FZ(`"B|m:%p%P'KJgl hs\!\Q;M+.~ƌ[ reB+ IaJf&WKú3)SUׄ"DnS%?yB!|_Tre.ATH&r PAT#ƒHl}' E8=!e1jDfK=t> #1-Zz*m$ -U'`S$DUKEwq$>v+ݘd05+G\4  6>w캬JH=&4 k]8G]嘉^NF3)/AlW`?"'\'n;I(8,> w ڏDMƝUcVY Df}OgUZ/8LvsPhM݊I|(ar[Yux` (:^gUMͰIkEHA \O6z0KOhxCYȃV,Q3wlŭ~JzGiYd;owl*K,%Vi1P+КӌXj˭X[(~Rvv(Nk '9PGtG.Rۑq{Bxv כ Ɂ.H `]hAy 3;v =aBC Q/]cvb9F.]!чr>p4(<kג#58mɉ QYA~#Qu _t vEjM+v;zܩ-9?5e?TBB& oI! dij/4g0 }$lkm=[s߃i5I W:Sdt:kLkw,b갂׎X-7 Lr)2Pp)e)B%j5o?_^8ؠ Twr玭}i5c`[MϯY0ۃv։GxU\J 4YAr%eazBRMmףY]ʿfLǹ6=>(~ENzҏԀgxMG劙3pTT%rBwmm`/=j -(jCbvZBġPpLG?v8N+ݦy?X=A9f.NO(K`~.&&^ 5nǧ9c %)JvC8E#P6; z4(;(4-re߶@S5Y7hؕ' * D͍aohn!7s}uu-\!"X 0 >DGk0]{HNv>s?j%S'TϷ~OЀ}b#ʞty:_<˳SNN`kzfHқAyoy"9Z'{XǑ{Ä-]%cwфcWӟHXezSXٚ"D?*m{D٬:#ֳt6ͩb)<f'-Icн8#S!v̈HɬY~Bڀψ esNvO6β{"rfl2>BGby)RƘBM;xC{8t CMgS:Eu?MIdr|t7IޫGV;.tYj%o}'$\sk,r`t2rh~Q!# - 2Z=˜Z3淑[ *EVhVț䓊#hH7ϼc,&l?̊R|"C(YZC%GD2LwjOeʹzkU9'P.K),%"gZ *Gg ;?"{Rx;~~QYQh*'\,#[!YzL'ҵ+٪fbv6SVlJ)2~r"ʀF Fl{vi O 8|k8Zzktt8Y7ؾٞǙnuҡzF"`u #r!V5l4xف^iimYap! Q"33|vuVjҸ[l L ݳ.3ZcگxɉS>5ݐ[QJ&OǗkqi)~3D,UdcdZ!Zf( #q<)&N%[QP9YQt!;MѠP6YV~}E}/aβ77L!T-fi .=><)ktsg{rff!T~@&x=xEUZLX]]R.|~^y[XlhdJ! PqxSc卶_AKgl"³NQiL wϊyI}#Ux`w:#0`*xgԮNݛ6x g KxVEϒOcGEw^?%) r|Q܂U!#έ$zġŭ⶧Y|k)JP3/~ *S mC&/R?o'p-gio  ӽ[󆬋X#lBo gP9Œ+_FeaQIu:Xo8e:%3>ؔ7hR!xD }x*bq]@< f!I"NA8dwg#NrHj}?^ -$$Q0lӸ &)$V.xš[|%%ΈPF71 yb΂DL-m:0&;+P&T3z>aLA UEX共Q[ 9fTJ^>z{+"!qU7o):cUhyBo>IfbӺF|Qei|!ecQrN*i`.lmnNkqͨU lž @Q<38#M`l;WS5#^.\ЫpMi _p}/P)<'(Є` $8~ίxFXWOMU5Q>:N7źB^4څoyae;en˺'ZYG\/S'Pj<Ve]>4*|?E@D#dOAD4zj5@tʦrx`QN~ Vz uծhGAԫͨe9?W& =^V#XktHA+ܔg@Rxw E؋~NH.Ν)^G0)'Hm9{2pY fY7 ,7}=Yoh7Y ɩ{hWCL kjCzEhݤ  a3j.R4̷XTx~6{QhdG [m!:ˬ r ݙ6Ժ >Qt!1'$^m >=bbI,d^~Nq̖D Hǰ eͿ" ht:*{ 0L{;Ik=Lm^@$,6,_wv̶ ;5oY5 Y3֣}:0b}.'+|'e麸|F n5ԭA0g( o&X!Cԉ A;f=M(l'dнI}#c#WWkSߐ&.yK1x=e{G'Vƞ)~>{vY,yY'ʼֹ=j `qC\:~nq^Xxc}|' a`Qe{ edWl%J7Mgd{զ'c^gdЅXnd! .VO/ $;:m<o0J/xE[ UcڞTɈ})#wwsRN P9x;ʨ/V}dzLnqx?4=nu /Z a6emFxtc}أس*cAױu@tJK8*5Wbd1bu| 䃯nz 2_)ߒp~/p"WP>WyY"N<ʦ[ 7q,?֨{~AgA?0&2丆 y^;yU-9Ox?`r*Tz 4w{^G?sx8 얰vPS% 3nc Qקu /|DaDJ[*M:ߌ9+绵3 LJiU&/CXՈ8#h&t33Aksv'20-:\T,ř֩YkJVSaYvÑƷ+m҅]>=Vs~"%(4EҳЙD+I"wK`GvM,ZY71`3CzFz AiƀdcQtOeegX2~fX k޽p9gDUGN wJvYһP#}4Gp[Ƹv K7eÀ u9|gL%ͧQzܬ[]LruY,|=PVIӏ E?13TS%^Q3Hx+{uaZ|;ۀXKu_AqP 5:Vz [~ kCZV]I D|aRcW^ _"¯JWiljaJ@=qRHd dyOQaA94sٰsz]dG;۵BQgPU-`zN ea4?(ik]<_)ߢ*+]UQsgvaTNr:DMܛ'iq@UJaL5ZTɽUK`z ~j!kח[n1"Kdm9HLC)qYR$(LPeKEzR(vIfy^̂Ε0aj On21s)qhlI4d9[-q-g KAX>7JD=U<|(]v1V=# ywmuo\]-kI-o@@19؜& t/pQ;d!-OtSZ;̀dU!ua&m6 gH)љ*Ju} @^{F+GI1JNpܘ%5D$}s9;v9CP8yft>^8Lgby[zXm" 88ߗL.[WG953Gh\g,JlowG3|t1$- A.&̄e][,q{)p^gFAYH) UGu7lr.7l$e[4Oo"^$~Y 6GF4,1P"?ZB/B}ٿ{"`_zfQ(lbVkEv8WV"ZWY^!RIV t8mV#7~Okb¢La~9Z2p,62~>>6yP(cS,\!ޔT-:3=gxޙ`oWQkØ/ ރ,30Ax28]?EeԌfaK>f >+[⾖aG3M:e[P&wWuOU3SؔHBx`oN6 sN2} g4 gZv!8I2{xqS*;h 󽀳<r24EuW"5B`R+ǨubXq1BSsEIs[ZjE랳ҧIs.82ao:T8{(%B6S9Hd,+K_ j8Vu6i2OfvbqԯS8ˊˣ8w GEHwۙllչss4U*IJcM^T *,@-[9:Unw`SȄMV8$i~YƄd0=q0;5a β&Ems?+?۪crK*7nݘNhU 4K?SK0,"-v*ٗsTulܡSk7Jgi+5I+yݨT7c!8jZ?bř#L̒|Qa4Qb@55\ jREYVWZ8o1U.o"U}aL?}'7?=ϜȤw[ֲvYvyUē֑r0s_gvy҅VY\R}%o e h: b(gD`U!r̕=|dڕlE*# (Q{'@dΈ~.-JJ/&W+ZV, v?+?p8p>wT6, Q3OtiE9n)_6%Kv33ɀW)er7QQ|\a ve.ZUv C|H^9ý_v!NmG,ב7kǧ59typE`(`貣i&[mKanf_BݽJJ\ȀFCEK7AMг rj,Qy ~.yթ@'TNnV rUrH_W?g1=D)kx>q($^=t#IEaT9P5 wIȳ*Fm_Ԇ=D1\7mM=̗,> $i@{J0q~^"/ʓd3V\U/;S d4@&&#WWfHO[fϕA"ڒ"k:ӛ4 ,pv. B p!+^LݴgestҤCְpCݓs=|Dx_B0cF~6㞱YzF?f'LI$mS>66lM$ Vc) |2jxZr?8Y݇tc1{Cq)Zw3IJ9 o^(ϣ{f.+ G+7kq OhՖ,,^_m$5tJϵA65,ԖNO0fXb|"as* ud%{uѶw}\*γ#_nBc#}ǚ`Or\L34Oq4i{ yJg TH"sۨA yN3f7:iF3>hVL"# )mTdIeP=X}^TM-xIcE@h/Ms 8lNndb]>m11C֧-*jtˌ4|-oxyK5 y*K2gRGa'sP_TKjfz6t%BG@`{/H@ x,Ϳ|ک锑rViSN0㿊;_6գ9H~d+'UCDh_0*E_[b7R65nA[Ò C  m_lݙHEٸ($S2GwxYghBG6%BccDȗ =](_VxtU؛Ȧkі9`Q;:H'rz§"Km@V-GuNJ\oMD77M !iy&Hz*jdꧼ;+'($OR"37bFߚ45R|\^SDd 2B Yb!>6.yc:Cה(,ׁ}aQ7Vp""}7Pb#wl&U&kԜPP$x߇>Kk !KvpE2pi_ 3r5LU>˹kBl ;ׄq/J|1L1Y'9 )WW˜7~F|(>vOF?m~߾F&]aM0\ ȷp%aQDƸ63h=ugrᅻMh8(Ͱgbx"Ej므i,yz&kg3ļue p>~v"q<h$`yrW4ɿ/q[)wFFĶ(%L>zdF=0 lmU| MяxFX #iZC`T9;@2t"l,MGr?f(.OH48+s,+"TN_TPH]*&"Y#*`āI !v3"΅ 5~,kJJ')h^p ,5NDLb|#WA|II%Laڔ%;ke 3wlqW%4C*.R؄cBúED^Peo͒$܀ tIm?s@$@}ŶfٺQ'!er]@!z6v iɤL00u;c~YsQ6ҐY~Cx;)Qh|߂$2nK=u)>~e)N-.7U$@CNmY5>eŹS&==>7Z)@v/h7CѺ 1Ҡ$fOk[J{UDk"ᶎ#@>aȊzyeIzhV"-tD.YDM4}#Rӕc c0>=sq0ܓ}i̫= \p6( JtIUT -| !<7688O7qr-K6g~y2 0^*#` zE7o/ }k;8\DE)KJIIɺ!=1mG_[ȬO.?i$أFFs0ErՇW\zm/!tR,:ɦp.IN"g/'#bְ-pM=T-D^//X%'`N)Dfv=M'7>RzL.%K%Vb DJu=Y.ˑA. T(~bF0 ѷ8U_i./Lt4g&L *O,-5K޴&sfZ:rS'C!**I9d/̏GY\v9Έg`O2YS$"ZCyv[?L 4黷Bwt.%1uXBV=U" Se<ǰ,M[AR<ȄAUBPn8ms6P\{,QY]Rt5Ǘ<$n6h]\GoWdR$;ڱeoɊ˦1R0jXPq_ ;&Y] ]VElZЌ 1GWWh rjr> [ C^ oȈELdNߜ "a'N/s˄sTQV4~lҭNeԯu 2\y2f6-}?0q21@"H3~7E!C^JiqJæyN_ n)֖xevNٿr$6PM=6鮜&8zqά`ZeC5KwR 'ۙP"V?WpRTO5`9X.:|o`.x:XvZP|47j}=X`z5YUZCZomg~z>TVU&aW 5!ͫX/ 8Sn_ҥc#rgba4I`Uk[56?ҤI]S-m_87 hD߲>h~4`#%++cn&ww>`.c 4w ŰK\AH+3OΖq,L{)hZ(2~qsr>u76زY݃vU:<2 S$ nO)AK +1 'nLcoY[3aA+N9W#@oƕ&sj|6@]rT| Q R+v^O^1i_J2\5:ȩZn?$a {0\JxCqX)@jQNݍIKF]oY [\Kĸf](5A׸N?IpjJ/rA%vҩ, hwO2Hh_I-x!7r,NEf-'uO'}M/@4uDDgqJ]+j!GX .@]r!QU݁?^ou,5fUC($ 1|8mDl]m)'T5=,âfORLrU3eS`} J894{ywí_4^]YYlk\ywin h J"9:)^lxqN}iCM+R1-rEu7žޮNws~J#!0<=:ľ4*`k{~6slx8j`j߻`rn&G6ddq^Ź,O_,%#Tբ )A_֙{ {ݭK@cpi \tK؆Z}\tn_?q#-?qH-8tViH e` ^x!&f)ί'waJw}k[ oũ9]>̓ՒQ8U/#)]B H-G}ΖB+g/z[a, %+̾KyIVR:E5sΗXk.ʂ!CJL,SƝx($96P:>zʡvg$? FU6c0!x>P"3ʥT[&H(T*F{_@ @+Ѕ%Əh pxyǧtB5h>!]8W,c5珂X疂mSZͺgsѳ6A}k%GmAiiDX`T! gȌTy*g>\ TDy9*k[8^}YO՚yX;ŴJ.UtCH㳶%{ /5D2.\?WD \lHP-5}\X%Ė*B%xi( g]L("uwwsX]o-.to7 Edlhէ"%Sv6\W{BH{aiJla/^auyS4L-aO0VB el~& x\)ʉ ъ*1RaaU0o!]È:S57zċ4zڜ_Vǿj,U%R7ެl (ޮh +ýbWɈhJOs!?I :x.u<BY h› ViXi4'ŝfCs/-7.uuJxJ:F`s< аl…nŸ&\M7W&2;޲Ӥ/#Pi܆g7-l?WiZH)jpd?If+ǥP((~.^T0+-qBtm_ߟ{z '53J[^:92Uc^m}PYO-c)\?C WXFU`n/ΩHU"$,M ܑͪ6goJ0|y<;gܛyqUO}뫿Gp?IѭI 1G{Itގ [!堿źXߦV羰Bsk6Kgzij5 AkởroeRx`cCS~a]WDLjJ6WVo-i]]r[K 2=Ű]ZZWwPaf~aj 22}CӫB;h% 'Iãs^9 L fB@ve}dLy'˼3nˌD m)@xۮ 2$iZRXC6 o dX4EO"ݸuINCY. n=Fz9)_|~NC {GKHDZWR)*Q8f ;wV " "D=R _i6;!?~JUÐڼ`P#u˛ %(-ζm՛ 놰IG7մtyt}}zgM3D&o m7^LجI%2Z۱އgG:^&U>>'d؃յoYO/ȉ@3ՒR\:p&q= X(Ic@>FJorY:8's3lUq7y^Sށ_gaѿX$K!M\䒘 Ay<4T4Nt؎^m.z&QTu>prYѭx./Bz+M΍mY)|/y y$d(QC|6ZuaW9d',&>!G!YCdFQvԯBwWXX_[$AuT1Ofd!e3 @_g2`v§16'@)=vIA{!@ס"SlK[wWŎyXwߢ&6*}e )l)c-\Go@FÕB\5Op; ΍':U"W?4QU45G]4!)3[&/OngH&lvX f` xr;ڇ*/+:L vٜ ~ZH;M] Zv;-$-$_ pkM̻@{ʎn`j`5a<+Ȅ,G6dX_s =ԟU S&J#֑Vʝo߫~t$*A|*R2kR$5]{* \iE@t[ل]&ߙ`*]CSr3:K>m be_ yȊ./%[whN5J+u+i*qQCkGQ d[S:YGC y?q$:1/\߄ܿ9j(iR7V0KIFToVxjvQ RIf)̳E@F5ČqX'~x[ ,_OzZ:[thxs3XWZ@|r.+PàvgIG8l}8:nV'HUaPϦݴ)GU‡z G&MQʂ kؤgJ35Є%_&j^VZĔ{@5PAN _UY -]0fKyҤ@~HMΎOXj5u۬`0Fd==;4I"9g:dJXĨ"i 6!)!&Mgĭr iBq{=jFr EtLjyϹ6n ҜQ\// ؙB2Tb_y)N}ھ8-]n̝%F3MO7_}E>=%y(pDUǼ?|*QuC E8pJ&3ɠvUpƇ :\E\bէt۔GPjJOBE9Ϡ}lhnU$`YrJw"v+iجO0z~Q|n#Xy/XE !s/}}\58 m"$$q6R Jׂ?mLXݬ&3W[)wCnwe(W*i'pKS/= Ey{qSPTfָ0 ¯~4xM @/\4ߺ a,ۛ:qhO5~[<,h dgY >YaAd; X!Ž/m\Lg3r:zqkErސFuT =agh! p0[s&U x 4Nα& PEwCDزf#ն\ GV:MG<'P-qP4܌WTzX~;ں4-49NgF\ H7"oM_6C JnI=aFŸc` zOB3 1 Vš%GB3-U{o?؝ h:ݞR+!BXZva4?^DHtSQmq/! h5[!eχT%>5&ofƲh s{FI5\#@JUGc'3Ra1,[/܂3)!, :B&7BL䉕G.u++5K84C~BzUPRj_*0 Ʋ+Du1$( !$:z>r!Ás, }It+HxD26|)wܑ̗OqsZ/97RaFH+AoOX[2?7t&Ih> fK&Ҕx06Et7 AL fB]*W*Kj)D^J!l,~; imV pyqӻo]Zw1~hl;=z1D{W%2,X#nկ@ޙqc9{?0OBҽ祎 x̏yqg3I#)~(^JRG$_EeaŹ ^b`kHH~{E E]iU])=9'x;L^aA9T'ӽx$^)VKOjJլ/5JޮN6fiCV?n qC.H8O-.(3Vx z_,"F مozw}vfEg_yLB!ɫ'e{]ˀOUmEIzwZ.E H\3֣ǭzgi ٫ϴyZ"NX1u p ͯƳP2[]C-UBvKQqiVC)?[ R13j ,>=n1%C64Ƃf؉o)xv5o;sdICy }ӍBŕPi'fD`"zoՈ=z 8]mo#Pi֞-M9.t *R?.}Pq,OqAL[`c6lyj>8~Za?AkuMւ *뾈6ݶ5[IهDToc:ZmlϧO^OM@pմ̋f9K:$kj/?$DZڋҥ;",Oa''S}:G|0 byOç[ Gr@.` aR$unZ'"(EA,>6jqy1oJh4O04)*aH(| ꘋQEGzW :[99rK{2! 4 *CsyT ,ًDǣNڜ%-ﰻL+(LwBЬ~8S;mʷi3t_ϼ&.I$1V&*˩ɈRHgAJ@w3q/љ9fe$Jbbɲb3.y;P`N$%=L"“T!b MKmO- 'B/#q!k/\OQ"("E4U vu XׂKP ,Dsx2vZnfs|~.di:eG Klz5|O.Lv%hR쬡yk 4 >~s.4RoU`ǯsKF qqi)ΝN|d\t_Nf@]#Mvtt|+ĤE ޖ]1Ju?^)7Jh@$G]@cߥ-k(dEW sUkUyơ: BW:WL#n56o}sJ? > R&$eňoƝ@Ғ9XRZfqȏk mC2tǏ=# c4/Q`v 5/%<#m6kU) bS(y $NsoV"r9+9'V~:W4G+ _QHj~b 0R<*EI1-I_=9 6FWP^Q֏N&g0X \GԊjJ^pcfCm2ks}E5aR F8X_kJP]㊿_>gvS 7AeP}ڋ+8h&4 9d7E}h0m?ܮ:y6~I:"L6* lث EH,ځ# N=;dHH糂=j؍"{v]|ȄU5}W-XP!-N\&Qm>ˌQ)@$"]dB=E[kq苷߈ 企z yuW,0q^׎g-*!MȾR걅!UX>y1]"CkC).AnyTz PivqNre?|> ^?Z Pg&°KmOgdk)ªoIoM9OY 3SoZU!8 znn\JqW!' >"2Y0?#ǓZ3V–9,+Z%kNj"9&qeh|q١PdO! DƉFv4n9/IoZwU[)eDX}ЛL7I/PT6/2[[&s[@\0oM}SZPw6kSwrє(c iHGԴč3v**g}Џ6xL/iQٯB>ɤ}+,b5I1=˳7+vm$9D_Qj9sB{>(JM)^kQə%GxLyqXk" ]`̘ Pdp.6>;6r+^ߔ#!v%6/C3rG.EUF3,Y"O@yh43iلl e,]5BF< 2N9OGn|PQ1}>/TpA%7[aCh*k6T0z2P`aNVeS65R; 6jPKo[ G M@< E-^6IS[33gxh2 ; c¯4AKp\dzs^G#:B]wl"Ue)Iѱ=!|#yg8!h6х$ F0#Ln`s۹joT1q$Nx~ׄGkLh+i0^,ilLe] Y+<(>^̥84!:h>`1s;zQ lwB3?vi!jNV:4-Ti}ٖg,fіA|kHh%3o:~Xr4`jQ> 8ߊ 1WE?mCF%X1iN@Zmj1G eaqBT.7 xe,jfk}B/ýJXIPӐ~$\1{ HJ?u "Zy 772nG -O {tJCUI-1TTێ/WAN}]f۞sӉeix/58F:\v<[H5%sW#_WD!#2{~x!!v gǽI3!9f (A,o QZI;eDBiSl"nA-*dW@Mꔚ˦%LK210}л6SS܃|w5QcO<W֮] 0&kvƇn:@ab0;6vа3Fx|y穝&b^8/1Tbn7{})xH#N:(bQp*Fm3+fX9'+&}sj_9|zgwZ9:BӃ <;˘Gh74d77l~&DA\~z`)uI헥Ht}XEsʍ7_r[b]Z)MU]g!2UcYhOcHٮAypWU  mA-w UrH7UeɄz_Y.\|#s_$ fE'|5c`rJnB8!NdzSf f(HGWj;}@xiֽ&-HWk,9;3qkUϺ L3w؟'[!.VU#0dÿ,=H͕48Q|#%MB)\B!-?+Uq.Xe3sGoAo:39-h}D q =B+H?QO!J;H-]c@YG6CՉVzdRQS&&‰HS&A }E- MJnyUs x>Ґ06.IuQJM%kq|e$HGF ro 2Jݾ`$'Yw}k(0Y.BYlEjqAo:>%3 "8K u:ZT ؝ZGZEؐԲ޶ 32Bc-&gK}'O#D$]ՙ81 +K)N8V_gX8FD7 }m*2m mOzcPuׂקi'KXF=-Hk&wEMX0bc.G|IP?YS* x -?%%fhÈMV/l~F]8 ђ'\TYT'x JMyFHzYb`Opd#ǻzYCLRa[j|\ v#b?: r`@v=V>tAw34[ U)y _ywg|Z΍ԁd%MWYO=JkQ"8{'ڒ苙4Oul(jo(!/ 1"pHAAXQ5ki&cJse;Ϻ$H+6G{6m(BAL E#ػ@yxPQPHN5~#.z\-)ׇa=iޗ#{"*tl K%wəkuqxx~] ʰ#_Ȣğ3P7CFcqQt69  م||Qbma!I=`q#fD3?+ꎗ=wfZb2 } n eQE)}Q%j FjS'fV9f2 EXk4(XlQEyM`40C:9>} *89t4|Cbo#{հ)ĜsH}"߶vZDz_. C遗őp7jK/vJ-ݴ8qݛ$wD}\XӮV;{qS㫴>uV'G_2I S1f mM#1MG{֊q J&tdY%(j![ d=Կj_ˉA<TLt^gtSk& w0;vl*;*/;CnPdRe}e0pG$F0^O83DP: c9SE$ ,ޑ ĎeY-"q,6r:(^Q^@P0 *o| oL3H& (f2K\TMh; =߯I썞nm=Lܗ\x^by3ł{ ˉ(e5B&u։Id()<0o gv(BXPBBV¸"|QbPcfص ӝEvV[_-픩Θ`٪tm\>OS!t&tfG':CF|8>!j4 t̓A^|U6sEmG{EN!5ŵE97 -˪;.gmnFH~hH%WAR}+MX(لv!a"6!lb(賽^ΑI~V~==B6,d;K[fMNaȚo;bq8I #[= (qN>`1G!Z∞cEε:ʦyyw ^7\:uf+ONF} fV- { sQ2- %Ѯji gヽQF9HM&/}ʬ;F1*9)]P0h0iC'QiN}%^ڬAvQ Oo]#((6p~:^𜈋lkuསѣȁkiH;q D!(= Q&nnC6nnZw`gijVHe m}"x ^dIGbVaa*|(ny> d :/F}v2)6=tmb͛oG4¹ > u-60,w|E9;n;)#Yif,&C>%W$}m*`Vt{O_"TxG`AΝ֖X[d-fZ1## B^}\Ǘ-xsV/Cr=>(& IʈD[W95AV/h ez#0Q4N0O2&0R- @!oCkjWψ]:hzb(h`AbwCݵzuV?$i+So"LqCl վ;"g;pDK6H&&I r#_R^A XJ1.JQ&4/^#+nXPI[zt1nUN8!\$+uk U4T\Z%6X>~h'卂fϊYIDJ]s8V(##`'oQG3c0Y~2fK@2FGmHXNB3iz5.6=ι/Ov"ܪ{_ 0`󜾫#BkU"4ԅIݹz&=E p45in8u2| Cerȣ:瞵7' 1UE q~Ž3u;C 4|l=J/% Dn{`T [&dӫy9wZBrKz  (h_o^iGW/Q1$≈dSfBM+7>lˆL"Sސ#D13nUu`$dK:D!x,qN枿; ؒ(&`EQJkNjAC7Gi#5D  x]Ϛa'08*{~=>_҅'[dT}ЯkkAI5e"8jvqEuIlK9!/ۖH5U^+Je/ 1Ak2fǟPz=S16MlS%~m KRrx`STT/2ğevhaVxrt,Hp>SViIS5r-`E>pUK~X.yODJ@W-8eB:S8?e6\DVyINa@aA]G"%E*~{-g@e)[H%5$emVE(o$ֽZ`\7b6IK2e1Ixp㼥+|q꛹%$C*j@NjnxG oGei>Obvpxd)@5V _|x'C+w$ī.ȏ_zF[5SQ@gNX\r0?O}'^f뿋v?^uDZleݝۊ{(pj. 9-Y&y@3+MqZ$9s]{gg?)U,9 Fgk8BUع[^VWn:^Ad|(% Ew%RcXZ(UG_-VO G!(J(\jP(l |鹢Vnx%xt sw[ԓP.=!u`[,]  Lnc{w&y(QppjwZIb-ub,4ARErJƃ\XX!a?3Wx>H'/vWD%o;TE/jA.~M}eˑo& uE!찰by&<Q(XpsށX*E&9bI<{m5FcSř|E{C#Up+(F' 7?a̾`f;+6`h_k;Tޓ5TkFKGaZk 3Dm_$ySo0\ Lx^ޢVoUakwj 6wJ'sc Å.z!Go9/mXC1cfv+yOm;7XV;MtoQ%2a}tͿW?HǣprVr@66 ,b${J"vw=T⯁捚gS+Iov+۬KM߮ 0QŘi{w"i8ʕf03Emޭxt&IyxZzvtRm~Xp3' U/o_ӣVAYp:lt,ஹ60L=אV tm93;b CPV$;.,sH&-c\4$vPlF]4*@mw βx b+}ZF AΚ\܋I%ᡘT7:Rgkۇ#y!vUcj|ͥvܞ gglفA`q!lzDHߧp4r0CBPwʡlY;Y Er;^SZLOE~̝`IRsÇ3]u?ezc7XBS,"=i|;s5Q(!BLV; 녇 D׉>c`!w}1 t Dlߩ_f"5AH1\wպEoT&c+=v%quYD<>!*!CbAYUbe$O:f2wM5kqk*L .49`KJBAom kCk嫼 хwW\ZW8Na(/R/7!=n!(r47$KB\6^[9gpѣ& s6& 'B %6ykjfY:Cgޒ. w R%)Fk4fE5Ǯ,6: TCR{~IMh}i7p#! @6+пٜ[G)nY-XŐ6C9ҺP Oo> :6BPas1wi3\VYXqLC: ݚolc)ߚXL-;XиXvy#t#&5V|1 t:R+ıЀbTi巁PϜ(hQ'()^oVnw7S jP{3X g{[ @d!WS4ڊ憏jy+!CvCz~z!_HAwHI YhZ_߻8 t$? ȺJJԯz%M(y'xH;VR%Vʗk3`i)6s6*ƘdmOe7Y?jbIx^KNEn= :Rڦ"-W].IRV;hJ %]n}c-돜J _ |+WAkTEQR"P[K%&Rx ᢩ_QS( ˹*wC[`cL4Q.RQifv"?9.5-.5)r7_46(mVԾ=ZK.0TD%`O+<`ث^[tgӿb١(J0`y7!7/%l`;kID#E*E8 啥:%#QZ0Ԡ$2xD87GCsd'LG0/߉^JYȽNDV*.1L4[ tmBᄀ$4Qu+`bs~|6<ٕoϘo8ԙc<;d_\E\u)z8=0a yfW~($/=p5e%rAe<(mA2HB8\'ßLAKu \!ĥ ,~RFxA<$?i@SB%)H76g^&4|,:ѕaZfjdM46u~r2i?v@QW AI/U'76&EVC^b!h1Bw]DHyzRt+K\=ٽf/F^ypyёpӕ&(y/cweny,K'I8a/?ZrF|!q[⺫ƭѷVm5CkP myDϳa~=Owp"^~e|) և1x y6R~<cVRzuyIK%\7ұEq q-1䵂(\J&t0ID67b-mc sD,t B!;s Cis^$O: SamhN5(2NN@8c/Sg4@WhZ_P-S >#/ H4D"RVUz`lXh}.#?gJZ&%8@'])T68c;_aڰu] _)BِsZVǦ(jEW`H1ДFA㐝x.D'l.j@uN7-Glߋ|ZR/daḧԣ&}b1 í;L+vM[y9n:>Z>A*$Smaٯ--L;G~\6+;ػ߀Q[}o+:FI>dd9440`Bۈ"zh[xֲ mwdiv7aR*i 2BMJ|Y{X):3_ 5w>'::֧KVČILM9hl^CfJGZG}}´T_O5ѽ x>E;=>x蜕k6h<|:h/n, rpx*P d9@1m> )B)pZk.'2\ !3 Y!gdUBdRtyوoyCHRD*s?tI dw@rn(RbkVT5tj Hb%"LfT̅@M硎fhhhk?Fe2:F.J9BSNnzY T׌^RHtFDVћɤai3zmTŶo% tU}* gM#đ]g Ji3璙2i56VW=qdk4j+@hC(Z8,~\yji"IXAF&z}XOo˦, #qΨ5@W!r%*M 14Ώv~(f QtܥT(_kp@ 8+lZ-"LzQH_1'!efb\8q5wʕ^mjgv Kv^Ӊ(GYWN¥譹}t \3N]nU?9s! vdQ:.)A',BD'z#enQ =#A[y+L\}¢ Vު.uep&|ݩ>=Et=w-W81EN?pV1  6r+0W[ {S~)\kEZ[Z86 +!/;GΦb\FFY%̑yn ';]zY|K&'nMj4|g}(u ֛ p-% vĄVpnZMsG[j{VE G)Ug ( K+n#0傛|㜵 GR;huj7rI̙7P6|^Ddz4m/-HG+]jQcrB(b8?;Q{M'b2rxMqb;g׫`< 1>&j-wܟ9WcaőY*Z=/cY 0.W4͐}%I"ayW mn:Wf|u (_},G/v&Nby&Ѿbp0ʴ{ Syg#w+g)NU#5f1>xȣ@%z!&G+(ai-X#GZzT!-@Bam<( _VSђyZfŇ}4bOʵ79q)hM4lZ㖬uZX;Pa X\/_7D6~._0e/[5'3k/k6.*?P{3oiqXh*&Ctj&mtP. "ľgR^ S?l4!wW3br{Lmъ:@56)STV2Ih%VLUcpw]i860i5NՁ\ %wd@c< qHT X<\ŔV'{>ч䷭Btg%JGwNJx8~Lұe1,(X Slު$Mսqim0ENM@{n :'=sD<7Ukc6'uyO%tI;Bd/%FOI$0 @B.LQ0ƴCsbLRW4>v0C7'Rx(FAR>Z*GT@Ƿ,H5%YVC2p9Ao# śb,IXѭ⫈EZX%jk9Ifuo3_;H(Ju:KKU1~ o{7q4E?{!}/i XCP2NQs̏TSq/8+OdL"d&ňWP=ܲ^8TjW9ʷݾ@l'⛭R[a5B 1T_C?6W.˹jrlG۔i8fa^C9ZuJ_a8HWČ='Ova 򉠜EƨNƣAڀmWo#xYBwuVa9L76b߂ BH"cCx-6vH8%bxc? 0bDe5B6*xbhoq/'IG;iJ9074eŗE5;QVȉUh xq]e TCYcqLiB˨f,lqb_B\Ffҙ{aW]2.~Ɔ^&6fjO&(i ZF+sh,f7ed:\Dz߀[ɡ)n jP$8m9EV,}e6$]?5_T4\p0R7/zr4G)@`Y힥lun ]q~QGH#F sWO OSYz%zM0O/5 A|oOA5ƫ4WwXL|%J C: _A@ /ࠜЄΓ`Yf7ߝZ&4Z~̞>ձMxމ)W.E bs u)+RJ>nH@Afef+mo9KXXcQk'#4/ڍE';y{jg2 Yd^DxMz]n+ˮSA&2+,/X3.yZj^w :y2M]e4;YUmV,*~Qwv H&lUw&61m#Ңwe#9BjEW/"7{q/ӹf 17 ravl&[\+@K#.n!ñlhiG<-k~:"w7 e}(rk@.Xy}u數99[*@<M{mM,@2d_@f UXP ܐ]9-JdYkV™f"E5b|/5fSԥFQS0\VOdښd˄]j A>}`qD%?0M}>kxXA>k@\DwojT3Ƥ#^1h[8PA<ڙ@t86'â;, yrȥئݡ}.rP73|F޻}U*f_ k麮t˷w|$%ղ|0Zol)(Ur‹֔|/HDffU ;1b{ H|uȟHw~ػ.v2 _GĞ$Nd$l L^GKu|23/Y9g׭|hK18z/"eX[TnM-znO.3G*i'@$[pC}"b7O`)Gq : SHOf~zVde,Pޏw xTbt]hұ 0Y3b 2U_jKT%Gu˫P:^ Ai,8M}CHUiϳ fs+9.,+@*L2Xr;ףFp9KM0#'u_\0|%ѥ7R .ɺ~Y2OJMʻ{SÀf0a5=qבx~2LH_;A4Tg-N1?Jd+Ueb=m&nPNr.r*-F Hך?!J`zϳ_*1X(crszBqh#!dn;\cVSfmosS1A+@BĹR&@aVx'9 {K,6`qAEƒPrlI"hAF"0¿t6+6/$m^.jF)G7̗odlϖ.ɇT b$og; YzDD(9p*9P+)-˒TyX7K"5yX]CrO3? PPD424-qTB?;OԆ3Ԍ1DI㺥fmkj| 1l}4 8'Xpֈ?+c4 Kpk6wHw ǩ%]D˵fm2tFYyprN56{3nVOe 'VlYnM;d( Tr% 43}|gv{JxB S'qN?;HGٶY FcT85] q#i"eNl RxDh_#2`.b Q6^4v h[H3 SQ[sKmX#3qSr-WO 66h48mtk ";B 2f1 ' ⫈K)]~F=쳁 NZ=&u[jPa4WƎIJ|9ުV\<$=;n~M0ٕ/%.SQGvnMsnr{ QtFYRW 4|(8Q8{ nnOJ)>pC{G2$P;M3kEndkJK{w1}bKO`fV# UzS*@GfTeF|eKYTz!.Q8m^d9w&K܄IH(EO&C'6Z١wUtS7W>Ѹ _|M}ۼ%+[)/q X,5 <3ذz71D$kt*ixۙ/nN2,+O<})Njk8qøj֍bD  qӥ$lu ^\$) 1f_hr]"ǑJUu%;hx؀*!2 f4j&2Ҽ#vkG4Ūh\%xF`7ae0ĸY|e"%XwZ##w<6n_)e?FߊEAh,lVz6qL]؊Y|`?Mbm]yk6-(|1ɀN^3RBa7#IF&ZxZ|- MRs_Q'͕8 wHz3˙Tz,[S% 缈sv=, 3=+H*Tje)<싷. >s u\DP;Pp(mT#0*=~\1I?ɒ(8L7sՖ;lRٜ|U]5 ;FFsg'cm9ZEw8 K빩l 3(۫CC}Ŝ  3z)4H?WJ?[(*[zG'#Rgݮ6'a蜳zc}SS8bp$k5DWu,&CΖ$$ulÂUj,"qOeYuYf٬Մ"1@ҷ>N0lD1.|93g24vD }:#Zr*._5|;6`OfN#`-& (N8nP +W枖] *ˎr3/xT\@=s1o˧uW1G(J9 & Bԕc׀<4Ckוv%r[ohpJ[- ^eK/G[\ƣ:6 5e/>[Wv8*˩v#@uI  zi>Z4%bo;u_'D&\C,MǨe}FZ^n)+2YڞY=ȡS- +ɛ[~2іX|O;TR&&y44@a| Vԩ9pC:m;@uzCD}J$Ea+e6n ̠b/9eMA{Zz ; ztA`fQ/.Ƭu Q3-ؿyޟ'UGU#LX|%8Q.b[K\PC}*:7֥1r-l`[ofh!`;XL>L0|4դAӈIa 3;u؞ /bԿsQbEkdr.D`UӯQ D7!A'69tPҶ%qB08lbbK/y48q G<ZjtN[j,=+1VkQ~I/E+y%OKL 4LxGn6f݆λ NcV]94~vEY-=- 1#`qN51IEGնe &i3օ|텙L Μ,I\ƹVi,쵂9@,ʔ+Om^>jW[DW?;-,T}·&[׉T_vL~XExqQbo4Z'8%ntcDNE'cq.NoonsAjI"!!7+(O MOlX ǘ&!Ýr7`Cuۈ<;ۂMZRNV&`ZsfhZiM`2 %~ ,~)!j# CB z1HX3h/2qx Lq 给>42bOJ5LSlmQ!x` f.0W7'W`Z9Ufqz]Pru[PJKh[Ȩq{}Z}h]5!֠^%qe9bQ žכ92a4?Gn\G=?ռ:9=z"$b:,F#ϘVZbyzOd0ދҢ$Q<$+1 8޿mrG~Pn_ t7%o:-F7誂E;R"R=χ~Ԯފ(ܲ8kTpA ĀτŜK(VS(>^;2yi ELis~3Eos =B~3I KՓHvNz650_ZRǗ+gpGZ+^d^ۙ G >WU/}zAb'RBh鹦)4]-8 S NڞBfҾL p-xP"_N}PceWHK`7O~.b{mrf U`#`b]fb2dw Q}iV}d芉\'Lo("gw1ˋ8yñ˅9}R `=mXlVR(8ɟڤ,%K.; q! 6E D,!2lo6ȮO~,VR$ ŝƤ/m)7 ~Zy'y`$SXފN*!0 ?h573?.u;>a#F=P0&b*Zn`jz&^~[^-h ԅ=f͵b!vYRy:""wBHI*(W{LԔp /aߔY9H,Q(+lUW|pճQDw\S@9R}ַX',M s?ٛQ~㤱SdoIE4 4kiZϑDN䶰YqUڻ޽ 6> & >[F N߳%}n3 6pC^@駕±] ]9-jrXW.0OYG<,Bg_ 1A :qR,2Hd'6cO&^:g2$9v[ w@HʪQ<Ꞣ7N$a?7ٍwWLk}|@0I˩'a[MX8ut:LWӅ̽vː#f;y!:lVh{5< 7#]ά~ 2)ȵÑ˝Iq.sإ6 ?t Ѥ0?AK 8խdEe-& ەˣeΎH[N ;~Jp?3h"fvґȂ´-|0 xÔznQX%9e";6=Mb\mÒft۔ h^|5-Ti!__2TB}fG7xwetp.2%3fBߎ ȠhO}|C>ԯ[/)N,¿J0 u^Jq|vXEvK":Lu'Րw?"c_ spf}eΣ3\ bw9U\{k@UUސd/TC-BRT<`xtE+G -Aa)s뼬N^PeI=o7.JSJ6nl>bpуYl>`VtUg2yxҽ8`A߯*ܘ, x# |;:m 'y8oY(?u;a`V8a̤&1Ie3|QTV]Mr-oJT6p?^GZΪ@Y'i k-ڑ*2h.|@ӆ;?" sqivlњpAhB"Km4C|GA#h\\C'N~1/ةe?qupj6ͣ SjfEap q⠙j8V1{KSښ*v[Qiv䁮4`5}&SruKNtqo+ g?(V%d\n^rN(LӃw?gVN{`WyhIW~y=7,5WyRYjS:fV{ac P}~l}m >')W'5?9¤夽|84)gFW3ZKrd2, Oڭ,Uע"_r~U SN21R~pj#ƑV`uaM*Ǽ,T\=\v؋De?UH@yӖ3'omYW `h9J=l#])QۆRZ{نq7+kxg@,xfPnZt=Sr4*ks9.r:~cBIV;>?XƱݸdfKy,clj(+۔7=*uvMMqL*iR_Ó{=m\7!0 ,R3rhA\Z}:}}=^i卜Jg<`sP!F2!m.ڳ겊l `>}FW4.&PlS Qxl A7ѭe4ITp%],ȕG?l jv=6c!h&G8q u e| FFF拏"EE{Z1(J,X;a86(PI1lKZ!,l_u:ʘi ["i rE?Gr&t#A| 9ybhE΍ȒVh!e+nyĬإ|xF*cr1XQ1T't+{b>ع3UE>t|% tV+d?^H+{ȅ[WRݵ2[C^h\=3pjec)w8292s,q eH?K[_tdI[F*<݀U5 8RӪ#rG4t`k˙=U "|,hX b  PЪ{TyCJq#x yKE8ÐLZg3}܉"5KN6JJF2G޽XÀ exu(mgaQ|5hǀf=ũ$OǔiA|~/o6u4eRRkRw5LZu7 P ؁[{ i0:[G1p!!{ጽx撫Hd7hMЋ|ij<0b"`mD73vlWmCXi9VԸ} ;i*9؏8>b8DA0Ag?li7YOZgsm2x[:,Ç/j2N!g-|tZwK)a|NόyOp!^K8Ղ[I9od#KtD 掩aĵhQi]aԖ=\84ԍ'>>M)Ν'\' mV ,sLavexx6C y1c-_8QrᔵwD6=&J5)[?j5T 07( cN:m3d"(D |}h 4]e]2~v7pf;i[4N 7|nP:uw7`rzaZOL_3ͦVt\kZQn-'ENF͠|w6Q Qnz`aF%hsčAݣ-]حDĶ:b61>ז+%#24=cJ-f@'JT?4,Pht ۜ{,,K Ru'!]ƌtBT_h!٘UAF,b*S9-~q-Q/zlj4'0pﴙ$}k+ܰ-w<@@×xB4n*Q#fKV8a ZͤqC8fRs(Qv\gZ'N ҳ  ck[Z`A|lB| c\߹Z'"  =aql(Q6o8-!Is}/6Y[n$k\u> <[} pMddz5. }SA *@W}x#F;?J1]@;%VxG Wp&69ՎXm614HpuoR 3gsxq18FjR 'hNL`T5̣P((k."/~]1>l ak8z aa{S[/i59Z lh@FÕ!{b~g3P~1d5$` (|rۿ49<^j+'y~;LS>+Z`JBNiٕZ/[ŗޓ^8^d*ӣBQ5}bKƛ/"Asg .vd 1nG3ͻU#aTAO YuÀmX9H#xX퉜N=48NtYGu/qV/meuq9m kIu|yBquAvg+*fw` :74%L>]m%*JmTAWrҡ0=c mduTk̎ :AX΃20=Vvy['Y\cfGQO44i¹weky7@n KSE<1(0gH,-c[rH */8$t V䴍$5&+  aAW0u^m¾Bbg2N~mɮܞpA5 x쀒?yIc_ a5q8*P5$#OgKP c> uыk)su$ͣ<=)N/Ђ5"sfB  @,ngb׫H`.LX+p@剁P~TĚ`7 UэrcW gƦz1\oR*םrXmٌ&DƔ<qrWG!N̸q|=6E^+6+<"Z;D@r$,8L(N=(k3`wⶕyo9j-ݽ)uY_!0١;;t+=!ܓŽ+L@Y#]YeF+$bxBB"m%CE>isʿEJR&3K.ցr7]l Mвg9O'x9[3>cVoV7L zȉI_QuDmr[߆v3Jyʫʰ\ڀGݼX~F{(JWW ̌[ضzvؠ ˕&ͯ?5{L5AQv#zky% p&D/."`/rkk&!8Z2$usGݱ}K8k4Cs*y +L-^L-`w#pIQYo{tWZz]g%.QOqv$Q8x3js wSG|El"^WivWᚪ~LYS VbIu`_x4J[l2fla)aنزOz6Î-N$7sT腖Qdž)/( ymr|gdpXz>gt>"O\(> m,60REjG4cB,A7c(X*67f+\5~Z (8 .}:s*.Ot/X_WE1B?>Ԝ",jwr )Se5hv<*R"ui4@ٯ`UDFt=ihR=se!hfY>20eF ;E4azo; ^r4ߌ@$NI.h:W޲19n6z6 g,Z;Դf½+~qKpi65Y)n騺j-;U$^C:ߟ:PջK wl" vJԊ0 ds+`HaNǼwSuKAShrI~=C2?I1 ?ݟ(Q`<C?m›l=\0Tc#}Nvż@SB eH O@RP pC ,H!KWƾitdI5AS)w'!4Ϥ`<{f{23՚mCG7=8Wj9ALL?0GުweZ.x'xiH_ٍGU"RޔQ;o&Y^5r-ǃTjxu. eti0b WW7ˣ6u<<\V}52"25|,|3A+?>Kh@qꝆ:Zũ"ӋˡNxXG=]5 b3x=|`ۊ)%^RQC(Gՙuw8IZ؎݌._s '1ufB>EQ8yt.;q{ݣJk -aJCЄ15Mf_V~$"s8,G,+zt5@iE@P8m3? I]Bw3}kjU>Vў[#! 9m?74rrf_ L0^STKXO,ɚ.)m*>x5>m-.ήf&ju$YA `^Ȣ3{8CT+IӡN3lHW[#,5>r$F=2F|SƜ$8*&*2.>+wv^75?h'c~t.`v1^()l/ U F/O &:)\l)y.Dk(CRlO W%3*ȣ*#G|PmJ8E^1zdɕEpi5D[J*n|h N;