gvim-9.0.2103-150000.5.57.1<>, 0e_ kp9|aKK!8QY\PҠUg |rݑC+,ثC& HywYzm1:CdB E}Ü2h7; "够U %Jr^H § S҂CmH?d  +8<HLe P, j  $  t  & L  2 2N2(89|: >o@wBFGH,IXY,Z[\]^|bEcddeifllnuvwxHy8zCgvim9.0.2103150000.5.57.1A GUI for ViPackage gvim contains the largest set of features of vim, which is graphical windows and language interpreter, like python, ruby, or perl. You need package vim for the help and other documentation too. If you want less features, you might want to install vim instead.e_ ks390zl35NSUSE Linux Enterprise 15SUSE LLC Vimhttps://www.suse.com/Productivity/Text/Editorshttps://www.vim.org/linuxs390x/usr/sbin/update-alternatives \ --install /usr/bin/vim vim /usr/bin/gvim 30 \ --slave /usr/bin/vi vi /usr/bin/gvimif [ ! -e /usr/bin/gvim ] ; then /usr/sbin/update-alternatives --remove vim /usr/bin/gvim fiLpr)U C.&F,A큤e_ je_ je_ Ce_ Ce_ Ce_ Ce_ Ce_ Ce_ Ce_ Ce_ Ke_ Ce_ Ce_ Ce_ Ce_ Ce_ Ce_ je_ CePae_ Ce_ Ce_ Ce_ Ce_ Ce_ Ce_ Ce_ Ce_ Ce_ Ce_ Cd905e7e98f46181f54583d0605ac286acfe807e3d549af62efea6488b95c40d4761bba80e57d7bb566bd56c4369c6777d92b54f9b77ef8a1edc3ecc4c397feeb9214a5266181ac8e4bb41475f3e1c4c9d66359d7faedf8c2a15f0cbe591a820196946503aad0bab7ef3fa89e74f9fd44294c1ad24aa6ff7c1ee428fc43b8bad96eec36bce6a7817e62c4b15940ab1b42af19292b7ed37d42e268d2c9131b2db708795d7de0debd3ce4d8d7012d3a468d0008a470abeb5b87a46f01ffb7e3ea0b0685688fa3eabffad030fb2450faff870a4db4fb3179b4bf87b1853cb625b001d203547ea1a77a3202cceda1b017a54628250e2f0443e8d947146387145eaa09051e24f1bdf0a66bc7c3d3bb811c5229dbe789119d4dde535a1b92872090cb8f7f1c006a109948927f594b3915999ed80293e0b592a7706efafedb212411be3ca7620817e07ddab0ae17a5cb7bddeda01a42119c9863aacb48f37f1784b17f225bbc8b1988690ddf5be1c0cd1847d3128da54cfd66787308238e7825ee36988cb498011da6e6641951421a79de2e1c6ed4977d08a82afc14538e957c806d7544a8fc3d48d94761e5e255c76c7ddee31b7ef5c0cde8c919cf92a3a0c08ec58390946dce274e5051e4853cb1bf3483966bb349cd2a9e575af7e773c1ffdcaff749gvimgvimgvimgvimgvimgvimgvimgvimgvimgvim/etc/alternatives/vi/etc/alternatives/vim@@Irootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootvim-9.0.2103-150000.5.57.1.src.rpmapplication()application(gvim.desktop)config(gvim)gvimgvim(s390-64)gvim-basegvim-enhancedgvim_clientmimehandler(application/x-shellscript)mimehandler(text/english)mimehandler(text/plain)mimehandler(text/x-c)mimehandler(text/x-c++)mimehandler(text/x-c++hdr)mimehandler(text/x-c++src)mimehandler(text/x-chdr)mimehandler(text/x-csrc)mimehandler(text/x-java)mimehandler(text/x-makefile)mimehandler(text/x-moc)mimehandler(text/x-pascal)mimehandler(text/x-tcl)mimehandler(text/x-tex)vivim_client@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@    /bin/sh/bin/shconfig(gvim)gvim_clientlibICE.so.6()(64bit)libSM.so.6()(64bit)libX11.so.6()(64bit)libXt.so.6()(64bit)libacl.so.1()(64bit)libacl.so.1(ACL_1.0)(64bit)libattr.so.1()(64bit)libattr.so.1(ATTR_1.0)(64bit)libc.so.6()(64bit)libc.so.6(GLIBC_2.11)(64bit)libc.so.6(GLIBC_2.15)(64bit)libc.so.6(GLIBC_2.2)(64bit)libc.so.6(GLIBC_2.2.1)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libc.so.6(GLIBC_2.7)(64bit)libcairo.so.2()(64bit)libdl.so.2()(64bit)libdl.so.2(GLIBC_2.2)(64bit)libgdk-3.so.0()(64bit)libgdk_pixbuf-2.0.so.0()(64bit)libgio-2.0.so.0()(64bit)libglib-2.0.so.0()(64bit)libgobject-2.0.so.0()(64bit)libgpm.so.2()(64bit)libgtk-3.so.0()(64bit)libm.so.6()(64bit)libm.so.6(GLIBC_2.2)(64bit)libpango-1.0.so.0()(64bit)libpangocairo-1.0.so.0()(64bit)libperl.so()(64bit)libpthread.so.0()(64bit)libpthread.so.0(GLIBC_2.2)(64bit)librt.so.1()(64bit)librt.so.1(GLIBC_2.2)(64bit)librt.so.1(GLIBC_2.3.3)(64bit)libtinfo.so.6()(64bit)libtinfo.so.6(NCURSES6_TINFO_5.0.19991023)(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)update-alternativesupdate-alternativesvim-data9.0.2103-150000.5.57.13.0.4-14.6.0-14.0-15.2-19.0.2103-150000.5.57.1gvim8.24.14.1e]@e dܺ@dx@dldZ5dJcd'@ccR@c~ @cM@bb@`4@`.V^)@^@^2\@Zľ@ZlZ@Z%Z1@Z@V͛@V͛@VIV@V@VVŲ@V@V@VT@VV@V@V^VVuFVm]Vd#@VQ@VO @VCV VUU6@U@U@UnU@UUUx&U_@U>$U+UUQTT!TD@TfTr@T T TT|TTxcTk4T[bTBV@zbalogh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comjehan.singh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comlnussel@suse.delnussel@suse.delnussel@suse.deidonmez@suse.comlnussel@suse.deidonmez@suse.comstefan.bruens@rwth-aachen.dekukuk@suse.delnussel@suse.deidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comtchvatal@suse.comidonmez@suse.comnormand@linux.vnet.ibm.comsuse-beta@cboltz.deidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.commpluskal@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comwerner@suse.deidonmez@suse.comidonmez@suse.comidonmez@suse.comtchvatal@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comkukuk@suse.desuse-beta@cboltz.dekukuk@suse.deidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comdimstar@opensuse.orgidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comcrrodriguez@opensuse.orgidonmez@suse.comidonmez@suse.comidonmez@suse.comsuse-beta@cboltz.deidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comopensuse@cboltz.deidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comlars@linux-schulserver.deidonmez@suse.comidonmez@suse.comidonmez@suse.comopensuse@cboltz.de- Updated to version 9.0 with patch level 2103, fixes the following security problems * Fixing bsc#1215940 (CVE-2023-5344) - VUL-0: CVE-2023-5344: vim: Heap-based Buffer Overflow in vim prior to 9.0.1969. * Fixing bsc#1216001 (CVE-2023-5441) - VUL-0: CVE-2023-5441: vim: segfault in exmode when redrawing * Fixing bsc#1216167 (CVE-2023-5535) - VUL-0: CVE-2023-5535: vim: use-after-free from buf_contents_changed() * Fixing bsc#1216696 (CVE-2023-46246) - VUL-0: CVE-2023-46246: vim: Integer Overflow in :history command - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.1894...v9.0.2103- Updated to version 9.0 with patch level 1894, fixes the following security problems * Fixing bsc#1214922 (CVE-2023-4738) - VUL-0: CVE-2023-4738: vim: heap-buffer-overflow in vim_regsub_both * Fixing bsc#1214924 (CVE-2023-4735) - VUL-0: CVE-2023-4735: vim: OOB Write ops.c * Fixing bsc#1214925 (CVE-2023-4734) - VUL-0: CVE-2023-4734: vim: segmentation fault in function f_fullcommand * Fixing bsc#1215004 (CVE-2023-4733) - VUL-0: CVE-2023-4733: vim: use-after-free in function buflist_altfpos * Fixing bsc#1215006 (CVE-2023-4752) - VUL-0: CVE-2023-4752: vim: Heap Use After Free in function ins_compl_get_exp * Fixing bsc#1215033 (CVE-2023-4781) - VUL-0: CVE-2023-4781: vim: heap-buffer-overflow in function vim_regsub_both - drop patches: disable-unreliable-tests.patch ignore-flaky-test-failure.patch vim-8.1.0297-dump3.patch - dropped %check - most of tests didn't work correctly in OBS and maintenance burden of this was getting too big - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.1632...v9.0.1894- Use app icon generated from vimlogo.eps in source tarball; add higher res icons of sizes 128, 256, and 512px as png sources. Our current icons deviate from upstream flatpaks for example. - Updated to version 9.0 with patch level 1632 - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.1443...v9.0.1632- Updated to version 9.0 with patch level 1572, fixes the following security problems * Fixing bsc#1210996 (CVE-2023-2426) - VUL-0: CVE-2023-2426: vim: Use of Out-of-range Pointer Offset in GitHub repository vim/vim prior to 9.0.1499. * Fixing bsc#1211256 (CVE-2023-2609) - VUL-1: CVE-2023-2609: vim: NULL Pointer Dereference prior to 9.0.1531 * Fixing bsc#1211257 (CVE-2023-2610) - VUL-1: CVE-2023-2610: vim: Integer Overflow or Wraparound prior to 9.0.1532 - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.1443...v9.0.1572- Fixing bsc#1211461 - L3: vim "eats" first character from prompt in xterm * Add: reorder-exit-raw-mode.patch * Swaps out_str_t_TE() and cursor_on() during exit to prevent missing characters in xterm prompt on exit.- Fixing bsc#1211144 - [Build 96.1] openQA test fails in zypper_migration - conflict between xxd and vim * Revert the creation standalone xxd packages- Updated to version 9.0 with patch level 1443, fixes the following security problems * Fixing bsc#1209042 (CVE-2023-1264) - VUL-0: CVE-2023-1264: vim: NULL Pointer Dereference vim prior to 9.0.1392 * Fixing bsc#1209187 (CVE-2023-1355) - VUL-0: CVE-2023-1355: vim: NULL Pointer Dereference prior to 9.0.1402. * Fixing bsc#1208828 (CVE-2023-1127) - VUL-1: CVE-2023-1127: vim: divide by zero in scrolldown() - drop vim-8.0-ttytype-test.patch as it changes test_options.vim which we remove during %prep anyway. And this breaks quilt setup. - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.1386...v9.0.1443- Updated to version 9.0 with patch level 1386, fixes the following security problems * Fixing bsc#1207780 - (CVE-2023-0512) VUL-0: CVE-2023-0512: vim: Divide By Zero in GitHub repository vim/vim prior to 9.0.1247 * Fixing bsc#1208957 - (CVE-2023-1175) VUL-0: CVE-2023-1175: vim: Incorrect Calculation of Buffer Size * Fixing bsc#1208959 - (CVE-2023-1170) VUL-0: CVE-2023-1170: vim: Heap-based Buffer Overflow in vim prior to 9.0.1376 * Fixing bsc#1208828 - (CVE-2023-1127) VUL-1: CVE-2023-1127: vim: divide by zero in scrolldown() - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.1234...v9.0.1386- Updated to version 9.0 with patch level 1234, fixes the following security problems * Fixing bsc#1207396 VUL-0: CVE-2023-0433: vim: Heap-based Buffer Overflow in vim prior to 9.0.1225 * Fixing bsc#1207162 VUL-1: CVE-2023-0288: vim: Heap-based Buffer Overflow in GitHub repository vim/vim prior to 9.0.1189. * Fixing bsc#1206868 VUL-1: CVE-2023-0054: vim: Out-of-bounds Write in GitHub repository vim/vim prior to 9.0.1145. * Fixing bsc#1206867 VUL-1: CVE-2023-0051: vim: Heap-based Buffer Overflow in GitHub repository vim/vim prior to 9.0.1144. * Fixing bsc#1206866 VUL-1: CVE-2023-0049: vim: Out-of-bounds Read in GitHub repository vim/vim prior to 9.0.1143. - refreshed vim-7.4-highlight_fstab.patch - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.1040...v9.0.1234- Updated to version 9.0 with patch level 1040, fixes the following security problems * Fixing bsc#1206028 VUL-0: CVE-2022-3491: vim: Heap-based Buffer Overflow prior to 9.0.0742 * Fixing bsc#1206071 VUL-0: CVE-2022-3520: vim: Heap-based Buffer Overflow * Fixing bsc#1206072 VUL-0: CVE-2022-3591: vim: Use After Free * Fixing bsc#1206075 VUL-0: CVE-2022-4292: vim: Use After Free in GitHub repository vim/vim prior to 9.0.0882. * Fixing bsc#1206077 VUL-0: CVE-2022-4293: vim: Floating Point Comparison with Incorrect Operator in GitHub repository vim/vim prior to 9.0.0804. * Fixing bsc#1205797 VUL-0: CVE-2022-4141: vim: heap-buffer-overflow in alloc.c 246:11 * Fixing bsc#1204779 VUL-0: CVE-2022-3705: vim: use after free in function qf_update_buffer of the file quickfix.c - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.814...v9.0.1040- Updated to version 9.0 with patch level 0814, fixes the following problems * Fixing bsc#1192478 VUL-1: CVE-2021-3928: vim: vim is vulnerable to Stack-based Buffer Overflow * Fixing bsc#1203508 VUL-0: CVE-2022-3234: vim: Heap-based Buffer Overflow prior to 9.0.0483. * Fixing bsc#1203509 VUL-1: CVE-2022-3235: vim: Use After Free in GitHub prior to 9.0.0490. * Fixing bsc#1203820 VUL-0: CVE-2022-3324: vim: Stack-based Buffer Overflow in prior to 9.0.0598. * Fixing bsc#1204779 VUL-0: CVE-2022-3705: vim: use after free in function qf_update_buffer of the file quickfix.c * Fixing bsc#1203152 VUL-1: CVE-2022-2982: vim: use after free in qf_fill_buffer() * Fixing bsc#1203796 VUL-1: CVE-2022-3296: vim: stack out of bounds read in ex_finally() in ex_eval.c * Fixing bsc#1203797 VUL-1: CVE-2022-3297: vim: use-after-free in process_next_cpt_value() at insexpand.c * Fixing bsc#1203110 VUL-1: CVE-2022-3099: vim: Use After Free in ex_docmd.c * Fixing bsc#1203194 VUL-1: CVE-2022-3134: vim: use after free in do_tag() * Fixing bsc#1203272 VUL-1: CVE-2022-3153: vim: NULL Pointer Dereference in GitHub repository vim/vim prior to 9.0.0404. * Fixing bsc#1203799 VUL-1: CVE-2022-3278: vim: NULL pointer dereference in eval_next_non_blank() in eval.c * Fixing bsc#1203924 VUL-1: CVE-2022-3352: vim: vim: use after free * Fixing bsc#1203155 VUL-1: CVE-2022-2980: vim: null pointer dereference in do_mouse() * Fixing bsc#1202962 VUL-1: CVE-2022-3037: vim: Use After Free in vim prior to 9.0.0321 - ignore-flaky-test-failure.patch: Ignore failure of flaky tests - disable-unreliable-tests-arch.patch: Removed - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.0313...v9.0.0814- Updated to version 9.0 with patch level 0313, fixes the following problems * Fixing bsc#1200884 Vim: Error on startup * Fixing bsc#1200902 VUL-0: CVE-2022-2183: vim: Out-of-bounds Read through get_lisp_indent() Mon 13:32 * Fixing bsc#1200903 VUL-0: CVE-2022-2182: vim: Heap-based Buffer Overflow through parse_cmd_address() Tue 08:37 * Fixing bsc#1200904 VUL-0: CVE-2022-2175: vim: Buffer Over-read through cmdline_insert_reg() Tue 08:37 * Fixing bsc#1201249 VUL-0: CVE-2022-2304: vim: stack buffer overflow in spell_dump_compl() * Fixing bsc#1201356 VUL-1: CVE-2022-2343: vim: Heap-based Buffer Overflow in GitHub repository vim prior to 9.0.0044 * Fixing bsc#1201359 VUL-1: CVE-2022-2344: vim: Another Heap-based Buffer Overflow vim prior to 9.0.0045 * Fixing bsc#1201363 VUL-1: CVE-2022-2345: vim: Use After Free in GitHub repository vim prior to 9.0.0046. * Fixing bsc#1201620 PUBLIC SUSE Linux Enterprise Server 15 SP4 Basesystem zbalogh@suse.com NEW --- SLE-15-SP4-Full-x86_64-GM-Media1 and vim-plugin-tlib-1.27-bp154.2.18.noarch issue * Fixing bsc#1202414 VUL-1: CVE-2022-2819: vim: Heap-based Buffer Overflow in compile_lock_unlock() * Fixing bsc#1202552 VUL-1: CVE-2022-2874: vim: NULL Pointer Dereference in generate_loadvar() * Fixing bsc#1200270 VUL-1: CVE-2022-1968: vim: use after free in utf_ptr2char * Fixing bsc#1200697 VUL-1: CVE-2022-2124: vim: out of bounds read in current_quote() * Fixing bsc#1200698 VUL-1: CVE-2022-2125: vim: out of bounds read in get_lisp_indent() * Fixing bsc#1200700 VUL-1: CVE-2022-2126: vim: out of bounds read in suggest_trie_walk() * Fixing bsc#1200701 VUL-1: CVE-2022-2129: vim: out of bounds write in vim_regsub_both() * Fixing bsc#1200732 VUL-1: CVE-2022-1720: vim: out of bounds read in grab_file_name() * Fixing bsc#1201132 VUL-1: CVE-2022-2264: vim: out of bounds read in inc() * Fixing bsc#1201133 VUL-1: CVE-2022-2284: vim: out of bounds read in utfc_ptr2len() * Fixing bsc#1201134 VUL-1: CVE-2022-2285: vim: negative size passed to memmove() due to integer overflow * Fixing bsc#1201135 VUL-1: CVE-2022-2286: vim: out of bounds read in ins_bytes() * Fixing bsc#1201136 VUL-1: CVE-2022-2287: vim: out of bounds read in suggest_trie_walk() * Fixing bsc#1201150 VUL-1: CVE-2022-2231: vim: null pointer dereference skipwhite() * Fixing bsc#1201151 VUL-1: CVE-2022-2210: vim: out of bounds read in ml_append_int() * Fixing bsc#1201152 VUL-1: CVE-2022-2208: vim: null pointer dereference in diff_check() * Fixing bsc#1201153 VUL-1: CVE-2022-2207: vim: out of bounds read in ins_bs() * Fixing bsc#1201154 VUL-1: CVE-2022-2257: vim: out of bounds read in msg_outtrans_special() * Fixing bsc#1201155 VUL-1: CVE-2022-2206: vim: out of bounds read in msg_outtrans_attr() * Fixing bsc#1201863 VUL-1: CVE-2022-2522: vim: out of bounds read via nested autocommand * Fixing bsc#1202046 VUL-1: CVE-2022-2571: vim: Heap-based Buffer Overflow related to ins_comp_get_next_word_or_line() * Fixing bsc#1202049 VUL-1: CVE-2022-2580: vim: Heap-based Buffer Overflow related to eval_string() * Fixing bsc#1202050 VUL-1: CVE-2022-2581: vim: Out-of-bounds Read related to cstrchr() * Fixing bsc#1202051 VUL-1: CVE-2022-2598: vim: Undefined Behavior for Input to API related to diff_mark_adjust_tp() and ex_diffgetput() * Fixing bsc#1202420 VUL-1: CVE-2022-2817: vim: Use After Free in f_assert_fails() * Fixing bsc#1202421 VUL-1: CVE-2022-2816: vim: Out-of-bounds Read in check_vim9_unlet() * Fixing bsc#1202511 VUL-1: CVE-2022-2862: vim: use-after-free in compile_nested_function() * Fixing bsc#1202512 VUL-1: CVE-2022-2849: vim: Invalid memory access related to mb_ptr2len() * Fixing bsc#1202515 VUL-1: CVE-2022-2845: vim: Buffer Over-read related to display_dollar() * Fixing bsc#1202599 VUL-1: CVE-2022-2889: vim: use-after-free in find_var_also_in_script() in evalvars.c * Fixing bsc#1202687 VUL-1: CVE-2022-2923: vim: NULL Pointer Dereference in GitHub repository vim/vim prior to 9.0.0240 * Fixing bsc#1202689 VUL-1: CVE-2022-2946: vim: use after free in function vim_vsnprintf_typval * Fixing bsc#1202862 VUL-1: CVE-2022-3016: vim: Use After Free in vim prior to 9.0.0285 Mon 12:00- Deleted patches: * restrict-shell-commands.patch * source-check-sandbox.patch * vim-8.0.1568-CVE-2021-3778.patch * vim-8.0.1568-CVE-2021-3796.patch * vim-8.0.1568-CVE-2021-3872.patch * vim-8.0.1568-CVE-2021-3927.patch * vim-8.0.1568-CVE-2021-3928.patch * vim-8.0.1568-CVE-2021-3984.patch * vim-8.0.1568-CVE-2021-4019.patch * vim-8.0.1568-CVE-2021-4193.patch * vim-8.0.1568-CVE-2021-46059.patch * vim-8.0.1568-CVE-2022-0319.patch * vim-8.0.1568-CVE-2022-0351.patch * vim-8.0.1568-CVE-2022-0361.patch * vim-8.0.1568-CVE-2022-0413.patch * vim-8.0.1568-globalvimrc.patch - Added patches: * vim-8.1.0297-dump3.patch * vim-8.2.2411-globalvimrc.patch * disable-unreliable-tests-arch.patch - Updated patches: * disable-unreliable-tests.patch * vim-7.3-filetype_changes.patch * vim-7.3-filetype_ftl.patch * vim-7.3-filetype_spec.patch * vim-7.3-gvimrc_fontset.patch * vim-7.3-help_tags.patch * vim-7.3-mktemp_tutor.patch * vim-7.3-name_vimrc.patch * vim-7.3-sh_is_bash.patch * vim-7.3-use_awk.patch * vim-7.4-disable_lang_no.patch * vim-7.4-filetype_apparmor.patch * vim-7.4-filetype_mine.patch * vim-7.4-highlight_fstab.patch * vim-8.0-ttytype-test.patch * vim-8.0.1568-defaults.patch * vim73-no-static-libpython.patch - Updated to version 8.2 with patch level 5038, fixes the following problems * Fixing bsc#1191770 VUL-0: CVE-2021-3875: vim: heap-based buffer overflow * Fixing bsc#1192167 VUL-0: CVE-2021-3903: vim: heap-based buffer overflow * Fixing bsc#1192902 VUL-0: CVE-2021-3968: vim: vim is vulnerable to Heap-based Buffer Overflow * Fixing bsc#1192903 VUL-0: CVE-2021-3973: vim: vim is vulnerable to Heap-based Buffer Overflow * Fixing bsc#1192904 VUL-0: CVE-2021-3974: vim: vim is vulnerable to Use After Free * Fixing bsc#1193466 VUL-1: CVE-2021-4069: vim: use-after-free in ex_open() in src/ex_docmd.c * Fixing bsc#1193905 VUL-0: CVE-2021-4136: vim: vim is vulnerable to Heap-based Buffer Overflow * Fixing bsc#1194093 VUL-1: CVE-2021-4166: vim: vim is vulnerable to Out-of-bounds Read * Fixing bsc#1194216 VUL-1: CVE-2021-4193: vim: vulnerable to Out-of-bounds Read * Fixing bsc#1194217 VUL-0: CVE-2021-4192: vim: vulnerable to Use After Free * Fixing bsc#1194872 VUL-0: CVE-2022-0261: vim: Heap-based Buffer Overflow in vim prior to 8.2. * Fixing bsc#1194885 VUL-0: CVE-2022-0213: vim: vim is vulnerable to Heap-based Buffer Overflow * Fixing bsc#1195004 VUL-0: CVE-2022-0318: vim: Heap-based Buffer Overflow in vim prior to 8.2. * Fixing bsc#1195203 VUL-0: CVE-2022-0359: vim: heap-based buffer overflow in init_ccline() in ex_getln.c * Fixing bsc#1195354 VUL-0: CVE-2022-0407: vim: Heap-based Buffer Overflow in Conda vim prior to 8.2. * Fixing bsc#1198596 VUL-0: CVE-2022-1381: vim: global heap buffer overflow in skip_range * Fixing bsc#1199331 VUL-0: CVE-2022-1616: vim: Use after free in append_command * Fixing bsc#1199333 VUL-0: CVE-2022-1619: vim: Heap-based Buffer Overflow in function cmdline_erase_chars * Fixing bsc#1199334 VUL-0: CVE-2022-1620: vim: NULL Pointer Dereference in function vim_regexec_string * Fixing bsc#1199747 VUL-0: CVE-2022-1796: vim: Use After in find_pattern_in_path * Fixing bsc#1200010 VUL-0: CVE-2022-1897: vim: Out-of-bounds Write in vim * Fixing bsc#1200011 VUL-0: CVE-2022-1898: vim: Use After Free in vim prior to 8.2 * Fixing bsc#1200012 VUL-0: CVE-2022-1927: vim: Buffer Over-read in vim prior to 8.2 * Fixing bsc#1070955 VUL-1: CVE-2017-17087: vim: Sets the group ownership of a .swp file to the editor's primary group, which allows local users to obtain sensitive information * Fixing bsc#1194388 VUL-1: CVE-2022-0128: vim: vim is vulnerable to Out-of-bounds Read * Fixing bsc#1195332 VUL-1: CVE-2022-0392: vim: Heap-based Buffer Overflow in vim prior to 8.2 * Fixing bsc#1196361 VUL-1: CVE-2022-0696: vim: NULL Pointer Dereference in vim prior to 8.2 * Fixing bsc#1198748 VUL-1: CVE-2022-1420: vim: Out-of-range Pointer Offset * Fixing bsc#1199651 VUL-1: CVE-2022-1735: vim: heap buffer overflow * Fixing bsc#1199655 VUL-1: CVE-2022-1733: vim: Heap-based Buffer Overflow in cindent.c * Fixing bsc#1199693 VUL-1: CVE-2022-1771: vim: stack exhaustion in vim prior to 8.2. * Fixing bsc#1199745 VUL-1: CVE-2022-1785: vim: Out-of-bounds Write * Fixing bsc#1199936 VUL-1: CVE-2022-1851: vim: out of bounds read- Minimal fix for Bug 1195004 - (CVE-2022-0318) VUL-0: CVE-2022-0318: vim: Heap-based Buffer Overflow in vim prior to 8.2. / vim-8.0.1568-CVE-2022-0413.patch - Fixing bsc#1190570 CVE-2021-3796: vim: use-after-free in nv_replace() in normal.c / vim-8.0.1568-CVE-2021-3796.patch - Fixing bsc#1191893 CVE-2021-3872: vim: heap-based buffer overflow in win_redr_status() drawscreen.c / vim-8.0.1568-CVE-2021-3872.patch - Fixing bsc#1192481 CVE-2021-3927: vim: vim is vulnerable to Heap-based Buffer Overflow / vim-8.0.1568-CVE-2021-3927.patch - Fixing bsc#1192478 CVE-2021-3928: vim: vim is vulnerable to Stack-based Buffer Overflow / vim-8.0.1568-CVE-2021-3928.patch - Fixing bsc#1193294 CVE-2021-4019: vim: vim is vulnerable to Heap-based Buffer Overflow / vim-8.0.1568-CVE-2021-4019.patch - Fixing bsc#1193298 CVE-2021-3984: vim: illegal memory access when C-indenting could lead to Heap Buffer Overflow / vim-8.0.1568-CVE-2021-3984.patch - Fixing bsc#1190533 CVE-2021-3778: vim: Heap-based Buffer Overflow in regexp_nfa.c / vim-8.0.1568-CVE-2021-3778.patch - Fixing bsc#1194216 CVE-2021-4193: vim: vulnerable to Out-of-bounds Read / vim-8.0.1568-CVE-2021-4193.patch - Fixing bsc#1194556 CVE-2021-46059: vim: A Pointer Dereference vulnerability exists in Vim 8.2.3883 via the vim_regexec_multi function at regexp.c, which causes a denial of service. / vim-8.0.1568-CVE-2021-46059.patch - Fixing bsc#1195066 CVE-2022-0319: vim: Out-of-bounds Read in vim/vim prior to 8.2. / vim-8.0.1568-CVE-2022-0319.patch - Fixing bsc#1195126 CVE-2022-0351: vim: uncontrolled recursion in eval7() / vim-8.0.1568-CVE-2022-0351.patch - Fixing bsc#1195202 CVE-2022-0361: vim: Heap-based Buffer Overflow in vim prior to 8.2. / vim-8.0.1568-CVE-2022-0361.patch - Fixing bsc#1195356 CVE-2022-0413: vim: use after free in src/ex_cmds.c / vim-8.0.1568-CVE-2022-0413.patch- install suse vimrc in /usr (boo#1182324, vim-8.0.1568-globalvimrc.patch)- source correct suse.vimrc file (boo#1182324)- stop owning /etc/vimrc so the old, distro provided config actually gets removed. Leaving it around leads to a duplicated autocmd for * .spec, leading to spec file template inserted twice. - own some dirs in vim-data-common so installation of vim-small doesn't leave not owned directories (boo#1173256). - Add vi as slave to update-alternatives so that every package has a matching "vi" symlink (bsc#1174564, boo#1176549).- Add restrict-shell-commands.patch to disable using interfaces in restricted mode, fixes bsc#1172225 CVE-2019-20807- introduce vim-small package with reduced requirements for small installations (boo#1166602). - BuildRequire pkg-config(krb5) instead of krb5-mini to be able to build against Tumbleweed repo.- Add source-check-sandbox.patch to fix CVE-2019-12735 boo#1137443- Pre-convert gvim icons, otherwise building vim depends on rsvg-convert -> librsvg -> cargo -> Rust -> LLVM - Cleanup SVG icon, make lines pixel-grid aligned - Correct RPM Group- Use %license instead of %doc [bsc#1082318]- instead of explicitly unsetting mouse, remove it from the defaults in the first place (boo#1079185, vim-8.0.1568-defaults.patch)- Switch to make -j1 clean to see if it fixes random build failures on Leap/SLE 15.- Updated to revision 1568, fixes the following problems * No test using a screen dump yet. * Screen dump test fails on MS-Windows. * Dead code found. * Assert_equalfile() does not close file descriptors. (Coverity) * Dump test fails when using a shadow directory. * Cannot use 24 bit colors in MS-Windows console. * Compiler warnings without termguicolors feature. * Libterm doesn't support requesting fg and bg color. * C syntax test fails when using gvim * C syntax test still fails when using gvim. * Quotestar test is flaky when using the GUI. * Xxd does not skip NUL lines when using ebcdic. * Popupmenu is too far left when completion is long. (Linwei) * No test for the popup menu positioning. * Popup menu positioning fails with longer string. * synpat_T is taking too much memory. * Terminal screen dump does not include cursor position. * With 'termguicolors' Normal color doesn't work correctly. * When using 'termguicolors' SpellBad doesn't show. * Screen dumps not included in distribution. * Using feedkeys() in a terminal window may trigger mappings. (Charles Sheridan) * Undo in the options window makes it empty. * Screen dump test script not included in distribution. * Various small problems in test files. * Various small problems in source files. * On Mac 'maxmemtot' is set to a weird value. * May leak file descriptors when executing job. * Cannot see what digraph is used to insert a character. * Custom plugins loaded with --clean. * Build error for some combination of features. * May not parse the t_RS response correctly, resulting in wrong characters in the input stream. * printf() does not work with only one argument. (Daniel Hahler) * No right-click menu in a terminal. * Build failure without GUI. * Build failure without GUI on MS-Windows. * Crash with rust syntax highligting. (Edd Barrett) * The terminal debugger can't set a breakpoint with the mouse. * Timeout of getwinposx() can be too short. (lilydjwg) * Too many #ifdefs. * Can't build Mac version without GUI. * Too many #ifdefs. * Cannot build Win32 GUI without IME. (John Marriott) * Can't build on older Mac, header file is missing.- Recommend vim-data so that colors can work by default- Updated to revision 1525, fixes the following problems * Compiler complains about uninitialized variable. (Tony Mechelynck) * Missing -D_FILE_OFFSET_BITS=64 may cause problems if a library is compiled with it. * Cannot act on edits in the command line. * Acessing freed memory after window command in auto command. (gy741) * Still too many old style tests. * Segmentation fault when Ruby throws an exception inside :rubyfile command. * Slow redrawing with DirectX. * Endless loop when gui_mch_stop_blink() is called while blink_state is BLINK_OFF. (zdohnal) * It is difficult to set the python home directory properly for Python 2.7 and 3.5 since both use $PYTHONHOME. * Terminal test fails on some systems. (jonathonf) * Terminal test fails on some slow terminals. * When in silent mode too much output is buffered. * If $SHELL contains a space then the default value of 'shell' is incorrect. (Matthew Horan) * Timer test on travis Mac is still flaky. * Clojure now supports a shebang line. * Filetype detection test does not check all scripts. * Cannot handle change of directory. * Missing file in patch. * Missing another file in patch. * Missing yet another file in patch. * Test fails without 'autochdir' option. * Completing directory after :find does not add slash. * Python2 and python3 detection not tested. (Matej Cepl) * Older GTK versions don't have gtk_entry_get_text_length(). * Libvterm doesn't handle illegal byte sequence correctly. * Illegal memory access in del_bytes(). * When package path is a symlink adding it to 'runtimepath' happens at the end. * Integer overflow when using regexp pattern. (geeknik) * On MS-Windows CursorIM highlighting no longer works. * MS-Windows: nsis installer is a bit slow. * MS-Windows: D&D fails between 32 and 64 bit apps. * Visual C 2017 has multiple MSVCVER numbers. * Invalid memory access in read_redo(). (gy741) * Screen isn't always updated right away. * Redraw flicker when moving the mouse outside of terminal window. * Unnecessary condition for "len" being zero. * Insert mode completion state is confusing. * Patch missing change. * Clearing a pointer takes two lines. * Using feedkeys() does not work to test Insert mode completion. (Lifepillar) * Searchpair() might return an invalid value on timeout. * Reduntant conditions. * Weird autocmd may cause arglist to be changed recursively. * Accessing invalid memory with "it". (Dominique Pelle) * Test 14 fails. * Emacs tags no longer work. (zdohnal) * There is no easy way to get the global directory, esp. if some windows have a local directory. * Number of spell regions is spread out through the code. * The minimum width of the popup menu is hard coded. * Memory leak in balloon_split(). * Completion items cannot be annotated. * No autocmd triggered in Insert mode with visible popup menu. * Having 'pumwidth' default to zero has no merit. * Clearing a pointer takes two lines. * Getting the jump list requires parsing the output of :jumps. * Getjumplist() returns duplicate entries. (lacygoill) * Out-of-memory situation not correctly handled. (Coverity) * Possible NULL pointer dereference. (Coverity) * Out-of-memory situation not correctly handled. (Coverity) * In out-of-memory situation character is not restored. (Coverity) * Access memory beyond end of string. (Coverity) * Win32: the screen may be cleared on startup. * Debugger can't break on a condition. (Charles Campbell) * New version of HP NonStop (Tandem) doesn't like the default header for setenv(). * Timer test is a bit flaky. * The :drop command is not always available. * Test for failing drag-n-drop command no longer fails. * Cannot test if a command causes a beep. * Some code for the debugger watch expression is clumsy. * Warning for possibly using NULL pointer. (Coverity) * The jumplist is not always properly cleaned up. * Getting the list of changes is not easy. * BufWinEnter event fired when opening hidden terminal. * Errors for job options are not very specific. * Invalid memory acces with pattern using look-behind match. (Dominique Pelle) * Error messages suppressed after ":silent! try". (Ben Reilly) * Getchangelist() does not use argument as bufname(). * Cursor is in the wrong line when using a WinBar in a Terminal window. * Shift-Tab does not work in a terminal window. * Popup menu is positioned in the wrong place. (Davit Samvelyan, Boris Staletic) * Cannot write and read terminal screendumps. * Compiler warnings for uninitialized variables. (Tony Mechelynck) * Using :wqa exits even if a job runs in a terminal window. (Jason Felice)- Split vim-data into vim-data-common package for low-disk usage scenarios bsc#1078722 bsc#1078554 bsc#1075541 - Make set mouse= default in suse.vimrc bsc#1079185 bsc#1078564 bsc#1067890 bsc#1064068 bsc#1062691- Updated to revision 1442, fixes the following problems * Crash when calling term_start() with empty argument. * Crash when term_start() fails. * MS-Windows: vimtutor fails if %TMP% has special chars. * After ":copen" can't get the window-ID of the quickfix window. (FalacerSelene) * Illegal memory access after undo. (Dominique Pelle) * GTK: :promtfind does not put focus on text input. (Adam Novak) * Memory leak in test_arabic. * Not enough information about what Python version may work. * Pkg-config doesn't work with cross compiling. * Filetype detection test not updated for change. * If cscope fails a search Vim may hang. * Terminal window: some vterm responses are delayed. * Using ":undo 0" leaves undo in wrong state. * Using pointer before it is set.- Make vim require vim-data bsc#1077352 bsc#1075541 bsc#1074790- Sort with spec-cleaner - Add conditional to build with python2 in order to build with py3 only enviroment - Convert dependencies to pkgconfig style- Updated to revision 1428, fixes the following problems * No test for expanding backticks. * Cursor column is not updated after ]s. (Gary Johnson) * Accessing freed memory in vimgrep. * Accessing invalid memory with overlong byte sequence. * No fallback to underline when undercurl is not set. (Ben Jackson) * Error in return not caught by try/catch. * The timer_pause test is flaky on Travis. * execute() does not work in completion of user command. (thinca) * "gf" and don't accept ? and & in URL. (Dmitrii Tcyganok) * The :leftabove modifier doesn't work for :copen. * Compiler warning on 64 bit MS-Windows system.- ignore make check transient errors for PowerPC bypass boo#1072651- Update apparmor.vim (taken from AppArmor 2.12) * add support for the "smc" network keyword- Updated to revision 1417, fixes the following problems * Encoding empty string to JSON sometimes gives "null". * Build fails with --with-features=huge --disable-channel. * Too much highlighting with 'hlsearch' and 'incsearch' set. * Cannot intercept a yank command. * It is not easy to see if a colorscheme is well written. * Memory leak when CTRL-G in search command line fails. * Pattern with \& following nothing gives an error. * :packadd does not load packages from the "start" directory. * Warnings and errors when building tiny version. (Tony Mechelynck) * Color scheme check script shows up as color scheme. * Cannot build with GTK but without XIM. (Guido) * Crash with nasty autocommand. (gy741, Dominique Pelle) * Using freed buffer in grep command. (gy741, Dominique Pelle) * Invalid memory access on exit when autocommands wipe out a buffer. * Duplicated code for getting a typed character. CursorHold is called too often in the GUI. (lilydjwg) * Difficult to track changes to a quickfix list. * GUI: CursorHold may trigger before 'updatetime' when using timers. * Crash in setqflist(). * Buffer overflow in :tags command. * Hang when using count() with an empty string. * Reading invalid memory with CTRL-W :. * Using free memory using setloclist(). (Dominique Pelle) * Accessing freed memory in :cbuffer. * Accessing freed memory in :lfile. * Warning for unused function without timers feature. * Crash when searching for a sentence. * Test doesn't search for a sentence. Still fails when searching for start of sentence. (Dominique Pelle)- Updated to revision 1390, fixes the following problems * Balloon shows when cursor is in WinBar. * terminal test hangs, executing abcde. (Stucki) * Cannot drag status line or vertical separator of new terminal window. (UncleBill) * MS-Windows: drawing underline, curl and strike-throw is slow, mFallbackDC not properly updated. * Channel test for callback is flaky. * Shift-Insert doesn't always work in MS-Windows console. * Profile log may be truncated halfway a character. * No error when settting 'renderoptions' to an invalid value before starting the GUI. * CTRL-A does not work with an empty line. (Alex) * Window size wrong after maximizing with WinBar. (Lifepillar) * Cursor in terminal not always updated. * Cannot call a dict function in autoloaded dict. * Autoload script sources itself when defining function. * Configure check for selinux does not check for header file. * When recovering a file with "vim -r swapfile" the hit-enter prompt is at the top of the window. * ch_readraw() waits for NL if channel mode is NL. * Get "no write since last change" message if a terminal is open. * Local additions in help skips some files. (joshklod) * Not enough quickfix help; confusing winid. * Python 3.5 is getting old. * Cannot select modified buffers with getbufinfo(). * Wordcount test is old style. * Char not overwritten with ambiguous width char, if the ambiguous char is single width but we reserve double-width space. * getqflist() items are missing if not set, that makes it more difficult to handle the values. * DirectX scrolling can be slow, vertical positioning is off.- Updated to revision 1365, fixes the following problems * Libvterm ANSI colors can not always be recognized from the RGB values. The default color is wrong when t_RB is empty. * The Terminal highlighting doesn't work in a terminal. * Some users don't want to diff with hidden buffers. * Terminal window colors wrong when using Terminal highlighting. * Recovering does not work when swap file ends in .stz. * There is no easy way to get the window position. * When one channel test fails others fail as well.- Update to revision 1358 * Too many changes to list - Fixes CVE-2017-1000382 bsc#1065958 - Refresh patches: * disable-unreliable-tests.patch * vim-7.3-filetype_spec.patch * vim-7.4-disable_lang_no.patch * vim-7.4-highlight_fstab.patch * vim-8.0-ttytype-test.patch- Explicitly require python2-devel- Add disable-unreliable-tests.patch to disable unreliable tests bsc#1054723- Bump priorities so we can upgrade from 12.3- Updated to revision 627, fixes the following problems * Call for requesting color and ambiwidth is too early. (Hirohito Higashi) * "1gd" may hang. * Bracketed paste is still enabled when executing a shell command. (Michael Smith) * Can't run make with several jobs, creating directories has a race condition. * The cursor line number becomes negative when using :z^ in an empty buffer. (neovim #6557) * Building the command table requires Perl. * Running parallel make after distclean fails. (Manuel Ortega) * Get only one quickfix list after :caddbuf. * Using freed memory when resetting 'indentexpr' while evaluating it. (Dominique Pelle) * Can't build when configure choses "install-sh". (Daniel Hahler) * Warning for uninitialized variable. (John Marriott) * :simalt on MS-Windows does not work properly. * Duplicate test case for quickfix. * Cannot set the valid flag with setqflist(). * Moving folded text is sometimes not correct. * Illegal memory access with z= command. (Dominique Pelle) * Fold test hangs on MS-Windows. * Memory leak when executing quickfix tests. * Test_options fails when run in the GUI. * No test for mapping timing out. * Configure check for return value of tgetent is skipped. * job_stop() often assumes the channel will be closed, while the job may not actually be stopped. (Martin Gammelsæter) * :simalt still does not work. * Cannot add a context to locations. * Changes to eval functionality not documented. * If a job writes to a buffer and the user is typing a command, the screen isn't updated. When a message is displayed the changed buffer may cause it to be cleared. (Ramel Eshed) * Duplication of code for adding a list or dict return value. * Build failure when windows feature is missing. * Coverity warning for not checking return value of dict_add(). * Crash when complete() is called after complete_add() in 'completefunc'. (Lifepillar) * Off-by-one error in buffer size computation. * Building with gcc 7.1 yields new warnings. * diff mode is insufficiently tested * test_recover fails on some systems. * No test coverage for :spellrepall. * When gF fails to edit the file the cursor still moves to the found line number. * gF test fails on MS-Windows. * gF test fails still on MS-Windows. * The buffer that quickfix caches for performance may become invalid. (Daniel Hahler) * Cannot set the context for a specified quickfix list. * When creating a bufref, then using :bwipe and :new it might get the same memory and bufref_valid() returns true. * Cannot manipulate other than the current quickfix list. * For some people the hint about quitting is not sufficient. * The screen is redrawn when t_BG is set and used to detect the value for 'background'. * When t_u7 is sent a few characters in the second screen line are overwritten and not redrawn later. (Rastislav Barlik) * Package directories are added to 'runtimepath' only after loading non-package plugins. * The conf filetype detection is done before ftdetect scripts from packages that are added later. * float2nr() is not exactly right. * Using % with :hardcopy wrongly escapes spaces. (Alexey Muranov) * When setting the cterm background with ":hi Normal" the value of 'background' may be set wrongly. * Hardcopy test hangs on MS-Windows. * NFA regex engine handles [0-z] incorrectly. * In the GUI, when a timer uses feedkeys(), it still waits for an event. (Raymond Ko) * Since we only support GTK versions that have it, the ckeck for HAVE_GTK_MULTIHEAD is no longer needed. * The ":stag" command does not respect 'switchbuf'. * Using a text object to select quoted text fails when 'selection' is set to "exclusive". (Guraga) * The message "Invalid range" is used for multiple errors. * Warning for unused variable in tiny build. (Tony Mechelynck) * shellescape() always escapes a newline, which does not work with some shells. (Harm te Hennepe) * In the GUI the cursor may flicker. * When 'wrapscan' is off "gn" does not select the whole pattern when it's the last one in the text. (KeyboardFire)- Extend vimrc with mappings for 8-bit controls key escape sequences- Conflict with old vim versions to fix the upgrade from 12.3 boo#1036583- Updated to revision 566, fixes the following problems * :windo allows for ! but it's not supported. * Undefined behavior when using backslash after empty line. * Not enough test coverage for syntax commands. * Crash when getting the window position in tmux. * Cannot detect Bazel BUILD files on some systems. * Using freed memory in :caddbuf after clearing quickfix list. * Setting nocompatible for the tiny version moves the cursor. - Refresh and re-add vim-8.0-ttytype-test.patch- Updated to revision 559, fixes the following problems * Test_edit causes older xfce4-terminal to close. (Dominique Pelle) * Cppcheck warnings. * Edit test may fail on some systems. * Swap file exists briefly when opening the command window. * Extra line break in verbosefile when using ":echomsg". (Ingo Karkat) * Saving the redo buffer only works one time, resulting in the "." command not working well for a function call inside another function call. * No test for the 8g8 command. * Some etags format tags file use 0x01, breaking the parsing. * The typeahead buffer is reallocated too often. * Toupper and tolower don't work properly for Turkish when 'casemap' is empty. (Bjorn Linse) * Toupper/tolower test with Turkish locale fails on Mac. * Toupper and tolower don't work properly for Turkish when 'casemap' contains "keepascii". (Bjorn Linse) * Toupper/tolower test fails on OSX without Darwin. * Getting the window position fails if both the GUI and term code is built in. * GTK: using static gravities is not useful. * The :ownsyntax command is not tested. * Setting ttytype to xxx does not always fail as expected. - Remove vim-8.0-ttytype-test.patch, fixed upstream.- Update the update-alternatives code- Updated to revision 542, fixes the following problems * ml_get errors in silent Ex mode. (Dominique Pelle) * A large count on a normal command causes trouble. (Dominique Pelle) * There is no way to remove quickfix lists (for testing). * Storing a zero byte from a multi-byte character causes fold text to show up wrong. * Character classes are not well tested. They can differ between platforms. * Using a function pointer instead of the actual function, which we know. * GtkForm handling is outdated. * MS-Windows: when 'clipboard' is "unnamed" yyp does not work in a :global command. * dv} deletes part of a multi-byte character. (Urtica Dioica) * Folds are messed up when 'encodin' is "utf-8". * Coverity complains about possible negative value. * RISC OS support was removed long ago, but one file is still included. * When 'wildmenu' is set and 'wildmode' has "longest" then the first file name is highlighted, even though the text shows the longest match. * Line in test commented out. * Buffer overflow when 'columns' is very big. (Nikolai Pavlov) * Test with long directory name fails on non-unix systems. * Test with long directory name fails on Mac. * Abbreviation doesn't work after backspacing newline. (Hkonrk) * Defaults.vim does not work well with tiny features. (crd477) * Memory leak when exiting from within a user function. * Quickfix window not updated when freeing quickfix stack. * Illegal memory access with :z and large count. * No test for falling back to default term value. * Startup test fails on Mac. * Building unit tests fails. * Compiler warning on MS-Windows. * getpos() can return a negative line number. (haya14busa)- Update spec.skeleton with spec-cleaner- Updated to revision 514, fixes the following problems * Insufficient testing for statusline. * 'makeencoding' missing from the options window. * Git and hg see new files after running tests. (Manuel Ortega) * Options test does not always test everything. * Options test fails or hangs on MS-Windows. * 'cinoptions' cannot set indent for extern block. * "make shadow" creates an invalid link. * Quite a few beeps when running tests. * Clang version not correctly detected. * Some functions are not tested. * Running the options test sometimes resizes the terminal. * The packadd test does not create the symlink correctly and does not test the right thing. * The fnamemodify test changes 'shell' in a way later tests may not be able to use system(). * Using ":%argdel" while the argument list is already empty gives an error. (Pavol Juhas) * Not enough test coverage in Insert mode. * Dead code in #ifdef. * Patch shell command uses double quotes around the argument, which allows for $HOME to be expanded. (Etienne) * Terminal width is set to 80 in test3. * Diffpatch fails when the file name has a quote. * Getpgid is not supported on all systems. * The ";" command does not work after characters with a lower byte that is NUL. * Getting font name does not work on X11. * Some macros are in lower case, which can be confusing. * Part of fold patch accidentally included. * v:progpath is not reliably set. * Some macros are in lower case. * Some macros are in lower case. * Adding fold marker creates new comment. * Compiler warnings for comparing unsigned char with 256 always being true. (Manuel Ortega) * The mode test may hang in Test_mode(). (Michael Soyka) * Typo in MinGW test makefile. * Using :move messes up manual folds. * Potential crash if adding list or dict to dict fails. * Old fix for :move messing up folding no longer needed, now that we have a proper solution. * Can't build on HPUX. * Test 45 hangs on MS-Windows. * If an MS-Windows tests succeeds at first and then fails in a way it does not produce a test.out file it looks like the test succeeded. * Resetting 'compatible' in defaults.vim has unexpected side effects. (David Fishburn) * Can't find executable name on Solaris and FreeBSD. * Off-by-one error in using :move with folding. * There are still a few macros that should be all-caps. * Using g< after :for does not show the right output. (Marcin Szamotulski) * After aborting an Ex command g< does not work. (Marcin Szamotulski) * Compiler warnings on MS-Windows. * Not enough testing for help commands. * Exit callback test sometimes fails. * When a test fails and test.log is created, Test_edit_CTRL_I matches it instead of test1.in. * No test covering arg_all(). * The client-server feature is not tested. * Not enough testing for the client-server feature. * Missing change to main.c. * The client-server test may hang when failing. * Tests use assert_true(0) and assert_false(1) to report errors. * remote_peek() is not tested. * The remote_peek() test fails on MS-Windows. * Unnecessary if statement. * The setbufvar() function may mess up the window layout. (Kay Z.) * Illegal memory access when using :all. (Dominique Pelle) * Using :lhelpgrep with an argument that should fail does not produce an error if the previous :helpgrep worked. * Not all windows commands are tested. * Crash and endless loop when closing windows in a SessionLoadPost autocommand. * The autocmd test hangs on MS-Windows. * Running tests leaves an "xxx" file behind. * Clipboard and "* register is not tested. * Splitting a 'winfixwidth' window vertically makes it one column smaller. (Dominique Pelle) * The quotestar test fails when a required feature is missing. * A failing client-server request can make Vim hang. * Crash with cd command with very long argument. * Build failure with older compiler on MS-Windows. * The quotestar test uses a timer instead of a timeout, thus it cannot be rerun like a flaky test. * Insufficient testing for folding. * Arabic support is not fully tested. * Two autocmd tests are skipped on MS-Windows. * taglist() does not prioritize tags for a buffer. * Quotestar test is still a bit flaky. * On MS-Windows ":!start" does not work as expected. * Coverity complains about possible NULL pointer. * Endless loop in updating folds with 32 bit ints. * Looking up an Ex command is a bit slow. * Failed window split for :stag not handled. (Coverity CID 99204) * Can't build with ANSI C. * Client-server tests fail when $DISPLAY is not set. * Coveralls no longer shows per-file coverage. * No link to codecov.io results. * Typo in link to codecov.io results. * Menuage for skipping client-server tests is unclear. * Check for available characters takes too long. * Getting name of cleared highlight group is wrong. (Matt Wozniski) * Script for creating cmdidxs can be improved.- Disable term=xxx test, does not work with any vim version * vim-8.0-ttytype-test.patch- Update apparmor.vim (taken from AppArmor 2.11) * add support for the "kcm" and "qipcrtr" network keywords * update change_profile rule highlighting- Build default vim without X11 support, use update-alternatives to prefer gvim if installed for X11 support.- Updated to revision 425, fixes the following problems * Packadd test does not clean up symlink. * Packadd test uses wrong directory name. * The E11 error message in the command line window is not translated. * The "zero count" error doesn't have a number. (Hirohito Higashi) * Xfontset and guifontwide are not tested. * Illegal memory access after "vapo". (Dominique Pelle) * Restoring help snapshot accesses freed memory. (Dominique Pelle) * GUI test fails on some systems. * Illegal memory access when 'complete' ends in a backslash. * Can't access b:changedtick from a dict reference. * Functions test fails. * Flags of :substitute not sufficiently tested. * Invalid memory access in :recover command. * :recover test fails on MS-Windows. * Illegal memory access with vi' * Not checking return valud of dict_add(). (Coverity) * When using complete() and typing a character undo is saved after the character was inserted. (Shougo) * Double free when compiled with EXITFREE and setting 'ttytype'. * b:changedtick can be unlocked, even though it has no effect. * Unlet command leaks memory. (Nikolai Pavlov) * islocked('d.changedtick') does not work. * Vim relies on limits.h to be included indirectly, but on Solaris 9 it may not be. (Ben Fritz) * When using CTRL-X CTRL-U inside a comment, the use of the comment leader may not work. (Klement) * When building with a shadow directory on macOS lacks the +clipboard feature. * Redrawing errors with GTK 3. * Not enough test coverage for Perl. * No test for concatenating an empty string that results from out of bounds indexing. * The condition for when a typval needs to be cleared is too complicated. * If [RO] in the status line is translated to a longer string, it is trunctted to 4 bytes. * Test to check that setting termcap key fails sometimes. * Using uninitialized memory when 'isfname' is empty. * Leaking memory when setting 'ttytype'. * Crash when setting 'guicursor' to weird value. * Invalid memory access in C-indent code. * 'number' and 'relativenumber' are not properly tested. * Sometimes VimL is used, which is confusing. * GUI initialisation is not sufficiently tested. * Tests fail on MS-Windows. * Travis is too slow to keep up with patches. * ]s does not move cursor with two spell errors in one line. * Might free a dict item that wasn't allocated. * Build fails with tiny features. * If configure defines _LARGE_FILES some include files are included before it is defined. * Not all options are tested with a range of values. * The 'balloondelay', 'ballooneval' and 'balloonexpr' options are not defined without the +balloon_eval feature. Testing that an option value fails does not work for unsupported options. * Invalid memory access when setting wildchar empty. * Leaking memory when setting v:completed_item. * More options are not always defined. * Build fails without +folding. * Invalid memory access when using :sc in Ex mode. (Dominique Pelle) * The "+ register is not tested. * Size computations in spell file reading are not exactly right. * Possible overflow when reading corrupted undo file. CVE-2017-6349 bsc#1027057 * Another possible overflow when reading corrupted undo file. CVE-2017-6350 bsc#1027053 * CTRL-Z and mouse click use CTRL-O unnecessary. * With 'linebreak' set and 'breakat' includes ">" a double-wide character results in "<<" displayed. * Diff mode is not sufficiently tested. * Warning in tiny build for unused variable. (Tony Mechelynck) * Misplaced #ifdef. (Christ van Willigen) * Timer test failed for no apparent reason. * No tests for arabic. * Tiny build has a problem with generating the options test. * compiler warnings * filtering lines through "cat", without changing the line count, changes manual folds. * Test for arabic does not check what is displayed. * When the window scrolls horizontally when the popup menu is displayed part of it may not be cleared. (Neovim issue #6184) * Arabic support is verbose and not well tested. * GUI test fails with Athena and Motif. * When the same tag appears more than once, the order is unpredictable. (Charles Campbell) * Tabs are not aligned when scrolling horizontally and a Tab doesn't fit. (Axel Bender) * Testing the + register fails with Motif. * 'balloonexpr' only works synchronously. * Cannot build with the viminfo feature but without the eval feature. * Illegal memory access with "t". * Crash when using balloon_show() when not supported. (Hirohito Higashi) * Some tests have a one second delay. * Test fails with missing balloon feature. * :map completion does not have . (Dominique Pelle) * GUI tests may fail. * Not enough testing for quickfix. * v:progpath may become invalid after ":cd". * The arabic shaping code is verbose. * Filtering folds with marker method not tested. * Updating folds does not work properly when inserting a file and a few other situations. * set_progpath is defined but not always used * Newer gettext/iconv library has extra dll file. * We can't change the case in menu entries, it breaks translations. * Menu test fails on MS-Windows. * Menu test fails on MS-Windows using gvim. * Balloon eval is not tested. * Balloon test fails on MS-Windows. * Setting v:progpath is not quite right. * Test for the clipboard fails sometimes. * ASAN logs are disabled and don't cause a failure. * Test for v:progpath fails on MS-Windows. * When running :make the output may be in the system encoding, different from 'encoding'. * Diff mode is displayed wrong when adding a line at the end of a buffer. * Python test fails with Python 3.6. * The effect of adding "#" to 'cinoptions' is not always removed. * Compiler warnings on MS-Windows. (Ajit Thakkar) * Build errors when building without folding. - Drop test87-python36.patch, fixed upstream.- Add test87-python36.patch to update test results for Python 3.6- Updated to revision 324, fixes the following problems * When a json message arrives in pieces, the start is dropped and the decoding fails. * Not enough testing for GUI functionality. * getcmdtype(), getcmdpos() and getcmdline() are not tested. * ":help :[range]" does not work. (Tony Mechelynck) * ":help z?" does not work. (Pavol Juhas) * No test for setting 'guifont'. * Small mistake in 7x13 font name. * Insert mode completion does not respect "start" in 'backspace'. * Warning for unused variable with small build. * When using the tiny version trying to load the matchit plugin gives an error. On MS-Windows some default mappings fail. * Possible overflow with spell file where the tree length is corrupted. CVE-2017-5953 bsc#1024724 * When running the command line tests there is a one second wait. * Illegal memory access with "1;y".- Updated to revision 311, fixes the following problems * Double free on exit when using a closure. (James McCoy) * Ex command range with repeated search does not work. (Bruce DeVisser) * When the GUI window is resized Vim does not always take over the new size. (Luchr) * Cannot stop diffing hidden buffers. (Daniel Hahler) * No tests for ":set completion" and various errors of the :set command. * Cannot set terminal key codes with :let. * Bracketed paste does not work in Visual mode. * Assign test fails in the GUI. * Invalid memory access when option has duplicate flag. * mode() not sufficiently tested. * Asan detects a memory error when EXITFREE is defined. (Dominique Pelle) * When using a symbolic link, the package path will not be inserted at the right position in 'runtimepath'. (Dugan Chen, Norio Takagi) * Cannot use an empty key in json. * Not enough testing for GUI functionality. * Linebreak tests are old style.- Updated to revision 296, fixes the following problems * Jumping to a tag that is a static item in the current file fails. (Kazunobu Kuriyama) * The test for :profile is slow and does not work on MS-Windows. * On MS-Windows the system() test skips a few parts. * Some syntax arguments take effect even after "if 0". (Taylor Venable) * Warning for an unused parameter when the libcall feature is disabled. Warning for a function type cast when compiling with -pedantic. * Some syntax arguments are not tested. * When completing a group name for a highlight or syntax command cleared groups are included. * No test for invalid syntax group name. * Order of complication flags is sometimes wrong. * Compiler warns for uninitialized variable. (Tony Mechelynck) * After :undojoin some commands don't work properly, such as :redo. (Matthew Malcomson) * Test coverage for :retab insufficient. * Leaking file descriptor when system() cannot find the buffer. (Coverity) * Internally used commands for CTRL-Z and mouse click end up in history. (Matthew Malcomson) * When using :substitute with the "c" flag and 'cursorbind' is set the cursor is not updated in other windows. * Vim does not support bracketed paste, as implemented by xterm and other terminals. * Build fails if the multi-byte feature is disabled. * The buffer used to store a key name theoreticaly could be too small. (Coverity) * The Netbeans "specialKeys" command does not check if the argument fits in the buffer. (Coverity) * Leaking memory when syntax cluster id is unknown. (Coverity) * When a Cscope line contains CTRL-L a NULL pointer may be used. (Coverity) * When decoding JSON with a JS style object the JSON test may use a NULL pointer. (Coverity) * Build fails without the cscope feature. * No command line completion for :cexpr, :cgetexpr, :caddexpr, etc. * Ubsan reports errors for integer overflow. * Completion for :match does not show "none" and other missing highlight names. * Checking if PROTO is defined inside a function has no effect. * When a multi-byte character ends in a zero byte, putting blockwise text puts it before the character instead of after it. * Coverity gets confused by the flags passed to find_tags() and warnts for an uninitialized variable. * When 'fileformats' is changed in a BufReadPre auto command, it does not take effect in readfile(). (Gary Johnson) * When a block is visually selected and put is used on the end of the selection only one line is changed. * The test for patch 8.0.0224 misses the CR characters and passes even without the fix. (Christian Brabandt) * Crash when 'fileformat' is forced to "dos" and the first line in the file is empty and does not have a CR character. * When pasting test in an xterm on the command line it is surrounded by and . (Johannes Kaltenbach) * When freeing a buffer the local value of the 'formatprg' option is not cleared. * When using bracketed paste line breaks are not respected. * There are no tests for bracketed paste mode. * Pasting in Insert mode does not work when bracketed paste is used and 'esckeys' is off. * The paste test fails if the GUI is being used. * When several lines are visually selected and one of them is short, using put may cause a crash. (Axel Bender) * Memory leak detected when running tests for diff mode. * Gcc complains that a variable may be used uninitialized. Confusion between variable and label name. (John Marriott) * When setting wildoptions=tagfile the completion context is not set correctly. (desjardins) * When using bracketed paste autoindent causes indent to be increased. * The address sanitizer sometimes finds errors, but it needs to be run manually. * The clang build on CI fails with one configuration. * Vim defines a mch_memmove() function but it doesn't work, thus is always unused. * Completion of user defined functions is not covered by tests. * When making a character lower case with tolower() changes the byte cound, it is not made lower case. * When the user sets t_BE empty after startup to disable bracketed paste, this has no direct effect. * The generated zh_CN.cp936.po message file is not encoded properly. * Compiler warnings for int to pointer conversion. * Under some circumstances, one needs to type Ctrl-N or Ctrl-P twice to have a menu entry selected. (Lifepillar) * vim_strcat() cannot handle overlapping arguments. * When two submits happen quick after each other, the tests for the first one may error out. * When virtcol() gets a column that is not the first byte of a multi-byte character the result is unpredictable. (Christian Ludwig) * It is not so easy to write a script that works with both Python 2 and Python 3, even when the Python code works with both. * Characters below 256 that are not one byte are not always recognized as word characters. * When creating a session when winminheight is 2 or larger and loading that session gives an error. * When using an assert function one can either specify a message or get a message about what failed, not both. * When calling setpos() with a buffer argument it often is ignored. (Matthew Malcomson) * Tests fail because some changes were not included. * The keyword test file is not included in the archive. * The keyword test file is not included in the archive. * Tab commands do not handle count correctly. (Ken Hamada) * Build fails with tiny features. * Not enough test coverage for eval functions. * Farsi support is barely tested. * Farsi support is not tested enough. * Memory error reported by ubsan, probably for using the string returned by execute(). * May get ml_get error when :pydo deletes lines or switches to another buffer. (Nikolai Pavlov, issue #1421) * Compiler warning for using uninitialized variable. * A channel test sometimes fails on Mac. * May get ml_get error when :luado deletes lines or switches to another buffer. (Nikolai Pavlov, issue #1421) * May get ml_get error when :perldo deletes lines or switches to another buffer. (Nikolai Pavlov, issue #1421) * May get ml_get error when :rubydo deletes lines or switches to another buffer. (Nikolai Pavlov, issue #1421) * May get ml_get error when :tcldo deletes lines or switches to another buffer. (Nikolai Pavlov, closes #1421) * Crash on exit is not detected when running tests. * Dead code detected by Coverity when not using gnome. * When update_single_line() is called recursively, or another screen update happens while it is busy, errors may occur. * When checking for CTRL-C typed the GUI may detect a screen resize and redraw the screen, causing trouble. * Checking for FEAT_GUI_GNOME inside GTK 3 code is unnecessary. * The GUI test may trigger fontconfig and take a long time. * GUI test fails on MS-Windows. * With MSVC 2015 the dll name is vcruntime140.dll. * On MS-Windows setting an environment variable with multi-byte strings does not work well. * MS-Windows files are still using ARGSUSED while most other files have UNUSED. * When doing a Visual selection and using "I" to go to insert mode, CTRL-O needs to be used twice to go to Normal mode. (Coacher) * The return value of mode() does not indicate that completion is active in Replace and Insert mode. (Zhen-Huan (Kenny) Hu) * The Test_collapse_buffers() test failed once, looks like it is flaky. * Tests fail with tiny build on Unix. * When concealing is active and the screen is resized in the GUI it is not immediately redrawn. * Cannot access the arguments of the current function in debug mode. (Luc Hermitte) * Errors reported while running tests. * No test for "ga" and :ascii. * If a wide character doesn't fit at the end of the screen line, and the line doesn't fit on the screen, then the cursor position may be wrong. (anliting) * Visual block insertion does not insert in all lines. * The stat test is a bit slow. * Some tests have a one or three second wait. * Argument list is not stored correctly in a session file. (lgpasquale) * test_viml hangs. * Bracketed paste can only append, not insert.- Improve summary bsc#1021040- Add missing %changelog to spec.skeleton- Updated to revision 194, fixes the following problems * When compiling with EBCDIC defined the build fails. (Yaroslav Kuzmin) * For completion "locale -a" is executed on MS-Windows, even though it most likely won't work. * Setting language in gvim on MS-Windows does not work when libintl.dll is dynamically linked with msvcrt.dll. * Using :change in between :function and :endfunction fails. * When opening a buffer on a directory and inside a try/catch then the BufEnter event is not triggered. * test_command_count may fail when a previous test interferes, seen on MS-Windows. * 'formatprg' is a global option but the value may depend on the type of buffer. (Sung Pae) * Error E937 is used both for duplicate key in JSON and for trying to delete a buffer that is in use. * When 'cursorbind' and 'cursorcolumn' are both on, the column highlignt in non-current windows is wrong. * When 'cursorbind' and 'cursorline' are set, but 'cursorcolumn' is not, then the cursor line highlighting is not updated. (Hirohito Higashi) * Ubsan warns for using a pointer that is not aligned. * When in Ex mode and an error is caught by try-catch, Vim still exits with a non-zero exit code. * The system() test fails on MS-Windows. * The error message from assert_notequal() is confusing. * Building with a new Ruby version fails. * Using NOT_VALID for redraw_later() to update the cursor line/column highlighting is not efficient. * There are no tests for the :profile command. * Detecting duplicate tags uses a slow linear search. * Some systems do not have ruby_sysinit(), causing the build to fail. * Build fails with tiny features. * Accidentally removed #ifdef. * Profile tests fails if total and self time are equal.- Updated to revision 172, fixes the following problems * When a C preprocessor statement has two line continuations the following line does not have the right indent. (Ken Takata) * ":earlier" and ":later" do not work after startup or reading the undo file. * When the pattern of :filter does not have a separator then completion of the command fails. * To pass buffer content to system() and systemlist() one has to first create a string or list. * Running the channel test creates channellog. * system() test fails on MS-Windows. * system() test fails on OS/X. * When sorting zero elements a NULL pointer is passed to qsort(), which ubsan warns for. * Several float functions are not covered by tests. * No command line completion for ":syntax spell" and ":syntax sync". * On MS-Windows some float functions return a different value when passed unusual values. strtod() doesn't work for "inf" and "nan". * Using a NULL pointer when using feedkeys() to trigger drawing a tabline. * EMSG() is sometimes used for internal errors. * Build fails when using small features. * Build error on Fedora 23 with small features and gnome2. * Ruby 2.4 no longer supports rb_cFixnum. * Outdated and misplaced comments. * Ubsan warns for integer overflow. * JSON with a duplicate key gives an internal error. (Lcd) * str2nr() and str2float() do not always work with negative values. * Still some float functionality is not covered by tests. * For complicated string json_decode() may run out of stack space. * Channel test fails for using freed memory. * JS style JSON does not support single quotes. * The command selected in the command line window is not executed. (Andrey Starodubtsev)- Updated to revision 147, fixes the following problems * Not enough test coverage for syntax commands. * Test fails because of using :finish. * "2;'(" causes ml_get errors in an empty buffer. * Null pointer access reported by UBsan. * An address relative to the current line, ":.,+3y", does not work properly on a closed fold. * When using indent folding and changing indent the wrong fold is opened. * When 'maxfuncdepth' is set above 200 the nesting is limited to 200. * Small build fails. * Warning for unused argument. * Pasting inserted text in Visual mode does not work properly. * Nested function test fails on AppVeyor. * Normal colors are wrong with 'termguicolors'. * Line number of current buffer in getbufinfo() is wrong. * When using MSVC the GvimExt directory is cleaned twice. * Running tests on MS-Windows is a little bit noisy. * When using 'termguicolors' on MS-Windows the RGB definition causes the colors to be wrong. * searchpair() does not work when 'magic' is off.- Updated to revision 130, fixes the following problems * Not enough testing for entering Ex commands. * Display problem with 'foldcolumn' and a wide character. (esiegerman) * Cancelling completion still inserts text when formatting is done for 'textwidth'. (lacygoill) * Display test fails on MS-Windows. * Parallel make still doesn't work. (Lewis Muir) * Configure uses "ushort" while the Vim code doesn't.- Updated to revision 124, fixes the following problems * May not process channel readahead. (skywind) * Value of 'thesaurus' option not checked properly. * When using ch_read() with zero timeout, can't tell the difference between reading an empty line and nothing available. * Cannot use a semicolon in 'backupext'. (Jeff) * When reading channel output in a timer, messages may go missing. (Skywind) * The channel "drop" option is not tested. * Still checking if memcmp() exists while every system should have it now. * Drop command doesn't use existing window. * The :history command is not tested. * Tests 92 and 93 are old style. * When reading English help and using CTRl-] the language from 'helplang' is used. * Parallel make fails. (J. Lewis Muir) * No test for using CTRL-R on the command line. * Setting 'cursorline' changes the curswant column. (Daniel Hahler) * Internal error for assert_inrange(1, 1).- Updated to revision 101, fixes the following problems * When the input or output is not a tty Vim appears to hang. * When a channel callback consumes a lot of time Vim becomes unresponsive. (skywind) * Can't build on MS-Windows. * Popup menu always appears above the cursor when it is in the lower half of the screen. (Matt Gardner) * Options that are a file name may contain non-filename characters. * Some options are not strictly checked. * (after 8.0.0101) cannot set 'dictionary' to a path- Updated to revision 95, fixes the following problems * Problems with GTK 3.22.2 fixed in 3.22.4.- Export "TERM=linux" before running the test suite: vim does quite an extensive test relying on a full fledged terminal inside OBS, stdio is redirected to a serial console (where the build log is being recorded/extracted. Systemd set non-local tty by default to vt220 in upcoming versions (which the vi test suite fails to run on; this should be considered a vim bug).- Updated to revision 92, fixes the following problems * Using NUL instead of NULL. * Crash when using the preview window from an unnamed buffer. (lifepillar) * On Windows job_stop() stops cmd.exe, not the processes it runs. (Linwei) * When a match ends in part of concealed text highlighting, it might mess up concealing by resetting prev_syntax_id. * An exiting job is detected with a large latency. * New code for job_stop() breaks channel test on AppVeyor. * Conceal test passes even without the bug fix. * No test for what 8.0.0047 fixes. * On Windows job_stop() stops cmd.exe, not the processes it runs. (Linwei) * Minor comment and style deficiencies. * When setting 'filetype' there is no check for a valid name. * Tests fail without the 'keymap' features. * Positioning of the popup menu is not good. * Vim does not build on VMS systems. * When using an Ex command for 'keywordprg' it is escaped as with a shell command. (Romain Lafourcade) * Compiler warning for unused variable. * No digraph for HORIZONTAL ELLIPSIS. * Compiler warning for comparing with unsigned. (Zoltan Arpadffy) * Normal test fails on MS-Windows. * Compiler warning for unused function in tiny build. (Tony Mechelynck) * when calling an operator function when 'linebreak' is set, it is internally reset before calling the operator function. * VMS has a problem with infinity. * Checking did_throw after executing autocommands is wrong. (Daniel Hahler) * Compiler warning for self-comparison. * Tests referred in Makefile that no longer exist. * Exit value from a shell command is wrong. (Hexchain Tong) * MS-Windows: Crash with long font name. (Henry Hu) * More comparisons between firstwin and lastwin. * Cannot make Vim fail on an internal error. * Using number for exception type lacks type checking. * Channel log has double parens ()(). * The GUI code is not tested by Travis. * Accessing freed memory in quickfix. * Accessing freed memory in quickfix. (Domenique Pelle) * The OS X build fails on Travis. * Inconsistent function names. * Extension for configure should be ".ac". * Using freed memory with win_getid(). (Domenique Pelle) * Using freed memory when adding to a quickfix list. (Domenique Pelle) * Using freed memory with recursive function call. (Dominique Pelle) * Cannot add a comment after ":hide". (Norio Takagi) * When the channel callback gets job info the job may already have been deleted. (lifepillar) * When a test fails in Setup or Teardown the problem is not reported. * Various problems with GTK 3.22.2. * Cursor moved after last character when using 'breakindent'. * Test_help_complete sometimes fails in MS-Windows console. * C indenting does not support nested namespaces that C++ 17 has. - Drop bsc-1008800.patch, fixed upstream.- Add bsc-1008800.patch to fix gvim rendering with recent gtk+ update. Fixes bsc#1008800. Patch by Jan Alexander Steffens.- Updated to revision 45, fixes the following problems * Cannot use overlapping positions with matchaddpos(). * No completion for ":messages". * Order of matches for 'omnifunc' is messed up. (Danny Su) * Detecting that a job has finished may take a while. * Get E924 when switching tabs. * OPEN_CHR_FILES not defined for FreeBSD using Debian userland files. * When Vim 8 reads an old viminfo and exits, the next time marks are not read from viminfo. (Ned Batchelder) * Whole line highlighting with matchaddpos() does not work. * When using Insert mode completion but not actually inserting anything an undo item is still created. (Tommy Allen) * When using Insert mode completion with 'completeopt' containing "noinsert" change is not saved for undo. (Tommy Allen) * When using Insert mode completion with 'completeopt' containing "noinsert" with CTRL-N the change is not saved for undo. (Tommy Allen) * In diff mode the cursor may end up below the last line, resulting in an ml_get error. * Calling job_stop() right after job_start() does not work.- Updated to revision 32, fixes the following problems * getwinvar() returns wrong Value of boolean and number options, especially non big endian systems. (James McCoy) * A string argument for function() that is not a function name results in an error message with NULL. (Christian Brabandt) * Netbeans test fails with Python 3. (Jonathonf) * ":lb" is interpreted as ":lbottom" while the documentation says it means ":lbuffer". * Vim 7.4 is still mentioned in a few places. * Popup complete test is disabled. * Unnecessary workaround for AppVeyor. * Crash when editing file that starts with crypt yeader. (igor2x) * On OSX Test_pipe_through_sort_all() sometimes fails. * Typos in comments. * Missing comma in list. * Crypt tests are old style. * Can't tell which part of a channel has "buffered" status. * Build fails. * Cannot get the number of the current quickfix or location list. * When using ":sleep" channel input is not handled. * Test_command_count is old style. * The regexp engines are not reentrant. * In the GUI when redrawing the cursor it may be on the second half of a double byte character. * If a channel in NL mode is missing the NL at the end the remaining characters are dropped. * "gd" and "gD" may find a match in a comment or string. * When the netbeans channel closes, "DETACH" is put in the output part. (Ozaki Kiichi) * Inconsistent use of spaces vs tabs in gd test. * Error format with %W, %C and %Z does not work. (Gerd Wachsmuth) * A channel is closed when reading on stderr or stdout fails, but there may still be something to read on another part. * Superfluous semicolons. * Code for MS-Windows is complicated because of the exceptions for old systems. * Mouse mode is not automatically detected for tmux. * After ":bwipeout" 'fileformat' is not set to the right default.- Updated to revision 3, fixes the following problems * getwinvar() returns wrong Value of boolean and number options, especially non big endian systems. (James McCoy)- Updated to revision 2, fixes the following problems * Intro screen still mentions version7. (Paul) * The netrw plugin does not work.- Update to version 8.0 * Crash on exit when EXITFREE is defined. (Dominique Pelle) * Valgrind reports using uninitialzed memory. (Dominique Pelle) * Test 86 and 87 fail with some version of Python. * Netbeans test fails when run from unpacked MS-Windows sources. * Netbeans test fails in shadow directory. * Not enough test coverage for Normal mode commands. * The example that explains nested backreferences does not work properly with the new regexp engine. (Harm te Hennepe) * Regexp fails to match when using "\>\)\?". (Ramel) * Reading past end of line when using previous substitute pattern. (Dominique Pelle) * Attempt to read history entry while not initialized. * Compiler warnings with Solaris Studio when using GTK3. * Memory leak in timer_start(). * Invalid memory access when formatting. (Dominique Pelle) * Checking for last_timer_id to overflow is not reliable. (Ozaki Kiichi) * Illegal memory access with ":1@". (Dominique Pelle) * Superfluous function prototypes. * Sort test sometimes fails. * Needless line break. Confusing directory name. * MS-Windows gvim.exe does not have DirectX support. * Test runner misses a comma.- Updated to revision 2347, fixes the following problems * submatch() does not check for a valid argument. * The 'langnoremap' option leads to double negatives. And it does not work for the last character of a mapping. * Can't use "." and "$" with ":tab". * With SGR mouse reporting (suckless terminal) the mouse release and scroll up/down is confused. * Warning for missing declaration of skip_vimgrep_pat(). (John Marriott) * Tests using the sleep time can be flaky. * Timer test sometimes fails. * Timer test sometimes fails. * Warning for assigning negative value to unsigned. (Danek Duvall) * Adding pattern to ":oldfiles" is not a generic solution. * Filter test fails. * Oldfiles test fails. * Tiny build fails. (Tony Mechelynck) * When cancelling the :ptjump prompt a preview window is opened for a following command. * Missing colon in error message. * Some error message cannot be translated. * In rare cases diffing 4 buffers is not enough. * Compiler warnings for signed/unsigned in expression. * Check for Windows 3.1 will always return false. (Christian Brabandt) * Compiler warnings in MzScheme code. * The script that checks translations can't handle plurals. * Coverity complains about null pointer check. * Coverity complains about not checking for NULL. * Two JSON messages are sent without a separator. * With 'incsearch' can only see the next match. * Channel test is flaky. * Build fails with small features. * Fail to read register content from viminfo if it is 438 characters long. (John Chen) * :filter does not work for many commands. Can only get matching messages. * When adding entries to an empty quickfix list the title is reset. * printf() isn't tested much. * printf() test fails on Windows. "-inf" is not used. * Build fails on MS-Windows. * Using CTRL-N and CTRL-P for incsearch shadows completion keys. * Using 'hlsearch' highlighting instead of matchpos if there is no search match. * Insufficient testing for NUL bytes on a raw channel. * Netbeans test doesn't read settings from file. * getbufinfo(), getwininfo() and gettabinfo() are inefficient. * getwininfo() and getbufinfo() are inefficient. * Command line completion on "find **/filename" drops sub-directory. * ":diffoff!" does not remove filler lines. * Command line test fails on Windows when run twice. * Memory leak in getbufinfo() when there is a sign. (Dominique Pelle) * New users have no idea of the 'scrolloff' option. * Starting diff mode with the cursor in the last line might end up only showing one closed fold. (John Beckett) * printf() doesn't handle infinity float values correctly. * Timer test fails sometimes. * When a child process is very fast waiting 10 msec for it is noticeable. (Ramel Eshed) * Part of ":oldfiles" command isn't cleared. (Lifepillar) * Comment in scope header file is outdated. (KillTheMule) * Generated files are outdated. * The tee program isn't included. Makefile contains build instructions that don't work. * The callback passed to ch_sendraw() is not used. * MS-Windows build instructions are clumsy. "dosbin" doesn't build. * When installing and $DESTDIR is set the icons probably won't be installed. * Compiler warning in tiny build. (Tony Mechelynck) * printf() handles floats wrong when there is a sign. * Not all systems understand %F in printf(). * Modelines in source code are inconsistent. * Sign test fails on MS-Windows when using the distributed zip archives. * Cscope test fails. * No tests for :undolist and "U" command. * When starting a job that reads from a buffer and reaching the end, the job hangs. * It is not possible to close the "in" part of a channel. * QuickFixCmdPre and QuickFixCmdPost autocommands are not always triggered. * Get warning for deleting autocommand group when the autocommand using the group is scheduled for deletion. (Pavol Juhas) * MS-Windows: some files remain after testing. * Default interface versions for MS-Windows are outdated. * When using "is" the mode isn't always updated. * In a timer callback the timer itself can't be found or stopped. (Thinca) * Marks, writefile and nested function tests are old style. * Default value for 'langremap' is wrong. * Several tests are old style. * Old charsearch test still listed in Makefile. * Crash when doing tabnext in a BufUnload autocmd. (Dominique Pelle) * Accessing freed memory when a timer does not repeat. * Appveyor 64 bit build still using Python 3.4 * Crash when autocommand moves to another tab. (Dominique Pelle) * Crash when deleting an augroup and listing an autocommand. (Dominique Pelle) * No error when deleting an augroup while it's the current one. * Insufficient testing for Normal mode commands. * Channel sort test is flaky. * Normal mode tests fail on MS-Windows. * When 'incsearch' is not set CTRL-T and CTRL-G are not inserted as before. * No way for a system wide vimrc to stop loading defaults.vim. (Christian Hesse) * Redraw problem when using 'incsearch'. * When a test is commented out we forget about it. * Access memory beyond the end of the line. (Dominique Pelle) * Using freed memory when using 'formatexpr'. (Dominique Pelle) * Crash when editing a new buffer and BufUnload autocommand wipes out the new buffer. (Norio Takagi) * Tiny build fails. * Illegal memory access when Visual selection starts in invalid position. (Dominique Pelle) * Freeing a variable that is on the stack. * Crash when BufWinLeave autocmd goes to another tab page. (Hirohito Higashi) * Error for min() and max() contains %s. (Nikolay Pavlov) * Coverity complains about not checking curwin to be NULL. * Using CTRL-X CTRL-V to complete a command line from Insert mode does not work after entering an expression on the command line. * Crash when stop_timer() is called in a callback of a callback. Vim hangs when the timer callback uses too much time. * Outdated comments in test. * On MS-Windows test_getcwd leaves Xtopdir behind. * taglist() is slow. (Luc Hermitte) * Running normal mode tests leave a couple of files behind. (Yegappan Lakshmanan) * taglist() is still slow. (Luc Hermitte) * Can't build with small features. (John Marriott) * Tab page test fails when run as fake root. * MS-Windows: Building with Ruby uses old version. * Tiny things. Test doesn't clean up properly. * Typo in MS-Windows build script. * Too many old style tests. * The "Reading from channel output..." message can be unwanted. Appending to a buffer leaves an empty first line behind. * For MinGW RUBY_API_VER_LONG isn't set correctly. Many default version numbers are outdated. * Autocommand test fails when run directly, passes when run as part of test_alot.- Updated to revision 2334, fixes the following problems * No tests for :undolist and "U" command. * When starting a job that reads from a buffer and reaching the end, the job hangs. * It is not possible to close the "in" part of a channel. * QuickFixCmdPre and QuickFixCmdPost autocommands are not always triggered. * Get warning for deleting autocommand group when the autocommand using the group is scheduled for deletion. (Pavol Juhas) * MS-Windows: some files remain after testing. * Default interface versions for MS-Windows are outdated. * When using "is" the mode isn't always updated. * In a timer callback the timer itself can't be found or stopped. (Thinca) * Marks, writefile and nested function tests are old style. * Default value for 'langremap' is wrong. * Several tests are old style. * Old charsearch test still listed in Makefile. * Crash when doing tabnext in a BufUnload autocmd. (Dominique Pelle) * Accessing freed memory when a timer does not repeat. * Appveyor 64 bit build still using Python 3.4 * Crash when autocommand moves to another tab. (Dominique Pelle) * Crash when deleting an augroup and listing an autocommand. (Dominique Pelle) * No error when deleting an augroup while it's the current one. * Insufficient testing for Normal mode commands. * Channel sort test is flaky. * Normal mode tests fail on MS-Windows. * When 'incsearch' is not set CTRL-T and CTRL-G are not inserted as before. * No way for a system wide vimrc to stop loading defaults.vim. (Christian Hesse) * Redraw problem when using 'incsearch'. * When a test is commented out we forget about it. * Access memory beyond the end of the line. (Dominique Pelle) * Using freed memory when using 'formatexpr'. (Dominique Pelle) * Crash when editing a new buffer and BufUnload autocommand wipes out the new buffer. (Norio Takagi) * Tiny build fails. * Illegal memory access when Visual selection starts in invalid position. (Dominique Pelle) * Freeing a variable that is on the stack. * Crash when BufWinLeave autocmd goes to another tab page. (Hirohito Higashi) * Error for min() and max() contains %s. (Nikolay Pavlov) * Coverity complains about not checking curwin to be NULL. * Using CTRL-X CTRL-V to complete a command line from Insert mode does not work after entering an expression on the command line. * Crash when stop_timer() is called in a callback of a callback. Vim hangs when the timer callback uses too much time. * Outdated comments in test. * On MS-Windows test_getcwd leaves Xtopdir behind.- Updated to revision 2295, fixes the following problems * The field names used by getbufinfo(), gettabinfo() and getwininfo() are not consistent. * Tab page tests are old style. * Test files have inconsistant modelines. * Startup test fails on Solaris. * There is no equivalent of 'smartcase' for a tag search. * ":oldfiles" output is a very long list. * The default ttimeoutlen is very long. * Crash when using funcref() with invalid name. (Dominique Pelle) * Can't build with +eval but without +quickfix. (John Marriott) * submatch() does not check for a valid argument. * The 'langnoremap' option leads to double negatives. And it does not work for the last character of a mapping. * Can't use "." and "$" with ":tab". * With SGR mouse reporting (suckless terminal) the mouse release and scroll up/down is confused. * Warning for missing declaration of skip_vimgrep_pat(). (John Marriott) * Tests using the sleep time can be flaky. * Timer test sometimes fails. * Timer test sometimes fails. * Warning for assigning negative value to unsigned. (Danek Duvall) * Adding pattern to ":oldfiles" is not a generic solution. * Filter test fails. * Oldfiles test fails. * Tiny build fails. (Tony Mechelynck) * When cancelling the :ptjump prompt a preview window is opened for a following command. * Missing colon in error message. * Some error message cannot be translated. * In rare cases diffing 4 buffers is not enough. * Compiler warnings for signed/unsigned in expression. * Check for Windows 3.1 will always return false. (Christian Brabandt) * Compiler warnings in MzScheme code. * The script that checks translations can't handle plurals. * Coverity complains about null pointer check. * Coverity complains about not checking for NULL. * Two JSON messages are sent without a separator. * With 'incsearch' can only see the next match. * Channel test is flaky. * Build fails with small features. * Fail to read register content from viminfo if it is 438 characters long. (John Chen) * :filter does not work for many commands. Can only get matching messages. * When adding entries to an empty quickfix list the title is reset. * printf() isn't tested much. * printf() test fails on Windows. "-inf" is not used. * Build fails on MS-Windows. * Using CTRL-N and CTRL-P for incsearch shadows completion keys. * Using 'hlsearch' highlighting instead of matchpos if there is no search match. * Insufficient testing for NUL bytes on a raw channel. * Netbeans test doesn't read settings from file. * getbufinfo(), getwininfo() and gettabinfo() are inefficient. * getwininfo() and getbufinfo() are inefficient. * Command line completion on "find **/filename" drops sub-directory. * ":diffoff!" does not remove filler lines. * Command line test fails on Windows when run twice. * Memory leak in getbufinfo() when there is a sign. (Dominique Pelle) * New users have no idea of the 'scrolloff' option. * Starting diff mode with the cursor in the last line might end up only showing one closed fold. (John Beckett) * printf() doesn't handle infinity float values correctly. * Timer test fails sometimes. * When a child process is very fast waiting 10 msec for it is noticeable. (Ramel Eshed) * Part of ":oldfiles" command isn't cleared. (Lifepillar) * Comment in scope header file is outdated. (KillTheMule) * Generated files are outdated. * The tee program isn't included. Makefile contains build instructions that don't work. * The callback passed to ch_sendraw() is not used. * MS-Windows build instructions are clumsy. "dosbin" doesn't build. * When installing and $DESTDIR is set the icons probably won't be installed. * Compiler warning in tiny build. (Tony Mechelynck) * printf() handles floats wrong when there is a sign. * Not all systems understand %F in printf(). * Modelines in source code are inconsistent. * Sign test fails on MS-Windows when using the distributed zip archives. * Cscope test fails.- Updated to revision 2225, fixes the following problems * When using matchaddpos() a character after the end of the line can be highlighted. * Can't build with +timers when +digraph is not included. * Recursive call to substitute gets stuck in sandbox. * printf() gives an error when the argument for %s is not a string. * printf() does not support binary format. * Sourcing a script where a character has 0x80 as a second byte does not work. * Buffer overflow when using latin1 character with feedkeys(). * Compiler warnings with older compiler and 64 bit numbers. * Crash when placing a sign in a deleted buffer.- Updated to revision 2216, fixes the following problems * The qf_init_ext() function is too big. * Compiler warning for initializing a struct. * There is still code and help for unsupported systems. * There is no way to get a list of the error lists. * When using ":vimgrep" may end up with duplicate buffers. * No proper testing of trunc_string(). * Coverage report is messed up by the unittests. * Can't run scripttests in the top directory. * Wrong part of #ifdef removed. * eval.c is too big. * Build fails. * eval.c is too big. * eval.c is too big. * Non-Unix builds fail. * Wrong file name. * qf_init_ext() is too big. * Using dummy variable to compute struct member offset. * eval.c is still too big. * Coverity warns for possible buffer overflow. * Compiler warns for uninitialzed variable. (John Marriott) * getcompletion() not well tested. * Compiler warning for char/char_u conversion. * Not all arguments of trunc_string() are tested. Memory access error when running the message tests. * spell.c is too big. * Missing change to include file. * The return value of type() is difficult to use. * substitute() does not support a Funcref argument. * rgb.txt is read for every color name. * One more place using a dummy variable. * No autocommand event to initialize a window or tab page. * Syntax error when dict has '>' key. * Cannot update 'tabline' when a tab was closed. * Running checks in po diretory fails. * Netbeans test fails on non-Unix systems. * When using PERROR() on some systems assert_fails() does not see the error. * Line numbers in the error list are not always adjusted. * Not much test coverage for digraphs. * Coverity complains about not restoring a value. * New digraph test makes testing hang. * Digraph tests fails on some systems. * Using the system default encoding makes tests unpredictable. * Digraph code test coverage is still low. * Keymap test fails with normal features. * Color handling of X11 GUIs is too complicated. * Using submatch() in a lambda passed to substitute() is verbose. * Coverity reports a resource leak when out of memory. * GTK 3 build fails with older GTK version. * Netbeans test fails once in a while. Leaving log file behind. * The color allocation in X11 is overly complicated. * Man test fails when run with the GUI. * Lambda functions show up with completion. * Warning from 64 bit compiler. * Text object tests are old style. * When a keymap is active only "(lang)" is displayed. * "cgn" and "dgn" do not work correctly with a single character match and the replacement includes the searched pattern. * Looping over windows, buffers and tab pages is inconsistant. * Tiny build with GUI fails. * Can't have "augroup END" right after ":au!". * Code duplication when unreferencing a function. * Configure reports default features to be "normal" while it is "huge". * Clang warns about missing field in initializer. * Misplaced equal sign. * Netbeans test is flaky. * Setting 'display' to "lastline" is a drastic change, while omitting it results in lots of "@" lines. * When there is an CmdUndefined autocmd then the error for a missing command is E464 instead of E492. (Manuel Ortega) * Defaults are very conservative. * getcompletion(.., 'dir') returns a match with trailing "*" when there are no matches. * Test for undo is flaky. * Tiny build fails. * Loading defaults.vim with -C argument. * The default vimrc for Windows is very conservative. * Deleting an augroup that still has autocmds does not give a warning. The next defined augroup takes its place. * Mac: can't build with tiny features. * Closures are not supported. * User defined functions can't be a closure. * No easy way to check if lambda and closure are supported. * Mac: don't get +clipboard in huge build. * No new style test for diff mode. * diffmode test leaves files behind, breaking another test. * Compiler warning for loss of data. * No tests for :diffget and :diffput * The short form of ":noswapfile" is ":noswap" instead of ":nos". * Memory leak when saving for undo fails. * Memory leak when using timer_start(). (Dominique Pelle) * Pending timers cause false memory leak reports. * More memory leaks when using partial, e.g. for "exit-cb". * test_partial has memory leaks reported. * Can't build with tiny features. * No error for using function() badly. * Various tiny issues. * Closure function fails. * Using function() with a name will find another function when it is redefined. * Test 86 and 87 fail. * :delfunction causes illegal memory access. * Tiny build fails. * Coverity reports bogus NULL check. * Leaking memory when redefining a function. * A funccal is garbage collected while it can still be used. * On MS-Windows quickix does not handle a line with 1023 bytes ending in CR-LF properly. * Win32: Using CreateThread/ExitThread is not safe. * Not enough testing for popup menu. CTRL-E does not always work properly. * test_alot fails. * Not much testing for cscope. * If a test leaves a window open a following test may fail. * Warning with MinGW 64. (John Marriott) * Quickfix test fails on MS-Windows. * No proper translation of messages with a count. * GUI test isn't testing much. * Test_communicate() fails sometimes. * Quotes make GUI test fail on MS-Windows. * Compiler warning. * Test_job_start_fails() is expected to report memory leaks, making it hard to see other leaks in test_partial. * Result of getcompletion('', 'cscope') depends on previous completion. * Insufficient testing for cscope. * setmatches() mixes up values. (Nikolai Pavlov) * Expression test fails without conceal feature. * Result of getcompletion('', 'sign') depends on previous completion. * match() and related functions tested with old style test. * It is not possible to use plugins in an "after" directory to tune the behavior of a package. * Startup test fails on MS-Windows. * Small build can't run startup test. * Small build can't run tests. * Not running the startup test on MS-Windows. * Startup test gets stuck on MS-Windows. * Cannot get information about timers. * MS-Windows build fails. * No test for "vim --help". * Can't test help on MS-Windows. * Adding duplicate flags to 'whichwrap' leaves commas behind. * Insufficient testing of cscope. * #ifdefs in main() are complicated. * No testing for -C and -N command line flags, file arguments, startuptime. * No test for reading from stdin. * Reading from stdin test fails on MS-Windows. * There is no easy way to stop all timers. There is no way to temporary pause a timer. * Compiler warning for unused variable. * Color Grey40 used in startup but not in the short list. * Sign tests are old style. * Tests that use RunVim() do not actually perform the test. * Test glob2regpat does not test much. * Timers test is flaky. * glob2regpat test fails on Windows. * Completion does not work properly with some plugins. * Cannot detect encoding in a fifo. * When startup test fails it's not easy to find out why. GUI test fails with Gnome. * No automatic prototype for vim_main2(). * Generating prototypes with Cygwin doesn't work well. * With Gnome when the GUI can't start test_startup hangs. * Sign tests don't cover enough. * MS-Windows: The vimrun program does not support Unicode. * glob2regpat test doesn't test everything on MS-Windows. * All functions are freed on exit, which may hide leaks. * Test alot sometimes fails under valgrind. (Dominique Pelle) * In the GUI the cursor is hidden when redrawing any window, causing flicker. * Cannot get all information about a quickfix list. * The sign column disappears when the last sign is deleted. * Build fails with small features. * Test fails with normal features. * It is not easy to get information about buffers, windows and tabpages. * 'wildignore' always applies to getcompletion(). * Warning for unused function. * The +xpm feature is not sorted properly in :version output. * Test for mappings is old style. * Cannot map . (Stephen Riehm) * On OSX configure mixes up a Python framework and the Unix layout. * Mouse support is not automatically enabled with simple term. * Mark " is not set when closing a window in another tab. (Guraga) * Cannot highlight the "~" lines at the end of a window differently. * A font that uses ligatures messes up the screen display. * It's not easy to find out if a window is a quickfix or location list window. * Test fails without the +sign feature.- Updated to revision 2045, fixes the following problems * Looking up a buffer by number is slow if there are many. * Netbeans file authentication not tested. * GTK: display updating is not done properly and can be slow. * setbufvar() causes a screen redraw. * filter() and map() either require a string or defining a function. * Memory leak when using a function callback.- Updated to revision 2033, fixes the following problems * Memory access error when reading viminfo. (Dominique Pelle) * "gd" hangs in some situations. (Eric Biggers) * Not all quickfix tests are also done with the location lists. * Background is not drawn properly when 'termguicolors' is set. * Coverity warns for unreachable code. * Win32: Cannot compile with XPM feature using VC2015 * The Man plugin doesn't work that well. * File list does not include new XPM libraries. * Viminfo continuation line with wrong length isn't skipped. (Marius Gedminas) * Using Ctrl-A with double-byte encoding may result in garbled text. * Minor problems with the quickfix code. * Quickfix long lines test not executed for buffer. * Ruby test is old style. * Cscope interface does not support finding assignments. * Not all parts of the quickfix code are tested. * No test for what 7.4.1948 fixes. * Using 32-bit Perl with 64-bit time_t causes memory corruption. (Christian Brabandt) * When using CTRL-W f and pressing "q" at the ATTENTION dialog the newly opened window is not closed. * Perl interface has obsolete workaround. * Perl interface preprocessor statements not nicely indented. * Crash when running test_channel.vim on Windows. * Unicode standard 9 was released. * When 'insertmode' is reset while doing completion the popup menu remains even though Vim is in Normal mode. * Two test files for increment/decrement. * Running Win32 Vim in mintty does not work. * The quickfix init function is too big. * When using a job in raw mode to append to a buffer garbage characters are added. * Coverity reports a resource leak. * Falling back from NFA to old regexp engine does not work properly. (fritzophrenic) * Invalid memory access with "\. * When the netbeans channel is closed consuming the buffer may cause a crash. * Using ":insert" in an empty buffer sets the jump mark. (Ingo Karkat) * It is not easy to see unrecognized error lines below the current error position. * On Solaris select() does not work as expected when there is typeahead. * GUI has a problem with some termcodes. * On MS-Windows large files (> 2Gbyte) cause problems. * Number variables are not 64 bits while they could be. * With 64 bit changes don't need three calls to sprintf(). * Large file test does not delete its output. * Getting value of binary option is wrong. (Kent Sibilev) * 'errorformat' is parsed for every call to ":caddexpr". Can't add to two location lists asynchronously. * No testing for Farsi code. * Viminfo file contains duplicate change marks. * farsi.c and arabic.c are included in a strange way. * Not all quickfix features are tested. * Missing changes in VMS build file. * Compiler warns for loss of data. * When copying unrecognized lines for viminfo, end up with useless continuation lines. * When updating viminfo with file marks there is no time order. * filter() and map() only accept a string argument. * Cscope items are not sorted. * glob() does not add a symbolic link when there are no wildcards. * Values for true and false can be confusing. * Not all TRUE and FALSE arguments are tested. * True-false test fails. * GUI: cursor drawn in wrong place if a timer callback causes a screen update. (David Samvelyan) * Capturing the output of a command takes a few commands. * Cannot easily scroll the quickfix window. * When writing buffer lines to a job there is no NL to NUL conversion. * evalcmd() doesn't work recursively. * Evalcmd test fails. * Tiny build fails. (Tony Mechelynck) * Crash when passing number to filter() or map(). * Still cursor flickering when a callback updates the screen. (David Samvelyan) * GUI: cursor displayed in the wrong position. * After using evalcmd() message output is in the wrong position. (Christian Brabandt) * Crash when using tabnext in BufUnload autocmd. (Norio Takagi) * Running the tests leaves a viminfo file behind. * evalcmd() has a confusing name. * Messages test fails. * There is a :cbottom command but no :lbottom command. * It is not easy to get a list of command arguments. * Test for getcompletion() does not pass on all systems. * Using "noinsert" in 'completeopt' breaks redo. * Using "noinsert" in 'completeopt' does not insert match. * When a file gets a name when writing it 'acd' is not effective. (Dan Church) * Warning from MinGW about _WIN32_WINNT redefined. (John Marriott) * When there are many errors adding them to the quickfix list takes a long time. * buf_valid() can be slow when there are many buffers. * When ignoring case utf_fold() may consume a lot of time. * Can't build without +autocmd feature. * Still too many buf_valid() calls. * Warnings from 64 bit compiler. * buflist_findname_stat() may find a dummy buffer. * More buf_valid() calls can be optimized. * The cursor blinking stops or is irregular when receiving date over a channel and writing it in a buffer, and when updating the status. * Reference counting for callbacks isn't right. * Can't build with +eval but without +menu. * cppcheck warns for using index before limits check. * printf() does not work with 64 bit numbers. * ARCH must be set properly when using MinGW. * The list_lbr_utf8 test fails if ~/.vim/syntax/c.vim sets 'textwidth' to a non-zero value. * Build fails with 64 bit MinGW. (Axel Bender) * 'cscopequickfix' option does not accept new value "a".- Updated to revision 1938, fixes the following problems * Updating marks in a quickfix list is very slow when the list is long. * When waiting for a character is interrupted by receiving channel data and the first character of a mapping was typed, the mapping times out. * When receiving channel data 'updatetime' is not respected. * Wrong computation of remaining wait time in RealWaitForChar() * When umask is set to 0177 Vim can't create temp files. * GUI: When channel data is received the cursor blinking is interrupted. * Channel reading very long lines is slow. * balloon eval only gets the window number, not the ID. * Cannot easily get the window ID for a buffer. * Cannot get the window ID for a mouse click. * Cannot use a window ID where a window number is expected. * Invoking mark_adjust() when adding a new line below the last line is pointless. * Various typos, long lines and style mistakes. * User commands don't support modifiers. * GTK 3: cursor blinking doesn't work well. * Using CTRL-] in the help on "{address}." doesn't work. * Win32: the "Disabled" menu items would appear enabled. * No test for collapsing buffers for a channel. Some text is lost. * When writing viminfo merging current history with history in viminfo may drop recent history entries. * Some compilers can't handle a double semicolon. * Collapsing channel buffers and searching for NL does not work properly. * Warnings from 64 bit compiler. * Netbeans uses uninitialzed pointer and freed memory. * Doubled semicolons. * Tests using external command to delete directory. * Recent history lines may be lost when exiting Vim. * No test for using setqflist() on an older quickfix list. * When ":doautocmd" is used modelines are used even when no autocommands were executed. * Executing autocommands while using the signal stack has a high chance of crashing Vim. * The effect of the PopupMenu autocommand isn't directly visible. * No proper test for what 7.4.1906 fixes. * History lines read from viminfo in different encoding than when writing are not converted. * Not enough testing for parsing viminfo lines. * Register contents is not merged when writing viminfo. * Missing test changes. * vim_time() not included when needed. * Ruby 2.4.0 unifies Fixnum and Bignum into Integer. * Command line editing is not tested much. * Missing "void" for functions without argument. * Viminfo does not merge file marks properly. * Possible crash with many history items. * Compiler warning for signed/unsigned. * Overwriting pointer argument. * Inconsistent indenting and weird name. * Can't build without +spell but with +quickfix. * Using both old and new style file mark lines from viminfo. * When writing viminfo the jumplist is not merged with the one in the viminfo file. * Compiler warning about uninitialzed variable. * New style tests not executed with MinGW compiler. * When using the GUI search/replace a second match right after the replacement is skipped. * Off-by-one error in bounds check. * No test for directory stack in quickfix. * When writing viminfo numbered marks were duplicated. - Refresh vim-7.3-filetype_spec.patch- Link to perl directly instead of dlopen'ing it.- vim must require %{?libperl_requires}, if perl is not updated with vim in lockstep, the following error occurs: vim: error while loading shared libraries: libperl.so and the program stops working. (boo#982869)- Updated to revision 1883, fixes the following problems * Python: encoding error with Python 2. * Memory leaks in test49. * Invalid memory access when exiting with EXITFREE defined. * Memory leak in test_matchstrpos. * Setting really_exiting causes memory leaks to be reported. * Appending to the quickfix list while the quickfix window is open is very slow. * When a callback adds a timer the GUI doesn't use it until later. * Comparing functions and partials doesn't work well. * Typing "k" at the hit-enter prompt has no effect. * Whether a job has exited isn't detected until a character is typed. After calling exit_cb the cursor is in the wrong place. * Channel test is flaky. * Appending to a long quickfix list is slow. * Check for line break at end of line wrong. * Cppcheck found 2 incorrect printf formats.- Updated to revision 1862, fixes the following problems * Using a partial for timer_start() may cause a crash. * Compiler warnings with 64 bit compiler. * string() with repeated argument does not give a result usable by eval().- Updated to revision 1859, fixes the following problems * Tests involving Python are flaky. * Ubsan detects a multiplication overflow. * Getting an item from a NULL dict crashes. * Can't build with Strawberry Perl 5.24 (obsoletes perl-5.24.patch) * Still trying to read from channel that is going to be closed. * GUI freezes when using a job. * test_syn_attr fails when using the GUI. * Unix: Cannot run all tests with the GUI. * Crash when job and channel are in the same dict while using partials. * When setting 'termguicolors' the Ignore highlighting doesn't work. * Valgrind reports memory leak for job that is not freed. * When a channel appends to a buffer that is 'nomodifiable' there is an error but appending is done anyway. * When a channel writes to a buffer it doesn't find a buffer by the short name but re-uses it anyway. * Cannot use a function reference for "exit_cb".- Update apparmor.vim (taken from AppArmor 2.10.1) * add support for the "unspec" network keyword- Updated to revision 1842, fixes the following problems * non-antialiased misnamed. * When timer_stop() is called with a string there is no proper error message. * Memory leak in debug commands. * Cannot use an Ex command for 'keywordprg'. * Possible crash when conceal is active. * When splitting and closing a window the status height changes. * When using a partial on a dictionary it always gets bound to that dictionary. * The BufUnload event is triggered twice, when :bunload is used with `bufhidden` set to `unload` or `delete`. * Functions specifically for testing do not sort together. * Cannot get the items stored in a partial. * When using packages an "after" directory cannot be used. * The code to reallocate the buffer used for quickfix is repeated. * get() works for Partial but not for Funcref.- Fix build with perl 5.24 (perl-5.24.patch)- Updated to revision 1829, fixes the following problems * No error when invoking a callback when it's not safe. * May try to access buffer that's already freed. * No message on channel log when buffer was freed.- Updated to revision 1826, fixes the following problems * The screen is not updated if a callback is invoked when closing a channel. * Help completion adds @en to all matches except the first one. * Compiler warnings when sprintf() is a macro. * Removing language from help tags too often. * Redirecting stdout of a channel to "null" doesn't work. * When a job is no longer referenced and does not have an exit callback the process may hang around in defunc state. * When job writes to buffer nothing is written. * Callbacks are invoked when it's not safe.- Updated to revision 1816, fixes the following problems * 'guicolors' is a confusing option name. * Quickfix doesn't handle long lines well, they are split. * GTK3 doesn't handle menu separaters properly. * Can't use Vim as MANPAGER. * Running tests in shadow dir fails. * 'termguicolors' option missing from the options window. * Test_out_close_cb sometimes fails. * Using wrong feature name to check for 'termguicolors'. * Using wrong short option name for 'termguicolors'. * Sending DETACH after a channel was closed isn't useful. * Netbeans channel gets garbage collected. * Memory access error when running test_quickfix. * A channel may be garbage collected while it's still being used by a job. * Looping over a null list throws an error. - Refresh vim-7.4-filetype_mine.patch- Updated to revision 1796, fixes the following problems * Cannot use ch_read() in the close callback. * Leading white space in a job command matters. * Channel could be garbage collected too early. * Color name decoding is implemented several times. * Some character classes may differ between systems.- Updated to revision 1786, fixes the following problems * When using the term truecolor feature, the t_8f and t_8b termcap options are not set by default. * Using negative index in strcharpart(). * Warnings reported by cppcheck. * synIDattr() does not respect 'guicolors'. * strcharpart() does not work properly with some multi-byte characters. * The old regexp engine doesn't handle character classes correctly. * Compiled-in colors do not match rgb.txt.- Updated to revision 1778, fixes the following problems * When using complete() it may set 'modified' even though nothing was inserted. * When using feedkeys() in a timer the inserted characters are not used right away. * Undo options are not together in the options window. * Arguments of setqflist() are not checked properly. * No "closed", "errors" and "encoding" attribute on Python output. * Cannot use true color in the terminal. * Newly added features can escape the sandbox. * When using the term truecolor feature, the t_8f and t_8b termcap options are not set by default.- Updated to revision 1754, fixes the following problems * When a buffer gets updated while in command line mode, the screen may be messed up. * Crash when 'tagstack' is off. (Dominique Pelle) * When adding to the quickfix list the current position is reset. * "noinsert" in 'completeopt' is sometimes ignored * syntax not set when using ":buf" and 'filetype' set manually- Updated to revision 1749, fixes the following problems * Cannot detect a crash in tests when caused by garbagecollect(). * The help for functions require a space after the "(". * The Perl interface cannot use 'print' operator for writing directly in standard IO. * It is not easy to get a character out of a string. * Python: turns partial into simple funcref. * Folds may close when using autocomplete. * Test fails when not using utf-8. * It is not possible to only see part of the message history. It is not possible to clear messages. * Count for ":messages" depends on number of lines. * syn-cchar defined with matchadd() does not appear if there are no other syntax definitions which matches buffer text. * Not testing utf-8 characters. * strgetchar() does not work correctly. * Clang warns for uninitialzed variable. (Michael Jarvis) * Python: Converting a sequence may leak memory. * Memory leak in Perl. * Coverity: missing check for NULL pointer. * "gD" does not find match in first column of first line. * When using GTK 3.20 there are a few warnings.- Updated to revision 1726, fixes the following problems * Crash when calling garbagecollect() after starting a job. * When using try/catch in 'tabline' it is still considered an error and the tabline will be disabled. * Tabline test fails in GUI. * Compiler errors for non-ANSI compilers. * ANSI compiler complains about string length.- Updated to revision 1721, fixes the following problems * Leaking memory when opening a channel fails. * Coverity: not using return value of set_ref_in_item(). * Leaking memory when there is a cycle involving a job and a partial. * Tests fail without the job feature.- Updated to revision 1716, fixes the following problems * When using try/catch in 'statusline' it is still considered an error and the status line will be disabled. * For plugins in packages, plugin authors need to take care of all dependencies. * GTK GUI doesn't work on Wayland. * Non-GUI specific settings in the gvimrc_example file. * Double free when a partial is in a cycle with a list or dict. * 'autochdir' doesn't work for the first file.- Updated to revision 1710, fixes the following problems * feedkeys('i', 'x') gets stuck, waits for a character to be typed. * Building the Perl interface gives compiler warnings. * ":syn reset" clears the effect ":syn iskeyword". (James McCoy) * When using :stopinsert in a silent mapping the "INSERT" message isn't cleared. * Display problems when the 'ambiwidth' and 'emoji' options are not set properly or the terminal doesn't behave as expected. * :packadd does not work the same when used early or late. * Using freed memory when parsing 'printoptions' fails. * Using freed memory with "wincmd p". (Dominique Pelle) * Cannot use empty dictionary key, even though it can be useful. * New regexp engine does not work properly with EBCDIC. * Not all output of an external command is read.- Updated to revision 1691, fixes the following problems * When reading JSON from a channel all readahead is used. * channel_get_all() does multiple allocations. * When writing buffer lines to a pipe Vim may block. * Completion doesn't work well for a variable containing "#". * When help exists in multiple languages, adding @ab while "ab" is the default help language is unnecessary. * The Dvorak support is a bit difficult to install. * The justify plugin has to be copied or sourced to be used. * The editexisting plugin has to be copied or sourced to be used. * The swapmous plugin has to be copied or sourced to be used. * The shellmenu plugin has to be copied or sourced to be used. * A reference to the removed file_select plugin remains. * Coverity: copying value of v_lock without initializing it. * Coverity warns for not checking name length (false positive). * Coverity warns for fixed size buffer length (false positive). * Coverity: no check for NULL. * README text is slightly outdated. * There is no easy way to get all the information about a match. * When running tests $HOME/.viminfo is written. * The channel close_cb option does not work. * MzScheme does not support partial. * Ruby interface has inconsistent coding style. * Can't compile with the conceal feature but without multi-byte. * When switching to a new buffer and an autocommand applies syntax highlighting an ml_get error may occur.- Updated to revision 1665, fixes the following problems * When 'F' is in 'shortmess' the prompt for the encryption key isn't displayed. * When binding a function to a dict the reference count is wrong. * Invoking garbage collection may cause a double free. * Crash when an autocommand changes a quickfix list. * Handling emoji characters as full width has problems with backwards compatibility. * Terminating file name has side effects. * Using string() on a partial that exists in the dictionary it binds results in an error. * When a dict contains a partial it can't be redefined as a function. * Using Python vim.bindeval() on a partial doesn't work. * Using freed memory after setqflist() and ":caddbuffer". * Compiler has a problem copying a string into di_key[]. * The matchit plugin needs to be copied to be used. * Quickfix test fails. * Old style test for fnamemodify(). * Users who loaded matchit.vim manually have to change their startup. * Crash when using expand('%:S') in a buffer without a name. * remote_expr() hangs. * Crash when using partial with a timer. * On Unix in a terminal: channel messages are not handled right away. * A plugin does not know when VimEnter autocommands were already triggered. * has('patch-7.4.1') doesn't work. * No test for special characters in channel eval command. * No test for an invalid Ex command on a channel. * Crash in :cgetexpr. * Crash when calling job_start() with a NULL string.- Updated to revision 1635, fixes the following problems * Quickfix code using memory after being freed. * Using channel timeout instead of request timeout. * Timers don't work on Unix. * Not checking for failed open(). * Memory leak when out of memory. * When starting the GUI fails a swap file is left behind. * Timer with an ":echo" command messes up display. * Although emoji characters are ambiguous width, best is to treat them as full width. * Catching exception that won't be thrown. * Having type() handle a Funcref that is or isn't a partial differently causes problems for existing scripts. * Comparing a function that exists on two dicts is not backwards compatible. * string() doesn't handle a partial. * Contents file is only for Amiga distro. * Compiler warnings for non-virtual destructor. * The versplit feature makes the code uneccessary complicated. * Can't build with small features. * Still can't build with small features. * Still quickfix test in old style. * Build fails with tiny features. * Malformed channel request causes a hang. * When a JSON message is split it isn't decoded. * Starting job with output to buffer changes options in the current buffer. * When 'fileformats' is set in the vimrc it applies to new buffers but not the initial buffer. * Emoji characters are not considered as a kind of word character. * Channel test doesn't work with Python 2.6. * Channel demo doesn't work with Python 2.6. * All Channels share the message ID, it keeps getting bigger. * Can't get info about a channel. * Trying to close file descriptor that isn't open. * Missing changes to structs. * Channel out_cb and err_cb are not tested. * 64-bit Compiler warning. * Handling emoji characters as full width has problems with backwards compatibility. * Unicode table for double width is outdated. * Compiler doesn't understand switch on all enum values. * List of test targets is outdated. * If the help tags file was removed "make install" fails. * Vertical movement after CTRL-A ends up in the wrong column. * Channel test is a bit flaky.- Updated to revision 1591, fixes the following problems * Crash when using function reference. * Using ":call dict.func()" where the function is a partial does not work. * Get E923 when using function(dict.func, [], dict). * Warning for unitinialized variable. * Partial is not recognized everywhere. * Nesting partials doesn't work. * Compiler warnings with 64 bit compiler. * Old style test for quickfix. * Combining dict and args with partial doesn't always work. * Warning for shadowed variable. * The quickfix title is truncated.- Updated to revision 1579, fixes the following problems * Passing cookie to a callback is clumsy. * Dict options with a dash are more difficult to use. * Missing update to proto file. * ":helptags ALL" crashes. * An empty list in function() causes an error. * Crash when assert_equal() runs into a NULL string. * Crash in assert_fails(). * Using CTRL-] in help on option in parentheses doesn't work. * Using old style tests for quickfix. * There is no way to avoid the message when editing a file. * No test for ":help". * Setting 'compatible' in test influences following tests. * Tests get stuck at the more prompt. * ":undo 0" does not work. * Write error of viminfo file is not handled properly. * Cannot pass "dict.Myfunc" around as a partial. * There is no way to invoke a function later or periodically.- Updated to revision 1558, fixes the following problems * Using "ever" for packages is confusing. * Specifying buffer number for channel not implemented yet. * MS-Windows job_start() closes wrong handle. * Compiler warning for unitinialized variable. * MS-Windows channel leaks file descriptor. * Using feedkeys() with an empty string disregards 'x' option. * Compiler warning for shadowed variable. * The feedkeys test has a one second delay. * Cannot re-use a channel for another job. * Too many feature flags for pipes, jobs and channels. * Selection with the mouse does not work in command line mode. * Too much code in eval.c. * Channel test is a bit flaky. * Missing job_info(). * job_start() with a list is not tested. * Channel log methods are not tested. * On Win32 escaping the command does not work properly. * GTK3: horizontal cursor movement in Visual selection not good. * Sticky type checking is more annoying than useful. * Getting a cterm highlight attribute that is not set results in the string "-1". * Two tests fail. * Cannot load packages early. * Cannot generate help tags in all doc directories. * ":colorscheme" does not use 'packpath'. * ":runtime" does not use 'packpath'. * Completion for :colorscheme does not use 'packpath'. * List of test targets incomplete. * "make install" changes the help tags file, causing it to differ from the repository. * Windows cannot be identified. * It is not easy to find out what windows display a buffer.- Switch back to GTK+2 because GTK+3 interface seems to be slower.- Updated to revision 1525, fixes the following problems * Statusline highlighting is sometimes wrong. * "J" fails if there are not enough lines. * Channel output to file not implemented yet. * Channel test is a bit flaky. * Channel with disconnected in/out/err is not supported. * Channel test: Waiting for a file to appear doesn't work. * Cannot write channel err to a buffer. * On a high resolution screen the toolbar icons are too small.- Updated to revision 1510, fixes the following problems * Crash when starting a job fails. * Keeping both a variable for a job and the channel it refers to is a hassle. * Channel test fails on AppVeyor.- Updated to revision 1506, fixes the following problems * No error message when :packadd does not find anything. * Garbage collection with an open channel is not tested. * Writing last-but-one line of buffer to a channel isn't implemented yet. * Crash when using ch_getjob(). * No test for reading last-but-one line. * When channel log is enabled get too many "looking for messages" log entries. * Job cannot read from a file.- Updated to revision 1498, fixes the following problems * ":loadplugin" is not optimal, some people find it confusing. * Not using key when result from hangul_string_convert() is NULL. * "inline" is not supported by old MSVC. * Compiler warning for unused function. * Visual-block shift breaks multi-byte characters. * No command line completion for ":packadd". * Wrong callback invoked for zero-id messages. * clr_history() does not work properly. * Crash when built with GUI but it's not active. * Cursor drawing problem with GTK 3. * Error for locked item when using json_decode().- Updated to revision 1485, fixes the following problems * When using hangulinput with utf-8 a CSI character is misintepreted. * Function arguments marked as unused while they are not. * Test_reltime is flaky, it depends on timing. * ":loadplugin" doesn't take care of ftdetect files. * No test for ":loadplugin". * Cannot add a pack direcory without loading a plugin. * "timeout" option not supported on ch_eval*(). * A one-time callback is not used for a raw channel. * Channel "err-io" value "out" is not supported. * Job input from buffer is not implemented.- Updated to revision 1474, fixes the following problems * Sort test doesn't test with "1" argument. * Channel test sometimes fails, especially on OS/X. * Coverity reports missing restore. * Missing out-of-memory check. And Coverity warning. * Can't build without the autocommand feature. * Compiler warnings without the float feature.- Updated to revision 1467, fixes the following problems * Error when reading fails uses wrong errno. Keeping channel open after job stops results in test failing. * The "out-io" option for jobs is not implemented yet. * When encoding JSON, turning NaN and Infinity into null without giving an error is not useful. * JSON encoding doesn't handle surrogate pair. * Can't get buffer number of a channel. * Using empty name instead of no name for channel buffer. * Memory corruption when 'encoding' is not utf-8. * Crash when using json_decode(). * Memory leak when using ch_read(). * JSON tests fail if 'encoding' is not utf-8. * Json encoding still fails when encoding is not utf-8. * Vim hangs when a channel has a callback but isn't referenced. * Test 87 fails with Python 3.5. * Opening a channel with select() is not done properly. * When a JSON channel has a callback it may never be cleared. * When the argument of sort() is zero or empty it fails.- Updated to revision 1421, fixes the following problems * When calling ch_close() the close callback is invoked, even though the docs say it isn't. * Using "u_char" intead of "char_u", which doesn't work everywhere. * Tests slowed down because of the "not a terminal" warning. * May free a channel when a callback may need to be invoked.- Disable sniff support, its unmaintained.- Updated to revision 1410, fixes the following problems * The close-cb option is not implemented yet. * Perl eval doesn't work properly on 64-bit big-endian machine. * Having 'autochdir' set during startup and using diff mode doesn't work. * GTK 3 is not supported. * Completion menu flickers. * Leaking memory in cs_print_tags_priv(). * json_encode() does not handle NaN and inf properly. * Leaking memory in cscope interface.- Updated to revision 1397, fixes the following problems * When the Job exit callback is invoked, the job may be freed too soon. * Starting a job hangs in the GUI. * Can't sort inside a sort function.- Drop vim-7.1.314-CVE-2009-0316-debian.patch, Python 2.7 has the appropriate fix.- Updated to revision 1385, fixes the following problems * Job and channel options parsing is scattered. * Channel test ch_sendexpr() times out. * Can't remove a callback with ch_setoptions(). * Channels don't have a queue for stderr. * X11 GUI callbacks don't specify the part of the channel. * Channel read implementation is incomplete. * Calling a Vim function over a channel requires turning the arguments into a string. * ch_setoptions() cannot set all options. * Can't change job settings after it started. * The job exit callback is not implemented. * Can't get the job of a channel. * It is not easy to use a set of plugins and their dependencies.- Updated to revision 1353, fixes the following problems * Compiler warnings in build with -O2. * When there is any error Vim will use a non-zero exit code. * When the test server fails to start Vim hangs. * When the port isn't opened yet when ch_open() is called it may fail instead of waiting for the specified time. * The test script lists all functions before executing them.- Updated to revision 1345, fixes the following problems * Crash when using channel that failed to open. * Crash when closing the channel in a callback. * Channel test fails on non-darwin builds. * Channel NL mode is not supported yet. * It's difficult to add more arguments to ch_sendraw() and ch_sendexpr(). * Can't compile with +job but without +channel.- Updated to revision 1328, fixes the following problems * Cursor changes column with up motion when the matchparen plugin saves and restores the cursor position. (Martin Kunev) * "\%1l^#.*" does not match on a line starting with "#". * Channel with pipes doesn't work in GUI. * Crash when unletting the variable that holds the channel in a callback function. * Can't compile with +job but without +channel.- Updated to revision 1294, fixes the following problems * copy() and deepcopy() fail with special variables. * Encoding {'key':} to JSON doesn't give an error. * assert_false(v:false) reports an error. * When jsonencode() fails it still returns something. * jsonencode() is not producing strict JSON. * Crash when evaluating the pattern of ":catch" causes an error. * The job feature isn't available on MS-Windows. * ch_open() with a timeout doesn't work correctly. * ch_sendexpr() does not use JS encoding. - Remove vim-7.3-diff_check.patch- Updated to revision 1194, fixes the following problems * New lines in the viminfo file are dropped. * Old style tests for the argument list. * Generated function prototypes still have __ARGS(). * Wrong argument to assert_exception() causes a crash. * Illegal memory access when using :copen and :cclose. * When running gvim in the foreground some icons are missing. * Recognizing does not work when the language is Turkish. * Using searchpair() with a skip expression that uses syntax highlighting sometimes doesn't work. * Cannot define keyword characters for a syntax file. * Can't sort on floating point numbers. * Default features are conservative. * Conflict for "chartab". * Using the local value of 'errorformat' causes more problems than it solves. * 'langmap' applies to the first character typed in Select mode. * Langmap test fails with normal build. * Autocommands triggered by quickfix cannot always get the current title value. * No support for JSON. * Build with normal features fails. * Coverity warns for NULL pointer and ignoring return value. * type() does not work for v:true, v:none, etc. * Automatically generated function prototypes use __ARGS. * No error for jsondecode('"'). * ":argadd" without argument is supposed to add the current buffer name to the arglist. * Missing error number in MzScheme. * Expressions "0 + v:true" and "'' . v:true" cause an error. * No tests for "is" and "isnot" with the new variables. * This doesn't give the right result: eval(string(v:true)). * No test for new behavior of v:true et al. * The +channel feature is not in :version output. * empty() doesn't work for the new special variables. * test_writefile and test_viml do not delete the tempfile. * Crash with invalid argument to glob2regpat(). * free_tv() can't handle special variables. * Error messages for security context are hard to translate. * The channel feature isn't working yet. * Can't build with FEAT_EVAL but without FEAT_MBYTE. * Compiler warning for not using return value of fwrite().- Updated to revision 1130, fixes the following problems * Repeating CTRL-A doesn't work. * No tests for :hardcopy and related options. * When making a change while need_wait_return is set there is a two second delay. * With 'rightleft' and concealing the cursor may move to the wrong position. * Vim can create a directory but not delete it. * When using ":next" with an illegal file name no error is reported. * Using {ns} in variable name does not work. (lilydjwg) * delete() does not work well with symbolic links. * delete(x, 'rf') does not delete files starting with a dot. * No longer get "." and ".." in directory list. * argidx() has a wrong value after ":%argdelete". (Yegappan Lakshmanan) * delete(x, 'rf') fails if a directory is empty. (Lcd) * Using ":argadd" when there are no arguments results in the second argument to be the current one. (Yegappan Lakshmanan) * There is no perleval(). * Can only get the directory of the current window. * Python None value can't be converted to a Vim value. * Memory leak in :vimgrep.- Updated to revision 1087, fixes the following problems * Wrong way to check for unletting internal variables. * The Tcl interface can't be loaded dynamically on Unix. * Crash when using an invalid command. * CTRL-A does not work well in right-left mode. * Using "." to repeat CTRL-A in Visual mode increments the wrong numbers. * The CTRL-A and CTRL-X commands do not update the '[ and '] marks. * Crash with an extremely long buffer name. * CTRL-A and CTRL-X work badly with blockwise visual selection- Updated to revision 1066, fixes the following problems * Segfault when unletting "count". * Illegal memory access with weird syntax command. (Dominique Pelle) * Typos in the :options window. * Compiler warning for ignoring return value of fwrite(). * When a spell file has single letter compounding creating suggestions takes an awful long time.- Updated to revision 1046, fixes the following problems * The fix in patch 7.3.192 is not tested. * When a symbolic link points to a file in the root directory, the swapfile is not correct. * Vim overwrites the value of $PYTHONHOME. * The local value of 'errorformat' is not used for ":lexpr" and ":cexpr". * The column is not restored properly when the matchparen plugin is used in Insert mode and the cursor is after the end of the line. * When there is a backslash in an option ":set -=" doesn't work. * An Ex range gets adjusted for folded lines even when the range is not using line numbers. * Using "q!" when there is a modified hidden buffer does not unload the current buffer, resulting in the need to abandon it again. * g-CTRL-G shows the word count, but there is no way to get the word count in a script.- Updated to revision 1004, fixes the following problems * searchpos() always starts searching in the first column, which is not what some people expect. (Brett Stahlman) * Leaking memory when hash_add() fails. Coverity error 99126.- Updated to revision 979, fixes the following problems * When pasting on the command line line breaks result in literal characters. This makes pasting a long file name difficult. * When using :diffsplit the cursor jumps to the first line. * Using ":sort" on a very big file sometimes causes text to be corrupted. (John Beckett) * test_cdo fails when using another language than English. * When changing the crypt key the blocks read from disk are not decrypted.- Updated to revision 972, fixes the following problems * Test 87 doesn't work in a shadow directory. * Configure doesn't work with a space in a path. * test86 and test87 are flaky in Appveyor. * Rare crash in getvcol(). (Timo Mihaljov) * The asin() function can't be used. * Memory leak when there is an error in setting an option.- Updated to revision 963, fixes the following problems * Crash when dragging with the mouse. * Segfault reading unitialized memory. * X11 and GTK have moure mouse buttons than Vim supports. * Memory leak when encountering a syntax error. * vt52 terminal codes are not correct. * There is no way to ignore case only for tag searches. * test_tagcase breaks for small builds. * Writing tests for Vim script is hard. * New style testing is incomplete. * Missing changes in source file. * Test_listchars fails with MingW. (Michael Soyka) * Can't build when the insert_expand feature is disabled. * When using 'colorcolumn' and there is a sign with a fullwidth character the highlighting is wrong. (Andrew Stewart) * v:errors is not initialized. * Sorting number strings does not work as expected. (Luc Hermitte) * 'lispwords' is tested in the old way. * When a test script navigates to another buffer the .res file is created with the wrong name. * When using Lua there may be a crash. (issue #468) * Vim doesn't recognize .pl6 and .pod6 files. * A few more file name extensions not recognized. * Test_tagcase fails when using another language than English. * Vim checks if the directory "$TMPDIR" exists. * When setting 'term' the clipboard ownership is lost. * Test107 fails in some circunstances. * Cannot run the tests with gvim. Cannot run individual new stests. * test_listlbr_utf8 sometimes fails.- Updated to revision 935, fixes the following problems * Test 94 fails on some systems. * test_utf8 has confusing dummy command. * Crash when using longest completion match.- Updated to revision 930, fixes the following problems * When a BufLeave autocommand changes folding in a way it syncs undo, undo can be corrupted. * Python interface can produce error "vim.message' object has no attribute 'isatty'". * Libraries for dynamically loading interfaces can only be defined at compile time. * Compiler complains about type punned pointer. * t_Ce and t_Cs are documented but not supported. (Hirohito Higashi) * Wrong indenting for C++ constructor. * No utf-8 support for the hangul input feature. * New compiler warning: logical-not-parentheses * When removing from 'path' and then adding, a comma may go missing. (Malcolm Rowe) * When running out of memory while copying a dict memory may be freed twice. (ZyX) * Compiler warning for comparing signed and unsigned. * A digit in an option name has problems. * The dll options are not in the options window. * The rubydll option is not in the options window. * Missing proto file update. (Randall W. Morris) * Leaking memory with ":helpt {dir-not-exists}". * Prototypes not always generated. * User may yank or put using the register being recorded in. * Completing the longest match doesn't work properly with multi-byte characters. * Ruby crashes when there is a runtime error. * A clientserver message interrupts handling keys of a mapping. * "gv" after paste selects one character less if 'selection' is "exclusive". * MS-Windows: Most users appear not to like the window border. - Refresh vim-7.3-sh_is_bash.patch- Updated to revision 898, fixes the following problems * Build failure when using dynamic python but not python3. * Indentation of array initializer is wrong. * On MS-Windows the iconv DLL may have a different name. * C indenting is wrong below a "case (foo):" * vimrun.exe is picky about the number of spaces before -s. * Custom command line completion does not work for a command containing digits. * Editing a URL, which netrw should handle, doesn't work. * Freeze and crash when there is a sleep in a remote command. (Karl Yngve Lervåg) * The 'fixendofline' option is set on with ":edit".- Updated to revision 889, fixes the following problems * Crash when changing the 'tags' option from a remote command. (Benjamin Fritz) * 'smarttab' is also effective when 'paste' is enabled. (Alexander Monakov) * May get into an invalid state when using getchar() in an expression mapping. * Vim leaks memory, when 'wildignore' filters out all matches. * Compiler warning for unused variable. (Tony Mechelynck) * Not obvious how to contribute. * ":find" sometimes fails. (Excanoe) * Coverity error for clearing only one byte of struct. * Can't see line numbers in nested function calls. * Test 49 fails. * When leaving the command line window with CTRL-C while a completion menu is displayed the menu isn't removed. * Block-mode replace works characterwise instead of blockwise after column 147. (Issue #422) * When doing an upwards search without wildcards the search fails if the initial directory doesn't exist. * Using uninitialized memory for regexp with back reference. (Dominique Pelle) * The OptionSet autocommands are not triggered from setwinvar(). * Triggering OptionSet from setwinvar() isn't tested.- Updated apparmor.vim (taken from AppArmor 2.10.0) * add support for the "ib" and "mpls" network keywords- Updated to revision 865, fixes the following problems * GTK: font glitches for combining characters * "zt" still doesn't work well with filler lines. (Gary Johnson) * Dragging the current tab with the mouse doesn't work properly. * It's a bit clumsy to execute a command on a list of matches. * Vim doesn't recognize all htmldjango files. * Filetype detection is outdated. * pango_shape_full() is not always available. * Still problems with pango_shape_full() not available. * plines_nofill() used without the diff feature.- Updated to revision 854, fixes the following problems * When '#' is in 'isident' the is# comparator doesn't work. * Compiler warning for possible loss of data. * "vi)d" may leave a character behind. * CTRL-A on hex number in Visual block mode is incorrect. * Moving the cursor in Insert mode starts new undo sequence. * does not show up. * Saving and restoring the console buffer does not work properly. * "zt" in diff mode does not always work properly. (Gary Johnson) * Missing information about runtime files.- Updated to revision 843, fixes the following problems * Xxd doesn't have a license notice. * The ruler shows "Bot" even when there are only filler lines missing. (Gary Johnson) * CTRL-A in Visual mode doesn't work properly with "alpha" in 'nrformat'. * After CTRL-V CTRL-A mode isn't updated. (Hirohito Higashi) * With a sequence of commands using buffers in diff mode E749 is given. (itchyny) * Invalid memory access when using "exe 'sc'". * Gcc sanitizer complains about using a NULL pointer to memmove(). * It is not possible to save and restore character search state. * Illegal memory access with "sy match a fold". * Invalid memory access when doing ":call g:". * Invalid memory access when doing ":fun X(". * Invalid memory access in file_pat_to_reg_pat(). * 'linebreak' breaks c% if the last Visual selection was block. (Chris Morganiser, Issue 389) * Invalid memory access in file_pat_to_reg_pat. * Cursor moves after CTRL-A on alphabetic character. * Invalid memory access for ":syn keyword x a[". * Crash when using "syn keyword x c". (Dominique Pelle) * Crash when clicking in beval balloon. (Travis Lebsock) * Resetting 'encoding' when doing ":set all&" causes problems. (Bjorn Linse) Display is not updated. * When expanding `=expr` on the command line and encountering an error, the command is executed anyway. * $HOME in `=$HOME . '/.vimrc'` is expanded too early. * More side effects of ":set all&" are missing. (Björn Linse) * gettabvar() doesn't work after Vim start. (Szymon Wrozynski) * Comparing utf-8 sequences does not handle different byte sizes correctly. * Can't compile without the crypt feature. (John Marriott) - Refresh vim-7.3-diff_check.patch- Updated to revision 803, fixes the following problems * Repeating a change in Visual mode does not work as expected. (Urtica Dioica) * Accessing memory before an allocated block. * Using freed memory when triggering CmdUndefined autocommands. * Test for ":diffoff" doesn't catch all potential problems. * Using "A" in Visual mode while 'linebreak' is set is not tested. * C indent does not support C11 raw strings. (Mark Lodato)- Updated to revision 797, fixes the following problems * Using freed memory and crash. (Dominique Pellej) * Test fails when the autochdir feature is not available. Test output contains the test script. * The buffer list can be very long. * Can only conceal text by defining syntax items. * Can't specify when not to ring the bell. * The 'fixeol' option is not copied to a new window. * Warning from 64 bit compiler. * Crash when using more lines for the command line than 'maxcombine'.- Updated to revision 788, fixes the following problems * CTRL-A and CTRL-X in Visual mode do not always work well. * :diffoff only works properly once. * Behavior of :diffoff is not tested. * Background color response with transparency is not ignored. * Search does not handle multi-byte character at the start position correctly. * 'langmap' is used in command-line mode when checking for mappings. Issue 376. * When using the CompleteDone autocommand event it's difficult to get to the completed items. * It is not possible to avoid using the first item of completion. * Equivalence class for 'd' does not work correctly. * Coverity warns for uninitialized variable. * Using CTRL-A in a line without a number moves the cursor. May cause a crash when at the start of the line. (Urtica Dioica) * Compiler complains about uninitialized variable and clobbered variables. * line2byte() returns one less when 'bin' and 'noeol' are set. * Still a few problems with CTRL-A and CTRL-X in Visual mode. * copy_chars() and copy_spaces() are inefficient. * Using both "noinsert" and "noselect" in 'completeopt' does not work properly. * On some systems automatically adding the missing EOL causes problems. Setting 'binary' has too many side effects. * It is not possible for a plugin to adjust to a changed setting. * snprintf() isn't available everywhere.- Updated to revision 763, fixes the following problems * Appending in Visual mode with 'linebreak' set does not work properly. Also when 'selection' is "exclusive". (Ingo Karkat) * Using CTRL-A in Visual mode does not work well. (Gary Johnson) * It is not easy to count the number of characters. * Cannot detect the background color of a terminal. * When 'conceallevel' is 1 and quitting the command-line window with CTRL-C the first character ':' is erased. * Spelling mistakes are not displayed after ":syn spell". * The request-background termcode implementation is incomplete. * Comment for may_req_bg_color() is wrong. (Christ van Willegen)- Updated to revision 752, fixes the following problems * When setting the crypt key and using a swap file, text may be encrypted twice or unencrypted text remains in the swap file. * The tab menu shows "Close tab" even when it doesn't work. * The cursor line is not always updated for the "O" command. * ml_get error when using "p" in a Visual selection in the last line. * Wrong argument for sizeof(). * In a string "\U" only takes 4 digits, while after CTRL-V U eight digits can be used. * ":1quit" works like ":.quit". (Bohr Shaw) * When using += with ":set" a trailing comma is not recognized. (Issue 365) * Cannot specify a vertical split when loading a buffer for a quickfix command. * "p" in Visual mode causes an unexpected line split. * No tests for Ruby and Perl. * The entries added by matchaddpos() are returned by getmatches() but can't be set with setmatches(). (Lcd) * ":[count]tag" is not always working. (cs86661) * ":cnext" may jump to the wrong column when setting 'virtualedit=all' * For some options two consecutive commas are OK. (Nikolay Pavlov) * It is not obvious how to enable the address sanitizer. * Unicode 8.0 not supported.- Make Perl support dynamic bsc#804070- Updated to revision 729, fixes the following problems * Illegal memory access when there are illegal bytes. * ":let list += list" can change a locked list. * Autocommands triggered by quickfix cannot get the current title value. * Overflow when adding MAXCOL to a pointer. * When 'list' is set Visual mode does not highlight anything in empty lines. (mgaleski) * 0x202f is not recognized as a non-breaking space character. * For indenting, finding the C++ baseclass can be slow. * ":call setreg('"', [])" reports an internal error. * Occasional crash with 'list' set.- Updated to revision 712, fixes the following problems * Out-of-bounds read, dectected by Coverity. * Not freeing memory when encountering an error. * The filename used for ":profile" must be given literally. * Various problems with locked and fixed lists and dictionaries. * E315 when trying to delete a fold. (Yutao Yuan) * Fold can't be opened after ":move". (Ein Brown) * Compiler warning for using uninitialized variable. (Yasuhiro Matsumoto) * Joining an empty list does uneccessary work. * Compiler warning for start_dir unused when building unittests. * Searching for a character matches an illegal byte and causes invalid memory access. (Dominique Pelle) * Can't build with Ruby 2.2. * Window drawn wrong when 'laststatus' is zero and there is a command-line window. (Yclept Nemo) * Undo files can have their executable bit set. * gettext() is called too often. * ":tabmove" does not work as documented. * It is not possible to make spaces visibible in list mode.- Updated to revision 694, fixes the following problems * When starting several Vim instances in diff mode, the temp files used may not be unique. (Issue 353) * When there are illegal utf-8 characters the old regexp engine may go past the end of a string. * "zr" and "zm" do not take a count. * There is no way to use a different in Replace mode for a terminal. * When "$" is in 'cpo' the popup menu isn't undrawn correctly. (Issue 166) * Memory access errors when changing indent in Ex mode. Also missing redraw when using CTRL-U. (Knil Ino) * Can't build with MzScheme. * Session file is not correct when there are multiple tab pages. * Running tests changes the .viminfo file.- Updated to revision 683, fixes the following problems * When using --remote the directory may end up being wrong. * CTRL-W in Insert mode does not work well for multi-byte characters. * MS-Windows: When Vim is minimized the window height is computed incorrectly. * The search highlighting and match highlighting replaces the cursorline highlighting, this doesn't look good. * Typo in the vimtutor command.- Updated to revision 676, fixes the following problems * When 'ruler' is set the preferred column is reset. (Issue 339) * Using freed memory when g:colors_name is changed in the colors script. (oni-link) * Using "0 CTRL-D" in Insert mode may have CursorHoldI interfere. (Gary Johnson) * When 'M' is in the 'cpo' option then selecting a text object in parenthesis does not work correctly. * When using netbeans a buffer is not found in another tab. * When 'compatible' is reset 'numberwidth' is set to 4, but the effect doesn't show until a change is made. * 'linebreak' does not work properly with multi-byte characters. * There is a chance that Vim may lock up. * 'colorcolumn' isn't drawn in a closed fold while 'cursorcolumn' is. (Carlos Pita) * Can't use a glob pattern as a regexp pattern. * When netbeans is active the sign column always shows up. * Using 'cindent' for Javascript is less than perfect. * Warning for shadowing a variable. * When completing a shell command, directories in the current directory are not listed. * The first syntax entry gets sequence number zero, which doesn't work. (Clinton McKay) * Missing changes in one file. * When a FileReadPost autocommand moves the cursor inside a line it gets moved back. - Refresh vim73-no-static-libpython.patch- Updated to revision 658, fixes the following problems * The tabline menu was using ":999tabnew" which is now invalid. * When using "gf" escaped spaces are not handled. * Stratus VOS doesn't have sync(). * When splitting the window in a BufAdd autocommand while still in the first, empty buffer the window count is wrong. * ":bufdo" may start at a deleted buffer. * Compiler complains about ignoring return value of fwrite(). (Michael Jarvis) * Configure check may fail because the dl library is not used. * Can't match "%>80v" properly for multi-byte characters. * Xxd lacks a few features. * Insert mode completion with complete() may have CTRL-L work like CTRL-P. * glob() and globpath() cannot include links to non-existing files. (Charles Campbell) * Text deleted by "dit" depends on indent of closing tag. (Jan Parthey) * Missing changes for glob() in one file. * Compiler warnings for pointer mismatch. * 'formatexpr' is evaluated too often.- Updated to revision 640, fixes the following problems * When using Insert mode completion combined with autocommands the redo command may not work. * The default conceal character is documented to be a space but it's initially a dash. (Christian Brabandt) * 7.4.592 breaks the netrw plugin, because the autocommands are skipped. * Marks are not restored after redo + undo. * If no NL or CR is found in the first block of a file then the 'fileformat' may be set to "mac". (Issue 77) * A search with end offset gets stuck at end of file. (Gary Johnson) * Incorrectly read the number of buffer for which an autocommand should be registered. * Can't build with Lua 5.3 on Windows. * Combination of linebreak and conceal doesn't work well. * After deleting characters in Insert mode such that lines are joined undo does not work properly. (issue 324)- Updated to revision 629, fixes the following problems * For complicated list and dict use the garbage collector can run out of stack space. * Syntax error. * The NFA engine does not implement the 'redrawtime' time limit. * Vim hangs when freeing a lot of objects. * Wrong ":argdo" range does not cause an error. * luaV_setref() is missing a return statement. (Ozaki Kiichi) * luaV_setref() not returning the correct value. * Compiler warning for unitinialized variable. (Tony Mechelynck) * Returning 1 in the wrong function. (Raymond Ko) * Compiler warning for unused argument. * Crash with pattern: \(\)\{80000} (Dominique Pelle) * May leak memory or crash when vim_realloc() returns NULL. * Possible NULL pointer dereference. * The last screen cell is not updated. * Compiler warning for variable might be clobbered by longjmp. * Coverity warning for Out-of-bounds read. - Remove vim-speedup-gc.patch, fixed upstream- Updated to revision 608, fixes the following problems * Compiler warnings for unitinialized variables. (John Little) * Can't match "%>80v" properly. (Axel Bender) * Range for :bdelete does not work. (Ronald Schild) * Parallel building of the documentation html files is not reliable. * Conceal does not work properly with 'linebreak'. (cs86661) * ":0argedit foo" puts the new argument in the second place instead of the first. * Using ctrl_x_mode as if it contains flags. * test_listlbr_utf8 fails when the conceal feature is not available. * When doing ":e foobar" when already editing "foobar" and 'buftype' is "nofile" the buffer is cleared. (Xavier de Gaye) * Crash when searching for "x\{0,90000}". (Dominique Pelle) * Using a block delete while 'breakindent' is set does not work properly. * The test_command_count test fails when using Japanese. * Tiny build doesn't compile. (Ike Devolder) * Cannot change the result of systemlist(). * Out-of-memory error. * Memory wasted in struct because of aligning. * It is not possible to have feedkeys() insert characters. * ":set" does not accept hex numbers as documented. * 'foldcolumn' may be set such that it fills the whole window, not leaving space for text. * Running tests changes viminfo. * The # register is not writable, it cannot be restored after jumping around. * May crash when using a small window. * Compiler warnings for unused variables.- Add vim-speedup-gc.patch to improve garbage collection performance. Based on https://github.com/neovim/neovim/pull/1761 (boo#899747)- Modify vim-7.3-filetype_changes.patch to expand tabs when editing * .changes files (bnc#900839)- Update suse.vimrc to stop remembering file positions for git commit cases. This fixes bnc#538369 and based on msys commits 1ef258e and 65ffc90.- Updated to revision 580, fixes the following problems * Ex range handling is wrong for buffer-local user commands. * Segfault with wide screen and error in 'rulerformat'. (Ingo Karkat) * No test for replacing on a tab in Virtual replace mode. * FEAT_OSFILETYPE is used even though it's never defined. * Ranges for arguments, buffers, tabs, etc. are not checked to be valid but limited to the maximum. This can cause the wrong thing to happen. * :argdo, :bufdo, :windo and :tabdo don't take a range. * Non-ascii vertical separater characters are always redrawn. * Giving an error for ":0wincmd w" is a problem for some plugins. * Having CTRL-C interrupt or not does not check the mode of the mapping. (Ingo Karkat) * Building with dynamic library does not work for Ruby 2.2.0 * Can't build with tiny features. (Ike Devolder) * Address type of :wincmd depends on the argument. * Mapping CTRL-C in Visual mode doesn't work. (Ingo Karkat) * No error for eval('$'). * Unicode character properties are outdated. * Redrawing problem with 'relativenumber' and 'linebreak'. * Matching with a virtual column has a lot of overhead on very long lines. (Issue 310) * Using getcurpos() after "$" in an empty line returns a negative number. * Wrong cursor positioning when 'linebreak' is set and lines wrap. * ":52wincmd v" still gives an invalid range error. (Charles Campbell)- Updated to revision 560, fixes the following problems * Tests fail with small features plus Python. * Crash when computing buffer count. Problem with range for user commands. Line range wrong in Visual area. * Cannot build with tiny and small features. (Taro Muraoka) * Crash when doing a range assign. * Using a range for window and buffer commands has a few problems. Cannot specify the type of range for a user command. * Since patch 7.4.232 "1,3s/\n//" joins two lines instead of three. (Eliseo Martínez) Issue 287 * Warnings for unused arguments when compiling with a combination of features. * Highlighting for multi-line matches is not correct. * Repeated use of vim_snprintf() with a number. * Using "vit" does not select a multi-byte character at the end correctly. * Function name not recognized correctly when inside a function. * curs_rows() function is always called with the second argument false. * "ygn" may yank too much. (Fritzophrenic) Issue 295. * Langmap applies to Insert mode expression mappings. * Various small issues. * Missing part of patch 7.4.519. * test_close_count may fail for some combination of features. * Failed commands in Python interface not handled correctly. * One more small issue. * When the X server restarts Vim may get stuck. * Appending a block in the middle of a tab does not work correctly when virtualedit is set. * Memory leak using :wviminfo. Issue 296.- use SUSE LINUX GmbH everywhere- Updated to revision 537, fixes the following problems * With a wrapping line the cursor may not end up in the right place. (Nazri Ramliy) * Using status line height in width computations. * Crash when using syntax highlighting. * Sun PCK locale is not recognzed. * When using "vep" a mark is moved to the next line. (Maxi Padulo, Issue 283) * Specifying wrong buffer size for GetLongPathName(). * When the X11 server is stopped and restarted, while Vim is kept in the background, copy/paste no longer works. (Issue 203) * When using ":ownsyntax" spell checking is messed up. (Issue 78) * map() leaks memory when there is an error in the expression. * matchstr() fails on long text. Daniel Hahler) * Still confusing regexp failure and NFA_TOO_EXPENSIVE. * Crash when using matchadd() (Yasuhiro Matsumoto) * No test for what 7.4.517 fixes. * Many commands take a count or range that is not using line numbers. * Comments about parsing an Ex command are wrong. * When using 'incsearch' "2/pattern/e" highlights the first match. * ":hardcopy" leaks memory in case of errors. * Warnings when compiling if_ruby.c. * Can't build with tiny features. * Test 63 fails when using a black&white terminal. * Value of v:hlsearch reflects an internal variable.- Updated to revision 516, fixes the following problems * When generating ja.sjis.po the header is not correctly adjusted. * Users are not aware their encryption is weak. * "-fwrapv" argument breaks use of cproto. * Generating proto for if_ruby.c uses type not defined elsewhere. * Crash because reference count is wrong for list returned by getreg(). * Memory access error. (Dominique Pelle) * In a help buffer the global 'foldmethod' is used. (Paul Marshall) * Completing a function name containing a # does not work. Issue 253.- Updated to revision 507, fixes the following problems * Setting the local value of 'backupcopy' empty gives an error. (Peter Mattern) * Compiler warning. * Crash when expanding a very long string. * CTRL-W } does not open preview window. (Erik Falor) * 'linebreak' does not work well together with Visual mode. * Issue 26: CTRL-C does not interrupt after it was mapped and then unmapped. * The "precedes" entry in 'listchar' will be drawn when 'showbreak is set and list is not. * Cursor movement is incorrect when there is a number column/sign/fold column and 'sbr' is displayed. * Can't compile on a system where Xutf8SetWMProperties() is not in the X11 library. Issue 265. * When using ":%diffput" and the other file is empty an extra empty line remains. * Using byte length instead of character length for 'showbreak'. * When 'balloonexpr' results in a list, the text has a trailing newline. (Lcd) * A 0x80 byte is not handled correctly in abbreviations. * Abbreviations don't work. (Toothpik) * Check for writing to a yank register is wrong. * ":sign jump" may use another window even though the file is already edited in the current window. * test_mapping fails for some people. * Cursor movement still wrong when 'lbr' is set and there is a number column. (Hirohito Higashi) * Cannot specify the buffer to use for "do" and "dp", making them useless for three-way diff. * When winrestview() has a negative "topline" value there are display errors. * In Insert mode, after inserting a newline that inserts a comment leader, CTRL-O moves to the right. (ZyX) Issue 57. * A TextChanged autocommand is triggered when saving a file. (William Gardner) * Cursor shape is wrong after a CompleteDone autocommand. * XPM isn't used correctly in the Cygwin Makefile. * With some regexp patterns the NFA engine uses many states and becomes very slow. To the user it looks like Vim freezes. * substitute() can be slow with long strings. * Test 72 still fails once in a while. * Typo in file pattern. * Language mapping also applies to mapped characters. * Cannot append a list of lines to a file.- Updated apparmor.vim (taken from AppArmor 2.9.0) * add support for 'hat' keyword * fix highlighting of comments in alias and link rules/bin/sh/bin/shgvim-basegvim-enhancedxxds390zl35 1700727147  9.0.2103-150000.5.57.19.0.2103-150000.5.57.19.0.2103-150000.5.57.19.0.2103-150000.5.57.19.0.2103-150000.5.57.19.0.2103-150000.5.57.19.0.2103-150000.5.57.19.0.2103-150000.5.57.1 vivimgvimrcegviewegvimeviewevimgexgvigviewgvimgvimdiffrgviewrgvimvivimgvim.desktopgvimREADME.Japanese-XIMgui_x11.txtgvimrc_example.vimsuse.gvimrcgvim.pnggvim.pnggvim.pnggvim.pnggvim.pnggvim.pnggvim.pnggvim.pnggvim.svg/etc/alternatives//etc//usr/bin//usr/share/applications//usr/share/doc/packages//usr/share/doc/packages/gvim//usr/share/icons/hicolor/128x128/apps//usr/share/icons/hicolor/24x24/apps//usr/share/icons/hicolor/256x256/apps//usr/share/icons/hicolor/32x32/apps//usr/share/icons/hicolor/48x48/apps//usr/share/icons/hicolor/512x512/apps//usr/share/icons/hicolor/64x64/apps//usr/share/icons/hicolor/96x96/apps//usr/share/icons/hicolor/scalable/apps/-fmessage-length=0 -grecord-gcc-switches -O2 -Wall -D_FORTIFY_SOURCE=2 -fstack-protector-strong -funwind-tables -fasynchronous-unwind-tables -fstack-clash-protection -gobs://build.suse.de/SUSE:Maintenance:31593/SUSE_SLE-15_Update/9a77e4e7e7833a7a0267af43541d7d8b-vim.SUSE_SLE-15_Updatedrpmxz5s390x-suse-linux cannot open `/home/abuild/rpmbuild/BUILDROOT/vim-9.0.2103-150000.5.57.1.s390x/etc/alternatives/vi' (No such file or directory)cannot open `/home/abuild/rpmbuild/BUILDROOT/vim-9.0.2103-150000.5.57.1.s390x/etc/alternatives/vim' (No such file or directory)ASCII textELF 64-bit MSB shared object, IBM S/390, version 1 (SYSV), dynamically linked, interpreter /lib/ld64.so.1, BuildID[sha1]=2b13f099eb63a54a4e6428b4b362aa44e180be4a, for GNU/Linux 3.2.0, strippeddirectoryPNG image data, 128 x 128, 8-bit/color RGBA, non-interlacedPNG image data, 24 x 24, 8-bit/color RGBA, non-interlacedPNG image data, 256 x 256, 8-bit/color RGBA, non-interlacedPNG image data, 32 x 32, 8-bit/color RGBA, non-interlacedPNG image data, 48 x 48, 8-bit/color RGBA, non-interlacedPNG image data, 512 x 512, 8-bit/color RGBA, non-interlacedPNG image data, 64 x 64, 8-bit/color RGBA, non-interlacedPNG image data, 96 x 96, 8-bit/color RGBA, non-interlacedSVG Scalable Vector Graphics image''R(R'RR R*R%R R RRRRRR RRRRR"R!RRRRRRRRRRR)R&RR RRR#R$R PPP P PP PPPPPPPPPP P o՝<(&A;qutf-8ae07ec8a54e34b5c10ef260cf89849131e84b55436ef52d476ccccc9bde8eac6?7zXZ !t/&]"k%{J #$yuC̵覄=vg,dCzQEZ&e>~Ff#B@0#udΌL.v W_fP][ϭgf]͔aTp%+Ɨ#Ӟd$"w&þQ-lHŮQ-WRI+&4/HafU1wR¬LˎE|sp|guS,ٴN~S&`D0X'ņJܢ9Dz& .-{OcDEIIǴ0sr-HCԓ,%u)%(s?.~[qh$F(Phm.i7_/wTt,fNH%1M1H*m+25;Gif.cn3>wZt &ɫoh/SŢb^ږp@4@4^Ȝ|Z0gR& 762dtVqXu`VDžS[l,$[WNp$} @K“/S_uRfmc(=ZVqڽ vlU_ǚ֧zػYEyT5k?Bm`ƑfE^%LCTQu Aky-3ϧ(Rt0Z hp(@D v#z; BbG&r&X|U$נ~\4<ϛDu+@y'%YB)9יHEN< zbs4ԪGoSM>h 6 &wx֗ooIlrȲ[46[Gq7)1K&z77D/"z391Ws*[fܖO_U_r2R!A6yOT_j.>Qx{μHt2|+ T/8v`' sp}YۤK|Bˬ6crޕQ6[,4}t`M$ Pw|$ېԔ]֠@0t_/,jn?:߉3DCcyH6ոrVv^%=``=Jkl.-2}$2ɱ$Ɂa(ʧ?sJ젃PHb>n 6풂X25ਚ0g cpܦ$A[ U=>./g(|'K I;ׄ ..s+%AfO;vv3o7y09 !UO6 J6;Ay7S@`t(4QXu췊º҈kyB% w-Q Uh(OZ15I% 0-$ [ A>|yеT#Y:şp:}#, p um$zv6򏌮܀BM:pΫI|V]QtDkq۱72")@2ھvILUpJ #yAnłD%Zw_c~WR˱疊Jjng/BG: rx9wZgΆ}mA'S 4iN \ νZ{fcqbfF]sn*F֠;RVKB{xC?ɥz xV_+Wvj'^բ`3Xe1Iۉ$>`͸oxȇq۸^2/ARR0BSMV`Zr'(a>:_&]aH,逿_#*v8Ow:W,j-؅1 + Raʴ+\oE7YلZZ5wxO2:& %]C8.Y>H振FU@[.F~z0n6St1 b*Z$ 3?aTBHH~X@r:LӏxbepU.~j89&JvGXԩ02\ÔT 襔$wr;4 4RݞrnQ3bv~C3>p^)5 i?tE7.ʏˡkN+}lV;s\wK}EUp;E$>O lba~<YRuV{I4A,d<J= y\YwcڑﴋȈڳP--`Ĭ_+8EV- ;;!@s:JNZ48{ՠX~Jv !B'Kּūa׏[2Ӥ $&zz Ф^Li716 Q@R\!?Q!M"S\h6TvD=ۏ';1netg,,lG$?x$!P(s{GXJj݉ ;_W]q|R&C(=7/սڻM+>ME Ϲeȁ=uoU=3Vh89̴ӿFAZs_La:o 5Xb($}NL5mFB~yñ[gmw_ ~ȹk]CYVxAz';oT+_Q>l\dOO^#(ۈnc!q6hrNQ>Q W(YQ>pJI +FG"6܁gOpF2WBW}TVInČ'nE e|tl?1DF5~79qZy9uzH-/*BCv;9M- 8kA;D-C!"+52vݕS?OQL@Ai,LlK1A`.Sʼn(O$ިs5iY w#u(Vr2O)J!?\w$\Dٚio H5%Qx8-- { GBY֨$b60dNr^*Ծ2\P:D?(N0C` ރPfe1lV%Ly\VRx{۔K}c;u* ;bD6Ac@qnYe~'4&o ӇFY(׼cnfnr%s-A _`ͻ2EHӼpbZ8?fNA$GO` /rK&%ǰ{{c\ӊg\[aoMR0TƖO,ݔb"\ 7 cφ94`R*0%"[oѤʥժvw G_ɇ(9ĭ~.3s57t+a깛; rg?.+ȗq"KcjѨ_wRJt9_~Y2C wΒ-[`>)I|ؾ,30ok7ɌpU=(TdxŐ5vΫESo)4ڞx,37]> OŐ)9b^L`w^)Y+D袜(bww@}JA`:2 ~>[D?h+)6'h:' &v/o *|9:~D@E3XYk,\>'y7C' 'm a30CI6  |HGlis8l\ h/8Cf%~vpyzܞ>Mj>r3QSA{\4<ܕx`:^*wi׵I-OEs^D=]3׵bum/ePk,o] N F Z@4l)%j. k!?P)}c2͔s}xI':h*A (iO~P6pj^3`PqcEPF04O0\" C4bwm+9RN!~mI_Fd ٢is!M˻vDL"M۳a/@ H+i5:ueCV 䠏! ٵR :!ߠSo;Ԋ~k#勀P5N|R9Pr\j'w!r/(`H\yO0Mo<+̉K%~#~ՀžYY,u=) x~T*>ߤ6QK zz>éVJIt:|p>p죗0n,A~&*r-D!t=@zm1tk.X{=PzS^2aAN\bo\A W?EIDx$5ԭ~Yԓ\,G :`}Ns{czr1#5iȖ*DM\bo l_9; PO:^2bK;o [[[9]&䬘 9HF3DmhjA|d^+pFV yˋ~t&ƑnRYD>ԞN_q;IZpn'ұ^7ެ2r  ToMi/To6PGpRe0$6  dVL յk;|?i{7妅:G~!21_XʘF.i9aEgէ} P_YwRSU,L RtV2ёh7zӬAa"kGY'/` wSz2U*Q` Z|yP 7NEl1u'Є{K&07 ŏ?ײwf&VpwtstPm }]7"ptS(aJoM=Y,'M'0Kq"Fᗹ\?b^mlE|5[ץ7ZL\P<ʧKb}j~(ÊR(gj'-Ջ(rDAf_$tGȳ(@E w@p9+.>ց-{3%L !CHsd?ewl!=toOy*b9(Kw=jTiY /|gbWtRiTЊl]Ι.Hx>7)o^S5Fȍq xj%ϥ11pkH LU>;Gsmew~ q\pd}+;$L՞䇋G)ϔRC_ԠBjKm}Ms ȗƮYSu̅%Q?Q+YLf_ĘA3y_#8us PuKMp7w>xx3~Y~K Hl2Zc Q#k#ؑ!͗IbY:f-T؛0S3+`H,6ݗtV* *5Kfd_V'Ns J9s ;r'ԧ}|Κ)4--˖fY_ָNu#22OڈRb*@GA6~lpX X7/$ec荢g$^k|a8ދ$OI'bYiq [W< 㘓>+:"ADTo݄H}x*] jR]koɗoB}M xr%s ~w?bUJ-Uh|{wP<|Y4?wgD69M-Cf4*4'Ac(m_:AUI)=Hg}.S]'&D6nr@ZGxS:Zz>rh]z2C?m5#Kp;u-,F-.bKVb1:?nܢKbh:~;}hTXCFŧ,!qfj 1Z0̏2RĆrHHF5]ǣ>(]hhg\2^:V.Қh\j*Lvܰ+aXGu$JCtWIPnN;eP+1߾IK7g^e}q_hاy2K4>?GUr}jJ#NK(Vؠ (MU.?i&U14zijO)ܱ#L_U8)Ww;H&Vs/Q}4X2>;뇺(%A]b gcT+K ?l6lA["<reNyfm 7ݡ)Y'PQBAU+5kFJIwH) MOZ@ģ=΄yʘjѴg!/h#HD_9Wdx'84dOv0MUX1*OT}(ō3T׈݇GB  !}CeyB\y=1O ~QoƊ71,N^ $@@wPElωl6 3lKF@|ruqT;vZ0O,Ok%+̡  /1rfs1V;YIO &nZ̲B( hbp)Kρ3җY5iOX;aCwxe~E?L9)Fv0]#bR`׳#foڇUߩiΞDI o&vDC2djhp[l &:DRqܷPO.!"7g#^Vd1eIY)JW ɑQdEB!)w7'[bJ>lȮs|j! m(o\+CFt v"2:v|K{yIu R'^t|hw,_ߌw{/f9U^Ed(gVSs~w~<{tt3UO\Fܙ@5{bmQXMG>QB ޿i %g.')GRf%o݀qr4X-TECRX1yUkU*>&IlT3=p=,TRBL!RPՈ~c|۟镪|nʪ(W_H%bX`qʾQ(A ,3M:}|RkO[PwqKNi Q,"&'_Xha  ˗uOϐvXl4%>aMF^@#prFtuN VTl _'e  wV)o&as NJ{+J*+K54g=("C pu޺%ęAZv[;zTzCuJ+Sk_jr8ϵ46 noIW~`2۵Q(Xǀ!=BI!1pW@xq_ EvSz+DŽkeErJ 6|QLD/},f̓ Eeove~\J`mOo*g<iOZ'V~W~!XW= bĕeP .@6Q H#*d"۶ bP{%7hLʚR Ga:PO8.QFqoN[|R |v9~.u]JO3hC. ñ>f,1)讲 |=~Tb4:&u SUk# *HjɤO=5[\jF5j5̵NHOz0 Eh-V&=)ȺZM~8x!lf_={dfOl[aى8kZ&Hr'5˹$8ŘTv .IښYu$ʢ":OA"qvQ@FKT >l(kVo~BtDZ|dèCC(RHJt/ az6F+ZGrkk DǕM-c`BqlsESnx 4ŇbJW7"z.]AT joSp"f4` *#[b]類&ԫx6=ʷJ;]xy o>f5/{R̡F`co!Mܨ޲(M}oZӘ$6\#@~[J@Wn:im(uHUY'9NH1בq_fsA5W 0B!VbrLyzd.k=Ԡ l*J +i&O< s, ):%k&tί0@Q$XcO0?F5[gRw ^bW9_b38^u+]wǰUTeDƮX,)c .t)£تsn~D;]6@&QПܴ)/fZV9ůwq[I nBg: ([L{Q4=6Z;(uҬ&WV;a$p6Pt?V7Ԕ@& S_+19c SiE."f/(<[D皳$rS$h68Il|9qej1TWK녙ikJQ0t$OکGDmXg'!]{a4%UPi^vBiKUIFJ@; popN&@, *a30#mG?P~Zz??[7" ;"y02)8 QӦ^!7xz?xtS~ RXƏ,@;G~IɤOD0In=A1 !VN#a'NM,ɿe|0ql&ykB,ĀVxY~O;̲QfI^ !OZ^JK>j"KNsxYP*H&N{{#(]yO "P- ?H"zc+z숧W܈O:`jk{ _7ϜUb㻞ebX},&HѸ)pHn\fﶉ& 7$E0*z^J1}buy*s2CCCM20,okBC9O] bJI𹚮 d1hr¯ӝxZslrb%Vۢʈa,Y q3_~\ -B7Y:U{hC)~}@mZcw~ % {'Dj>fƤbfS' ځ)%M825hOTS/^ʹ|+Yd[u/^-g; ;.\#䑎 Agpب:`k`;KqsbB65e_*PObT];425 WZVxkl-Ƿx$ | !;Et6v^Rwmr;jT+g1dD5T7j[ #L7--^O\cǢb+U{g(`M#fZl_ `s,yi u`hL6[R &;[Җӊ 2yv\ 3H_&&+c^Niek [W#1'II|]6~0jKH "7VS\z!/RLjY {|c߄v\"*X : m.nÅ{B5J#G^69Oى3Ȟ5tSGO2rXa*&O,fW_XႱ+UhR01@ 9[+[ă\L 8/ŢaqJPG{,jXpn_K 8Eb}/2Giా ⸗vSTPv=gjj_Ӯ E JV_宩/q,Yè̄ܩz|EU,@oplRd9Gq6BR(q4}\P[e^u ľ?C&Gf"A9jBEH{ܞxUSfzZ;p <~Aַ/ǵ x&lzAG?!hd̊:QhJR!aXRE]\rbK ܱNSW @.tt|#T(=!FbOkw8@wV%zcugYW"[i\`?sMC#oր=y29{QĴPyJ1"-S׃hdI|A~ 6W?t-@!Nb0j/@EjKUϠ{EviVK MBYLAed˙n9~2$lvǝP5{mEtSYSZ2˱i;Mɉn=OxL,ҕ72,s cO;!NRZD}QGHr=p.!UOzюn6ϭRֱe ԔԀ17s8yڰ#=.F7qY/޻HEkEz}%}(ER%"]#Yc%] q+{ PpNS<]ͷ`iش1'=W"ր'*D P'|IUG~Y%෯7fN=w`( !D4OyrbC^4R]rخQ')zEM^`G&ߝxzf?Q W$4j> kh7"w$U;`o&xbi83]]3lF^9fw 3 Gi(3ssK 7#|9N̆N+E֪ m=f,߫׽&L~)%˜|-6?;apnMܮB^w^['I*t 6`&oW0L[Y7!2QobfuQ;fuc|zYzpӢV5ú/Lb2R/ppK2/^F_LbP!fE+ &YVRޡV=}KzNsB3 :q_A |)6nƄsaӚJmUQ(Cٵ9!{IAJԴқLxCG'u\! Z֏T\Lc}A:ă=e"1!|{T$/xm@/x8\5} RY_͸.^lEIB6(d*"Z'1U 4&~`Gܶd@ wmi1 A˵8ϊP$> 77[; VWe"K0C5X!Y} k?zjuI%c=)ILx~qs 3NHq-'ڝ]r(i,XH$bh&`NV?;5X~af֭P,ΆGOD"pm@!b36$j,1{64wβ!rF-oaK j:O(qjD㕃>}W'RD G??.rIƵ:B-B S0yloL^\kzʊ\m(w[wmGjc0> Ey&>x?Ȃ,2t3 FqW$jٔ$.R桦ZՂƿ'TRj;lfaTF_v=x>fGǖYk,L LtBS*B4jrThOqn6 IH 83OoJ|&Ug9GP'ʛYT:+$gAE "HMtkϭo[k522ϠrBJ^9rc8aXdK߱v1q*]6Tڢv Tb#Յ$EPu4$Zu^$%jd#lQ-s1!bgnj͎"RBԠ2Gҗ][[O:D9!+OavD8&Ki*V#$vCYڮ^}0}RK'Yu)Qu`;^fRd,yP MxA"[t R߯g@BM4yi#*]5."NrB^1awDŽ_v3E煋䞙>*jګJl};S/ꙵPIaQdNXٌA'rȺԳbcaiA"gDi*#.rkmrMN0*_n=!XyUӤu$k>Pqws{knw*i0m$2\j/6J?PC82G5:Ip@53gdLd@ +9m1:ڂ`X˵h519D8N`B"y^juÆv 4%WYFlxi2Ny#\cw61 JTzD~UPA3U<\ B9{3:^GlU[$xfT{mF3eSi f$e;qπa{@t%ܤxo"ya*)զt8wZY}w(6Jn7 D@WHz 6A aƖyӘ{ T <ln-2nuw< y 5 UZ%Fls!dp!E@flzdKS25 hA օFV8Byٛ!HYNQ^WHRuHEJha#o7JSf]@yE4U .kDsU^%vQ꼬I=E" cO8pg{5iV+FAp"栧'S`+WWXL0g۝ BZ+,*U;ϱG@yl4{P~5ʃh8"L w@ ~O3+5N:ՏA^AB+ra7y5{zP7w>'&OטNsJX^ %CKUZˍNuejΛ#t®m[R^49,Ȭ gAʎˠiVSG` t-iۈ]<-ӠB/TqV}//P;dڈ|YZs {97`>8O %g-ƠN &v|t.W ő[\uwc͸.q쬓]ߟ O "LT!v@V~gw&B\uc:б(వjUZosݷa%6xe4Ux5R!.Rz^5޹У#u?G{ JӦ*k מuW TJZ u伏\Ɇx軼Q VLH!vk۲ϥ/ n|նk?^;K |D N'ަȨ?}F߲w!tU"̾Χnov.u~JJ"Y~N앒-ܭP]#WCxxf [ St8C\DQVp+ϸw4̇1TxP*&7KRӀkE!D# mN0;Ƨ"yʄOjW;il;d'U` U>;*Ju:psK.e⹆c{JN30\wTt&s\a;|_"ƦbRs"_wdC؞ l"EGLG A-oNej`.YW^ &V-ѱ վH\'Gd">{V0 80ITR. UCyCrUD8HP wD4XkCSTEn#r> ^^ֈOsz!uhXbﾴQU%oDfV3еs)X2u0{ D`c~,@J 4>%e4H @ .:BCs@]72;Ω%˶D~HJ,9Tuː t@дJ*uۃ oZXYߚ,JOzV2?V:+xPyH,i7 ' 8 ͋:2Qkwy$(VxBEɦ3h^ Y@ׇ'ߛO(L{U XhOoVqg;@rmǧ%d&9 4B6U !ZvkxE)H+SG蠩ˇz^zʀZS3 9]ܽq,+oQF3[7 -e$l/ P9,fI{Lи̐[L*Mz?7Y܇a8arOek ƶQ&miga*\'8HɰLB"F MO;GmGoO~Arr|[Zn F@K'Lr=jZcGs8\}۱, 8;NX/e/&8 .P*Mf`ΏLax!6? s5k TORxy`qXg cȎ 씬m=j3<hTqp#އ%!@b#7=@ōlH' Pw+KBPW!*xP4؁S@}mz.4 "UrTw{ N9eV[>R_zȪ\,ּ2k 5OnB4Ym7|hXY_}"W/O/6 >e2Ky 0tB'jFս$=;ZGl1{({SVK(kYm7nX=&&tWE)R&' +B뭊]GJӳ8Op8,/xC?3ޥGKItRaȋ h^6{~Yq?iZv-Z^VKWCTawd}},׋vJX#PF譇- Au vv|KOɧͼCbYmrǘ1>1S0P#: ŴNve.4er:1O0UKbCqbiDbcŬM4}~r‰c̐7b+l|nHA[?sJ☳|Pf$oV@ 798:v;P|NƲBm8 YFnH gU}M0!x11L1 X/Nd{" Qnr"PU*w$E5#C% c͠"2O77|4ׄbά{ ß5"{m1nXf^38 AR%:%]7"V2{֩hpڂ<~ȬGrSM%@ #C`H9?"p #Orlȡ/]|fm#ͷ-hpAnnZ3 Z98UklkB4Rcs^rO8xD !~с:@ >u( W$muK+WgEă7[H+GHl+Q6Y*^IZHܺsP 譊xby;#d311b|؁&3o^C6I7.E^2zxfVyŜƭLі8BjT^T|ܓ ],@.<5`fHuTPz[WWҸ@mﮜ {H}̐Tv)H"6:ٺ& 80zu<7sr ]ʲySS̤s:=)nR;C]z7*,"EX7'8S3~ϭTżtr^@zF)AXx9^]`5c BMܐ:Ϫ_%]HOTF֯8ݶO;UD%ƒËd(bJ~$ԳTӕ]2u%ƤY@A }EH*:qj88TsY* V $rkW`6g};@*X%z1sD4lJoW;{0˦dN 6)o ĐKm6J¹:>Gi\qT}"K<5ou ^'H T*%o펉 *W,"dF úu^)gǾcohK=/)7:Kɓ.e} е4Z va&喆Vu3o6đ $dDW i@hJR \]T&"J;1RK$I_;E(Pky;.Ñl#msv STGo&{PTp['|*,2.@ޓu#!8hG2j?0B?,~ٓ,VxocMzq/37ڠ78,ѷ g+OP,"\2!S! &&.הwmbgjqENDqRbHU`B>su,"WSI ny-N`-D`}o@}t$"0|`-\1|Br}z#_8:L3[EKjp3᦬ND^6T*#`jZ{rA SLv*ch.k0GO7Z2z~P}GA߆G m],w~DMdqxPjf)wBF^iM<-ǹdص6 Z~/=?_)ģx-cwEj,יErOGr tHg}ج|;rZ\щzncU}̀%2M.ǀ )^;ݖԠxtY5t8u0*ulV/ ,{aYf#aV!-q6y,?Ź&.ҙ,$W$5]8a r*tLȶ3!LGGf1C~j=ϪD,B*4 Z/n\-@E?w8}i<Ð) nN@֭A{cZs.ш6bqk=/ﱕU^VRx8;TzAۓ#r lfVYq̿ٶ @ KΟ5hģM[[`/0| EjV`mM#.C '}yN2Z#Qt`"4lv_hR[7 sgMsKY,3[f*̰j@!SEֹf 0ėfDt `wpl븽6XJ~gZ2+m5YȿF+åk\1+>IҀrDs[|f6|lItyrJhIeRXMY췼 .[+nvLؑPA$ymĆjRgD٫E5 ?kQLkW%r`B_~c+ ~<۫єY_VDMvP;HrEq e!Ɵ}=1F!Mꟁi\gp &I*VS&@.cz?dVGs" z]kCZ/JOk _VSx u0KmN< 3ld6r4]WN(tE~(_Ucأ4m 'FI]VeCW-ji._ұ1!hpiEC"KfюPyMwPt#Qb.,Ա[ H)&PpaO+< q$TEEFnl=dˆ/uAmFׯIKt[ y7@Oc!y7 h YP/Y<2-K|pު͋ij0rumk >COUx\fJ_߳._`"#k~M?DiQ=Rij}w:FIS{!m\V.J477?Ә zvj26-9}3*z'~u5ģ>fziXݚ&1|r=îOUՖN.[Tge,n}M"i,+s>j;-:*NE^x,ROh+je[o-nLRG&Aj 䬖গP7;)`G8m8iv-vՆ 9IY>39w %*Cͪ֡ Uٴ!gk]! ʌzU-܇[#hVzl3 @k)yLx ,<`#ڬ;/#~P mb(+Q5/6Q3dzgayhX_GOYS>9g>W f; #;>J X`ÉʎFIfwyv;rBn L( CeE?*߱E* zRd;jxSR?* M,ʰ$xsiPbHg 6Xsz1lmA?O`޻ŕz(4b'50u>\ˁy1@m`cIɤVQzO7=.[3#Y ˋ BXU5d4YFQKe\<Ȱˆk|l1'2@H2[C.dl9"o;cuxTZ=R8]b0]-EL:y=qC"@Qq%5,z~w1Np96vZG&ԱVw/cNi[Lf@; W'h1 uvJHߥӣfT9=p1q)R$j.qJrw2!1[#ljV$(MemAtl\$z%ORFJ e5oUUˇK5J%3ʲ69.Qz3s <i;VqoV&$\S4[B3 ʹ,H!Dq Dy.cX挌ul&28pK-th7E׭ +W'Uȱ44 9>8̀MvOnUIu@>Bt9_dֶ"sz(ZzC_=?Po l"2\a%uo=?2Y>`_CSхEOJLo@y9Ghv߳_3Mb}!'cDZ&N;΍5[iW%]] 5std 7uOt5}mNpqZڨ'*B#yt@ɉʦ ̽tYXb?Ԑ(zMBOiݵLZI>d OkH `Z_~H,]FOp6 {w_dW9{-iMuЪhG ur5I_}Hz_D3l.P,;ivOLv3a73~4&qau4@Mr X+^99S8 HH*o/SB:=ǏLRnȋ)s""d!eҷnΪj AAN=XuJR=GR;B Yu^,;챋pF>z[d'mrIPL6J}~ɋ;sZn O5ۋr Oa9CL:&Ll-8]u`iAi .xBw:8 ϕ*ز> ҉6?T|0&/P㑽kpZH?/[W5 ~ֽ@c `@.y&G,8╺V$A1& ΟHʦ ;g%{Zx/I >x*<]M"ع=dyW‰p|iUg+CaE A'd?AZ1lsh!6RV!f򿥺Sy9Sҗ= ׫b!FtD7(P12wI{J ROtKX-#ӷnQɭ&/ ӛQU=*}Q]{)d{/: Q08*f>q{"?a xOw*뙆ŷ&X!s9BO"a$%Ė:;W 4W|"gGa\)-ĩ+Eom Y%ʰс~N%^K`?nxޭaDbx3Kew`ND\!|NYd}Ũx "I{0 NNDK? 4Jl]`{D5/`^ęn5qLkް `HI]gw`?6 kNHJ0=٬Xl6"CGG EXgs^JkB /[49ցWQ\!y yT56Ktm]* @sOQ|e@Q7?G53(m1RԫXG#;tsτu^z`HM'Ed@LeRřKSsoK^|O`Db3[Z jrE9 mQyYdpP#ԯ|$E(|jRY/C A9pj$K ZC|vħ|hOA'ؕaaXIMz;4%N5Rc1] rSJPu7-cC`Kjz2/x+; FlA {hT<; 'Wvfpp\_o D'}#Dfe9˩"Bdr_-*~tr``2G94}GN"q1PhGĢ|KS)w+8[>8-)kh}mfyfSn^ l7*Í?f(y |"3"q٬# =,4W!h;|ida-bggUߙ&FE#&q;}gQrW1ч*G< m X(_)HƤm7u:\c]53wd8޷N_Lj)8+}}xOnrd$Эxi]OQ]]rI RSB)4uCc_wDf4)XoДәnR6ס(@'}j?dSSSG um-(i9| ۨ4~R| px)G8Xkr@%rCtG>?daBiɀTYaZ#&cQ D#2Ƶ;q ̻ٔU P'&6)a@`;KM{{j vCJ[$Aߢ3H|IkXoY)@XX,=鋤34c 3 G01X.P̢8J+%fWZ蕎 t1=衯eQ=)ќHiڊqE,8l=<1: !ܵ*>sB:i(s,|O\bJ󭸝뺪4#A)dm$<$#+y_qMdW LMEl|e6?SRQ1eUfX`N:)qTb&XhE3.G_w±AM4?V)eaeo0 A[𐊀2lox}+Y" IJFDU%Q893M{m4^PܭV}ogj 첈.Xq$#HksE &m装1{FH+#U˦"l"Nw$qH=גK9IGp!0Yh\̰p±{R&" H3!.4មGy"M0bݵDrZZ$?K6W܇2S|F=F689aPD!VqH++a'l1Ok73ثy1E1{Y.y0pHA7a T6\nb2[μii @UDu[.?&>](|w / / [5h(،tٓ/Eot8'J h{gݣ>rᘣ6y. 7PǸ\S$'`le5?NAnkG@  &vxĔnv/x BH[q`%lCqH/0R} wݮSkdRǃt SV*o\Ff3w豀/QOˡ5RՁעQF*K b6_}:࿅i_'1 @V::{:S`2Z%7 `U/XR p9(06qA<}gQ$.KiVV:9.i@Xpm>RΜy 4՝kNbnnDj7jV`4( |Ȉ|XoejvQL'^)&/ahcB!l,Sλ<.H㯎S:]DO:|F5fƏ}2PMXF[Q`Rt&+V*6WƉZ)IFv)W]0H6, 痵Ũ0ո>d{^xHa7OJ"CN` P *:Uk/f9$ .De%PtqZm쏂$xT"$QoS6< WTٱ^Y8ihFگs<N0oX ۯ!Läj1"+Y`$ྶ|s]6Xj-tR #9yTgLns7@$"q Y6FU0;=xn[h-rU1ZDꛫx(اmm-cx0f(dQLFW$e/˹4 m|rgk̟c.I} 9 c1-xE S4u+G4&Vrl t|UXdcע%,D6~V즤dd[Xtdx,L=&m]L]"z_#"h@ B(Zm<]}w5r%:< V4oٓ;jX/&@Y;h0#D{켌OY|F}Y,P,f`@YS) $g hIʈf6QHyT7 L ղ7A~!n[cYwgvu!*10Fsbp\$ v%2dF "wߋǼDmS tw|sfۚM5F;(G-;V;uө %VN;p z3NתJ`&')t4ta'MOܥD b $b rf?fiP/S74Nۃlݵ~-O3#ԣ{W1 LE$7kP72$D)]u%]v SvU<=9mލ]yZ/l3߽hnJ ͶB+4^5 ir eYz6=0@ >-[€u:˾ kyl%1^t1;3B([HST%HuO 0Oi5~SBJ& @y|ÜnrكҏW}0F` _bsy}o:#CuA$‰Ss*8GbyrCv_n8ށQ8l&] /`=-)L e``3+S}%/Vݾ{iƔtHa4pb+DZ#O-2){m Q6gW1|AEJ ݒ/;oUrE!F&ꯛIƞtHoQ,MCz4s3͒u-X b|J:觘awc!umOl]eDM֞{#e j<9rieJH:SeoZ0??PbLO~11mD%mzO>>U׼Kp ~}Ի?1ŞZZW;т`Pg]rKq;X$bv]v8Y^N\{mEMq^eN3WƑPPq['΢B|t;<[+1DD*Y@8˫wʝ>ݩ .Cfw0K(Hw\OI,}|u}S:@am!iI}3K0"ܾΏXJ$K+I*Y:?,c쑽wnT ]O"bpl"ݽpRԄ8'&B'^ɾ^%j g(߹"WjSI35q<+i3Kb#)u3xȣ,ާOW= &xw%eT-D=#q` TbajD+Z]j(N5 8vDiugCJOy%o\\}ލ4 Ig Ęϩ&O`<nm/ݗ*3xYJ}K>Ҙq2sFz*ϭReMOJR)C8F5R'V 4+9]5Pp$gz~dX0Tk\7QF`\3I 㗑Tm(?.@wÔj¶O&mЀ [TI^uvQ!HՆA?Ze:$vIEJ  X+Ո^oA-ln+_~JǿoJ)0{!?6R7QGrKM]30X{eNCOU\Ă֛{L9w c6BpXttV?t -.Ɓik#f AQZee$_*S!A4z-vDan_@>_Bq$[OП1L|xge 94YZFrB8~`ȟ,r1%͇]Aa5p›,ma.0l)U](Q:p@5&ȃ y񖉙HyH.fc_ђf?b]L+zk8M0Ed`*=*^arwHP ^fb OA8\k6 j6t^͌Ĭ~ WUк&@DY4eog%[C-RIw{ *PJHp~e 눦Qɒոjo-:IqqcNv@1A' IFjd[/iY/l'F+z~Z*Gsb:&n#-C4}'ecEd_Zw)#8]܉Ңr?1WD-ӌH۱<#3#>T!]OϘe)&` ܯ?aSwW(]cJQ:,E~O4C}AY5wcRUȈI`a_R+ME.COׇ@O)/G_L#*g/|]°6n>7f5H-8n1&vLO# ; Yj4?C)a8yPWi mw%͎R`Uٳ&udX VGWETVh$I8;E^Ό$^K.2تUߐ,]ߴW-itq0(0-ZrF$e${_)z&Mb܂+g@mzmo6\#pX2=O|݋MwDiF-,a6:~fvD JL ܇%8ŦyK ﻁ+3в֘TOkq)# UQXAkWly_ϳzns0'|Aֺ` f7Իmo`kf>5e}2^ |.t% ɐRTT;"tl ~pDME1uƳ|e!\d.9ۆY;Z|GpQ?O.}ayCWo .O>1=wt,g|*a`gfzBt/IZ+c{[ fB,H`O0۵m'ot"'u%gWcKcϵg#`{3;!# ٬Y 6O+%ƚ,:^*&Ht kLHDv;5$\InZŹ,@1.-y#_࿛q3bcpn|]U5 - C׾#T$(n.vB#+܎ϡJ?+eQ[M>&Ta3Ncsȃs]̓*Y+uc#YQ~ zFRFzI`?U| WXlife<ّŠ? 67zij0͏z1EG;*DLAm"$a '3Iow"~,"#ڞY&@U= |/13ݡg en,:ߕ̒G .uϏn˞c|$3̾BjUk^v- eYh+v?I8!T׵­"E.O0Jb,}m:?_/g>9Lz>GA(wqV*YőUgf+G07ÓaxԹm` _\0oIk0ѓIO,gpa#9͸ !7A=)FKmɥ:*Ʒᐄ+lGr$2͠BNg^A Boc '&M1i>6"ތO*6ӄ28)`15+"8I3ʜߪ#>y4B& #|6 "8B#zMyt7Qwp~hul=uɼm;A6nZ%W6os} bg AQ~U2 -B 77{§Yz#J̞w"_ci-O wfr {tw>;՘bk)'4rn*Q]mE[Zc*umF nYb%k鿲}.Fh眒߉OJ ;R3Cq/Od][{kD„x)A(k& )s1H(>+{5r%g75zEďX~S-.>85f<$DHdTiZ42DYe̢nE;,cA)(%I@]fYT$)ik*#04_J ܰ5Yݢ0J7 ? ?;N5k >(J~4)T^&:`x"3oYo`ߨ8^d$A3|')XДjDYƸ`uS~iuѐ鉍y^}tOꦧ 2J?\Li|n6P} ܰ|:[M,6/Ri5c|eYčFy4q"8{@_ﻁ)iK"!>ik=|ab7]ty>q"E9?J6OR9eW|?(NKǞ &\Y ;`Z\W ԡn=/ :{"744G8h}ՌuG" 0yLqE#sIJw'9KY Lv]Έ=i`#(tm5ƻ?vybP{vJ,nuP *bAV2yȮ^1E&HTrk-&JāٱK-4_pNg+ldӪuRXC؎M%?4Dw}XILŻr'-Bm"9u #C5 nw91[G-K%KrR}!?{'#'DtH"+M*<72|Y el9@I4dI񭉽9Ӕ2>['5nj$3?+&PSo6;૒|`~oq>g7P0zB1MlSc+].I؁ȤxUrtAF0*zȚ?9JE_Nƃ,gs1R yҾG %!aЏ7X_Z\N8/2'F۞瘜{dA`Lf9:C#pDє[>揂8A~}"ے~x$Pj З26vDTLž&t4!E ^j8Y(QIyy fҭW[ C:݅ (-.A7DQ}š}Qf5rP0Q&MfNG:B|ƿ֥s;5-o8VXRvox~) fk;&pq76*Bk-H=sh裂XWOCоs qѭRJU[a9kqk k_MUE.?9U#5 dպBB4}f)*.x[ ˑ ODjjdRf doik-YÑ$}hJsDœZHt.!iАvz~ҿU0Ym8U68%tDb~E:iBvRkAIHN &Jw*ΖM metmA-QjfܾFAe=)!C6$tr&ةKgEk&sWjl^W8Wq"|f}'l.~+/ø..ȱSp0pv*V&>6Q"J1yM9E[ !K`K1^u7Ed@eBQB4S+:*@"_MzBi\Xl$MGh9aX5 8*ȷRCrISj:~u`gqR|;ku6oM)QԂM^-Ͳz "Q7^bN|!z7@eS+bA1㷞H*0L8pl3/ذIh uk A4z [wXk 鎛{OOZ$`2 e%g[:BTQ"F˚S);xb, Ʋ'ߎX;G:F⍞AZVD0p k=82(|U5+kq1MOqwF4%^d/rOҌ>378ӚBt Ǧ&?NO,7gcaNQpLAe4[V$@0!0*;ao$MЂ ] 4=̋A%ݥ9+'YVk#}ͳwvzg=Jc<-QRDB"4..:AH 4z Dra , Z*T; :ϘH9Z+P2 /b#7 q[#}tV+㛳[?,7>D.缒??Gs+lZv!),R2juc<<_ʗi@k(hnVAзBp5d`Ltv]4ũ@1Ys8W sg>^؄g,{Q]9$(K{}I5B{WP6ث6ޠQ>Kѫ.zE#OH37ml'5ٶ :9ϖY %_JNbAWf7/H9 5U[zLIkٚ)l1{*φlZ $Gw쳳2)쵓E̴Ku*BPhK9i)[HܤuIdbV58Fy^2b7]+qCW^8e.+D5͞_kݺvx'ܗ%rcU& 逼^!D3'Q ԙf7[ z."2_&u೸N n=J"013=G{nP : mw4z.~W?S6}85UZ ,Dasl<Ĉ eܮ0z20 ͥ-s aW^_=Afam5[Sv#G!&>Җƥ&hP&"IQ8,禸]:wJ@`z;sLw5fCaˆ-M{ ?Md&AjH RZ& 蒨%8c`T2ԛ@O*q!J2i5:6PO8]./~?J3VkFbLA62A24xJ6U Ƿ5r(؂WV h@HA=j~ N}:kJxϵÁ'>T>O/XEv З]~) G P_4N=탛{H ^RqXL:^MSmQ%㽘ԕ 8 5AEl@ψ*K`K&Eѳ_?I:S'>1L0$^ R/UTl՚%`':c$OYm -p^?9pOHupCF6(Dlx`?m&;I :] Bp6 fŒy>s'PoCo ŠHr\\՞ ^t{Xxu\-`^Ee~_rPM-O{p`-^bƑ菙'g2|d`\NɜTDޕo8` -kBANyCNM,l-[EX:zg+#zl`Ѫ[i Դp?*cLgKz"e4X$%wPe3-e%|D+9#_(Zh7x)}q4l Rvtً4@~D9<O.w"{0LF'Q᝻4H3H,y+B<ѯʣ,r9LHS):UA &dMah2g(n;9uU<;ŧ|8[ٌ{WPoTGx+0FV|akEL̿GFt8b>iƊӣl=*o9HEf+M6W.1kZ~(Z39tFrho7X yWH|+jVR8WiJwy UfcRH9zTlka9p8+/l"`+#( El2L`B#"Ff!+7+Pt+&oӮ-)cB8!8Z5Z| :PP/\aI,:Rթ9m5*aApN*? nocI/ZJ=V ԝF^ }xS*P),.S "R2_p;X ̗OU4d)`04,#xe_}mXVU/?};eݫjN]NW@I)<~i_ {O.x()8ys(3f_6OkCF }P' qF'ВlWK.K?X<2Q T \eLʘ>fNFKxRCD-I[7iyVXU4AMԻM@R݅-/F)~ edoJt\<|x[ݽ)Faqԡ{v4#H_> .pl^4#>YZ`=7iyQ;:͗D]lHVH{TL^S! .C3`^:"zltV05@ʯĺ[ը4Sa8ʚ r?|B&r )@$񁻍l-u*Af_P/>i(Ge+b>lG7i``*5.!$v%~L7%J<~phy4~(| AxꜺ: ,+ek7(̫ 3;1cqh5"+ߞrUzUA~G/lZ-۾/0ø6*b]:{*{ "Kґ "Tmen6O7,iL*CeEKr]k߻-_0꥽u|[E$k0l69Yx#ؔm.r0PΣl|Z쩞}*e*!Dwv4"괷 M0ZS6&2V?!{RJBsuNe?Ƌ {3u RSe6*D#jhfӌFET`̰܉.G`%~G1%dȽA~|+[/i;j5-193- [ȍu{uhw"GOHmn"TN]N-oK܇ՠ-mZwW:qPTy>}v(q ))vhsyh(;}$Pͼ"b^o~pa>D{íg/rZ9u:E?!t],>+y yFqj{8&îQW"{N\y#ږŷm R^ [- OYz!,.h L *k &DX̄&!\ >BkVm6Z7o1̫{NF$d"g+m:5_ښHAEM;"K߰i*FCYv6:AJW+xWyJߕfs, Ԭ=oHu'BO/J1$@3X죽1Zo]F* P_+rJ9nkWd)$F K,=f+9=eXreE&xǨj0;da|g&rLT2}O?Z_f\~sxw!ɾ^J]m/K3;o@-iw 3đvS5aʬt:Y><9#,.3CvSh%$rh5Q*+ee ~I6f"J썱?6a>?O멬ֽq|P<`R' :.w#|ozlWB0#:00Mð"U~P=Sev'^nrb s;@^* HlW׫b-@8(LvVhkx0PF:O b@ ?ՕJ([ ܀갱fet/!%{ǣO*6ȝX@APMB<ɾeƎ@BuV61DlTVbGrné3Ow/!qҴyt3 'Ҫڍb4H Mݳ2pdpJZ s=ǤXiFYz(//܌ʹjM+e=#bzkQqj5{Z%eTc$M;=(Ӧ%xbe_BNcE4BmqՈ8,Ӌ| ϒ2 =RCh9hNP'*摐xQa#o:O5PE>2R\`Wh%aOb1S/w޸/8@}Ò'b *jb =+<03:g4K0HZO At,&ם{2ڸ m9V'NK[>p0h$a 9u-Z$S ,W!P}2G mFU7t94uV;52G(>k?/bh@|1 Ůe{82Mu5=mB#bKx)Hetw!f(L]./:3͕2ׯq՞U^g(&N]s.ȝqZ~Ƶ=zל {wu5.F)qQA ֮1@ťt/>Aϭ h0 ˏb PasKx 1F垴%[Bhw_KUr㓙װФ ‡񶦼CDYVa:oDzA6Ӈ]Q=~(0vy%NML{Z!OA//Dxvă*o_Ji ?[ői¡G2FrpʢH`1 g7UW0łm=N|wWbw{#A{I Jq!N ދV0I]JD}}z؆y"B|zjidURa,צG{p9[oK(ފ~~x)Mbqқq(G#3w62}C1&^`u{ `FV  =k t+8[e x3{MB@Q߈jjJgk2̜Kvu-ʇ=6*،(nHhMq%b א9aT:o=~zХJ#,dGAh(RTxV>Os`1-ԉ* K)2oVNypzZm?x rx7nSvNHhR}\`Bfqkyqn3mR6Ğt{IET" 04a"'^I? LR79i׼̓ :`DeТz]Ԥt1_9ݺ_D"~cn.\\3/Eb 4dJ3Brc},z^ɍ(O\mG.5KimghF,󌦼w1x(d8 @UlxL}wpRid_ ~ƀ ؖ2ivlYf,g4EeQehWQNuj :Y kFAh &exdK.e9qWobxX'冨8p;_(;J?#L,/|aHTҳϨq/6ՈyY`4 M 䁦\_Xjg.ɵ#vc1'/R[끼DVK+P( ? n@"+ڗ Oqm8()gf#1 L \uw!Zg眤 L՛ <}/QΗCx9!TYLN_ [ZsI]}/F#+ $hZ< Jz̒lq$T(3.!ͻ~8]8y,$o4mӖjj2cMK C9抿0K~"j@yO$)wD+Im!x.$:;EG8.kmn"F7P8dޟ. m}:$U5<&uо+dJbq0<$R07C-zRiWqM>9փ~S> ]Ea+\g{ 0աLʍaU`T78F')ż܇c?劶k(,-Gl9h|1{擲%~$f^_oݮ/;5B~,9Mj= =첚yf#qC=!2'yt:?C\-ΙbGC@&e+{x7ukz# 5.%PP@nh$zwB5,2~4_t`5>CId:A`?jrV13/F '5n}Ќ'VCJ)^Du]Ŀڋ*JLEFFI 5c[{6,fOqv-l{xCXIkve?=1'{ZЫпJ%b@t`G7ABM=cr+XϰTw1Zg}'`D}9Y9Ntu|6γ~2ҧׂ&]gF]/ *NxH#A-Yj¬[`KNkӰ, z, XYPѯ(WOM@ ƣXS*yAsu@gialzDZ_FPN pR&hʜ ӐWt蚁Zh|V|,C[ÈRC51OΕ?\,ԭ&/T8xcs/ b1`,/O>mW?q4DϰO~e3V$LuʎvM7(%SK?EwXLtcs2=Rul [<+*4Z3:"3DIĥk~}WXB3G:/D 4kB<(c8clw`ki'vşɓ}K$q* Z5U-  4~C'J Lq>%)SQC4V!#;ȓNWs$p>-Z#R[(SB ;@Bc]7l{HИM`2`LO #VГ<("T@G0R}DNL׾A h:Q=wْ<]qsv_fZXz-Y]/҈ S26ssnh!lU j5E7m}ԙ^VHA=zrThm.]timg&\Ŝ] ں{Lk{r`]ռ4^AEWTm1XeUq!7? s"BӱXs%Ln!@Bƴy1Dտx'3f}$`(c0e9^Z] duyơbLjtUpv!pFXvc'4S=ݏ5v )Z|hGFoopFg}$ (YHb&S!d#Ekό`Q^hJsXS-YSjBpV&]pQ3av/kwpcx!\K-C\a⤐98e'MAy+eW5uTHɫ{*;num>ubS% ̊J2E_; W:w6qX)i4J- ~?TqYW,ahea[_!Ґ97ثL (n:[yTc>$R>v~ʚy7 ֿ}:B1cN]&$@Nqޝ͐1<8FW:)~U)|ߝMhsV_]jX쯦Q\6:{_DtLXvbO1dvK}|&yQơoBvLƔ>@Yu SيϜ >`:>\Sc=iTА<8'6cO^Q_hEiN9+p,5 ?BIy}O&I390f>X/diŻGb\#=ZϠ?? UQtaʄ#F^sũiWtI%B`QE zi氻%+]dvA?(AFG&ݩN4[HS)ߗV`W1oCp<ZmDێ%l?r-8\%JQ`ma#dJqwI YjRW0IBo+Ub}eŠ:ˬ5 x璨`כ>jA),53$%Ek.#!*Xׄ6&q{v*7lP*j6xBm +*nI7ZZ, chp a7_)F_[bLf&9S ;vk !p,\_HQf u-&XfY߀N?x[ӐBr F|]M#~o(moRHvѮrC-8M҅DF=ө֕5vF?<ܡdJr&t%-%(ymI;chStq` l _Yn>A;Q+O\^25'cH/&QTCgkb碮0#ʇDL."%T#mPmrPkx1S/\)3y@:NN!ܿ9k3[jq71ʼnף帋:fA1zF-Kd*$"ؖH%z|q FM/,")Ki:u/2^fMO҅Mɋ1薑8 zHsW S9# ߚv\Fm6 ++) z6.8)IE_W+\HH|3zS̔ kNTz1j622FD id w}}!&$dtxgRܢT,8O|)L?Z\$oa]w;Ad+̷y"?7"@)<dϞK.Yw2)V(JOӔ'2{\ 8MsvN̠W076T'K> 3Cc-*ۈcڇ IW kzl|7d4Wm[ޝ(ckQ_OYY@Rǐr\h@g=BS ё. tvUV%)bM6Zdb>*Kᶧ݌٤WS^Y1VdWY66,ӄch@߽8[wz6s8'1Dg Ԗmզ"L;q &jJ377lF]Zсh,E׼f1|;Tp];]a#2I`~ ՉLu'|(J&AC %g5o_21ޅMbennmYNil%Km8@-o\\Z#N#up;!k3u)y c f;]MWicSY-BU6acq-7NQD;5jra@d9IRe2Džϒy^ʊ|9:%#[,i`6:Yi󂩎SPWۈOF ٘K290bځG;)|/THjͮS}oY* #fcb[%0fU#``k\r/ n %lWLD [",]18 hSU*$B $q[e q .,,  kz. 7.BY.e)S ASDjuLelSaT!dLM bh$YÊ;Ĺ$ugI&)c3CRf-Q1*oI کJx>9ѠR(Eosha@c/[]?2 L+ Hf880q5RRbmD*L}"hg:qahT`'Z0S<)y $IL,5y#pu!)&h.,IIiJV f*(&aEMd‹4iKtRf$^_a]c8Ҫke],,V*IEW%VlBsC\P7g-=eB;'a!Uj3f́I lƶfpN\ f t8$icJ$%DцڡCPbW e$nƶVL@M!R GjL9 ;\2[W69-VYSQRh᠂HW x@MҰ#[ُQu0v2 H)7B$$6sqfbNU|~~ vQ/ac^͂Dr UJH(O:v x ~e93&_W42ח_J%dDCu̽/ {c=)p΅ZsJ [249JT'I sx16Զ<3tE]5Ӈ%s_ #{32y^H@{UE;Y+a\XEozTOG->;F8y>HH7@FvDRW(K]Dό #ɪ]0x@)GD:@rTIc\0?nycon~s)cQvLme3ק~ow׬rPO3˫4H"XoG7Щ@4rc#4k(,<~"oپ=!n@;fb4hQؘb]#+[`pݓ7OQYƹ=UY-F/bvca(BBcOB/hoy@K4#E)/ 4^:j{ز.AXpm4ҙm#3<PIF8Ͼ FW.p/Ah=%9Xv_Y{TU"s$at\^ #3t6w{h=q-7 D1*a2:gVQb'/hHYx] l-K<{*éSH`},7>t.b;mrύcb;YzV\۝S/8?ќɖ94^7m&j z%t&dc&@\AH.qϥ^*0MRd{. ŦSU.tT=[ϞGtTW3V,0"RfH,ԽX@6p:(1!E]mdgk&9GZW8 %_:س9xYZizxE嶚Eޟ8B" !X#PV]-dg쿟5'XKǹ<Ϲ^WY?emXJnb0]wK1K{^oZqw>Cw29 )caAΑ{Z߇,k'؟)=BAd|xJXegi [؜fd2YqЗi{EXi!;㈁ Aӌ z~>mgGkIˉ0H<;7YJI2$K,J`b#\4m&Ut܍7Tr ~ 2k ").ex9A++"=I]k +F~(o!o"ʼpT]cRv"KP5v׬kt()Q,ԫW=K @ucaŭ6Ѓ@1jb.MͯoʐAn z> Iǣڣཧ 3Ucvk>C[ >;Y ߶"8a]<22×*\%| ҵxUqoڝ@RME_.:3Y}ކTݲ#\|r.;_YZ%Sۭ!OU_I~d_{/P%kR/JF .gN=xj?j ,ψf@JC:E`x7&=sCOcD]23H=a⃗Ɨ( Lx@*oV]HW./h~U[¿YoϭjȈvX%G`-PI'QeUGgЧMxb:.xhZKY~с=HbaQ+gRN`d&tp6D00C cD2dh~P.EAA}l܈UI^؝gNdܛ($HnКC + eiU,w!K/ILl*+p!/ӷ>)gW!D39_‚T!gLwNf,řz#IbJh~DnLЕl!܋D D35 ,MP+ν$sF\ZvJoDRF_E_@z:y&j\!1Q5@ 0pDV(S m"Iv 8c'ZZTXj$~shk&gjLݍrGCf }iL&{0=`=>$.0i2'g-IwhH" T(5hWfe h.,T@9xsq% + b$!HVlgg/Lj.o/?a+]L[d TD'׷X@$I0$D*/wy0iX9Fd57?pAP'QhbK'2Ts} M:qa^<ӻ ^aUw <3k%>ױvLAϛEPA&@PYcɍ4edu5>ĉΙl'@uZdD#1-3fƨN1FEU @ٯ. BV̲0L֬"o,j%dP뀉3!e 9@0, hAK%Zs퉣I:3`֮jT/vά)!XЄ #@E",*NHB e,. \B1"N"H BAa1c-קʆƛA6 3 ;0`Fk%y4Ւq-BɂÕ;Mͅ$@-iNpYיfxE. rub֩9;L ' ڙ(9:e2D{4 F3wc!I l1@H"hdDVE8-VM R"aHb MDV˯ل]?y<VEi7 5ou':^63MzwyΊS9ӹN*|j\+fϽ]gs)}M}Mt70Qz^)߂g}q;[ 'XjIq>(ު%Ewޯ >ܖuxo(Gy7)VZzibg׿Bf""ur6<kQ)[5{ fs˅q`ÝK,lW6޿-&%/%!&6<Ҙewp ]FF_nd+QYtӈapa32ڹnW6ҧҗ/=qg[>_c,\kvi)u̬'T75fƓ]#iuRӻHd[8d)?x㵼Tޘ93*Dc)JkOۿ#w+r{vk4Z}?No;="k8!礯5+nn̆$W7ci*8[}x_t7%#bm&/ߦE2G-&j>w=cz;GH Y96ok^x}E|fvo巯 gT/"bLC%Z s"*g()F„ U'.s!b&Ty9,t4^A 4hԋ!88.#04ڇ*"HKZܠl/Y6-à2.*6Kڄ;p"/40sNI  56[}S]A($ѯi=w00ۖڍN ͆5›߷˻6YP$ o)Nˋb%W `6I $i.N9 NȐKșAv4AHbTr&;I,!SA > t:D5`D( ^[#e'D1maZ-` =IDʓЄM+ [%]]?1hIc ?V^0BQQɄ& ÁaRO4[Y=7H$;R"O v"sۥ ?MI0pJ EC`SeDo&'-I4AdV:`|$Ҁq0O=ޱ*\c(cHXJՖ?##/.b>&4M5Jv2ul&bQWt;2v+/Nl*3 w脡h+]xL%[1oZ>qOގldP) 2k?jJa*ks4i6] x8[6p2t!iBm6@FU`Y]М̯~?!|ϠNbȌ(T"*e8ĥw9ҳVTV9N"a.#IX)D\нk@ $!8)$9]`a͹[uiJ&+̭~_v= 8 ´(u *0Db0dՉJEqRp0đ@A)HzgHXQZiq*=w4XTmcv=W0MXb~yj9pT4 N->Pqx0i)5قW]R8vƣhnГ>q^h3o|BEQE3}fs.S@e1 loKKLJ,5~2i\cd+6V(8x'|Zʪk[.]Vqw6^q惆Ɔ3+5pUB9xgXU(k.9\ \4 |xIp- v)@:IK_=(P0s? NJΆ`d \W0 2Ő5F"j(Ǫ[IQqzKPz  Ls~\ VnROJ8ZOo\ځ4L]w+s^.fE^ҵsƧsY6YiԙFlLq'e]O*0 q8&a!`1$+2+Oc Qȳ"Kq9S=KjhffMyȜ$K~BÊ=q iy 0ؠ$@@b!0:q(ὅD aP&,"|2i @ZRvHG,zAwx Z\^HXb' 4f(DPQ 06L8e;s'!rѽA SI.DOC"*p~ﹴA =Lk~pbP1Sa]|zEtN"3buh4y:xsfgI,%D^w.5"m*L% N:%mPɁ!S"%!D\Skr  4zr=omk59FO@Du8ݿĽrma[&͌^e Wjh/vr 12v$ Q#s'h 4D6X:I>t/Ⲱ$'|v! ~H/}'T~mI~ RI!Gd|$Aa 85_= ` {iv2B N0 Q:xj6_\Ŵ4+W]|QQr:Jelܿ-j)`)rA…o Q3 #Cz r [y&b^2^basxG8W`1,Mן2d`E4le8|CQ~:]0ÅVֻ9w! :pp`'f-׉m`,Ie.xWk_XҞa$Aη3L\'!ޙme@IL`➈?=7HFʧ0V,meUvbDBMύ?|b9#ne"b4!.QctZsa]MxW( ˈLVjb< GHf4wwIlwGZIcRs/EL OuG>pfL_tu|5f|.‹pg:>r /vE!(؂@- n#P߫B W{Tw@ZX$"@ؤ4-i# WD6i "N6&<u!HFbNbRHKzRo^ h&g&@MlRI%T߷ q3,+$PO6lG+l^blnr[ .4ioc^*2~\7RJ+QKD-.S o(R+ jVP)BS2`"Z4ka"cph[#=e_( ]LP8i>( B`(εs8Aï;nV @" 20ޞVbS4!Ҍ}8M" 0f B' HEMQE[O{mJ3 ? ŏ*dSK~(`SƼ3=64-H,{y քb@?J"ޟ(Q,(63hNTNdbv].t Lq ^R_٣aO7teB +w>_h|Mp;hZ8#'iʭ' AxZ~DD1|ImBp~_ $'ZiT ·?LIvr.+ԫ\rφS 9d'Am%;6i|<Ânt{}OA|;_65`~]4ӬĦC eZ'Xc}Aib6I 8^’*7M ݁F86އ !ioY=! Os4*(/uzZZY@=|W_߽ԮfbHcM(&P^RzE%MhR ;?Tx@|唿w'UPOWFHdV۽uDr=yq9^yNGH n?/5IP:KbIVhu;d=uC-wzο;u2XzioWsЎ{ ,:dr6BP/|k5ʷߙX'8gVAz.%&K]X ҅ލs_Àt] rhDS*ͺ™9Nƶ .jo)P>%% s\4e|} *w: 2gEnpR:ۮL]]JT 6C~b#Ɣ*4>}CY$4 46[w<Zb:6X:]%R݃B@_9t̢;u4r_%PIjؖeєvVqPjfJq+9]1CnWsȢy5-"ݹg>{1KObsj[٦d[}ljq2Y_q O$VN9NmN"4k&Bb94vbS tiDIVrkapS.NkN"ODQT݅}w|˲GC_MZ>XRZT98|Fj/ g`֣谽} )r$GXp웠B_60.m ~G`ެKhzPKcjQܿ?KU)~Oӛi_POhbTc/ d>ը ֭P%T^,0$Қ\'].#0ͳ+v@@xc/ fOSeSԲE$J6 I:zX5_#[I~?uӮPҰaʳ `!:: n [,aĖ=0 }oFeo10?| nɕމmO:6^+R?j˳kX"%%3\В,3??$]g$p&,%p^uϵcw^,z-7f_7Y$C{aCmd/Ce3RFSaVZV`&*~4}GF|GIwQڜM|ĚL§H_q{M%7]QvlGbBϐWͫ@!WC뵤tyd_ Z44L}oJזγqhdM*O%kX=  7K</t R5Y?m`9.r&˶jq{6xH`:2RdHkGD$n H1,Ϋ^a-DYIV2"vqC@'ؚNXYjJߺC,BL9.CYiI^6z/0/Zr[ܩLކ5h!͠EZsk*9|]wMWM9DYu)8kMzb)6C0K3 {4?񰅩T$ʣ o*MMɍql LCTcJ>?0>1{5:uH˷>9wl7Kq)f.q ~TjKoo~_M^:z9y1_TVMFM(Cb'N$*vIqL]xju01Lf~T nȊ <@DEQvw'~95l95/1&ߔ7r2Ѭ2iI x 2P8H;[[d;(kJ,2M'8x` gEJ7J*KQ e9ƣ*‰-'mK|--pt煭X5/bLF Z8/tB80ZY/2N 3laIx4O' ]En(!3`\Krʾ~ݜq*tЧmTB'[J"LވCU71:%#cd̝R@D *qH2XCrFoM ?rdq" j̬H0̤7ƪ16qJ\jGxOdGܱ?#Cu{Xi(;Lx,W([Ecn<22KXJc컖_Ff^DrZګ*Ȳ:sOˏLD )40īN:=ϿFla=j\^ "i )CKM5Efu&(x2~&ݮNDԤvϐqςy9IЊ5A ҁ7)bC`≥jBO|J?~Bbd%4hZZCpq uᣔŒ " G=ʎs!YMY?݈ +1~I&v*i:H!mb-oI( ^& 1mm1خu%4DBI?ғc4>-PͦO;txĔ-PեF[7ι_v(O2?RbyDRvԹۤfE&sU| 5)ǃ_$bVҟ$ VYz‘ 5@TIz=61֯2E.!0m*@,O-xs4"ڰ6: &QUb3V%h I@H-EG/[b1DH2YTqM(d`Qv{15iC!h32AQj"ADfR4Іl\7⿸YDcMq#WD}gSMy8ܽ7{쵷P5pSu1R9,uI z G3KN9^RFQ$vڀ xc#7 {bIDG:iON%{X ^E pm=u&^o@4ݝs(4M@;6af >` @Afa3bAnuàl,QW[ۮ؍@ĝ %:b-Y;mi Y'fS HىȌ0^ysop[tbs މ;G̓I ?,: _M RU_ 0MDpgz~#ߧ$sDKiӋE9Z6)؛72 t9 G<}{FӼ&Ar,CSqahNRh|0i2@Ҿ *Ŋ([ PYШJ*THEr_4Yփ;ώNN$*W X!﫮 'g>݆MX,4;Ze̩'B@"vj`B~ V84g@)B&3Igg}6bNqRؒ(idb`mX)MRܻw-Η6puxmZ Ԁ1Ps2;(Aif8d. tء6Q ODq i4)p5pÿa܆ח <,m&T*<5%QkVaK<Ti-0:כgk,U uC` -ɤ.!g$P2J@IGҡqϲVMUk .YjTF%XeQ84ɝ;b&o,:Y2NR,sc?8&΍}XbR!l~\X{^~˛.HK^}V%jXݬџ42t޵!=H&Um='+=$ WVoE])h;1,YlZu+2'B *x::|RFKlϙZ5@"P%גz#f ]Bo Alޱm*qtF2,QD%+-H 4Z:P}܊KWb5dQڞAj4 NaM4" m*^>lR[+A܈Vbչ/{_FՌ2"wU^Ԯ! k,f%]ؖS ]3B)MFײeb/D4M( ;$CRJR|VP:d^N̉3 b<& ]iS f>5b *A HaЅrDվ:YI18Z)BOJE.\ӥ[`/n B N4_v;qm^M75,NniLY:^]7YDք`+{蓡̱tb2T|0y)UGE t7:EIPkK}aE d0942οzÌ!&m؛ܑ9$YKN[_Z7I^Ծ&XeUm8 "RTpx@q rk7*1l  Re'G K{]66 E/%_B{Q STA@j(M뿈`la$!(,}#BJr>QYL=?d1nn Y> ;1VɍsoIّk M-&4 ?]{gr϶c,yUKD=yYxQ6 S?,st~qn//W1ބrwZ~Þw>NaボqL$Sgzr_ \{Q[D Ѹ44d 2;ShRdW(܎֙g*"+a*ѥAj "}޿z}Sk~p]Yc=̰iQ|f$5.2X9Ϫ/of8Vb%`7>-^[Q`p v-HPxEFE cؑ?TlK5r9y ݦ5ԙIG txK _pʼx*:BFMPPb .,Ivg2ag\-.!'QUCղHI6=/ 'RX5iZThaqTcjK$s$Bch{d) TRSAyOe2;ZA+3$Tg (܅3 ݼzأJ9nĭ EM) [p@s4Nr0.DЦ FGB&UHb2&6 JaYzb)q\&d)E1SUޯp+*yޫ XP{R4p+(zhT_/cxTx1C&sgDRĘͷah&Bh/I~qd8 3l$ !( J`}Np旺cg^I` {U@>FŽAWi%DK$qUʼʙ# 8K:dQ[էsA$L(UcJi _ ࡬䦺t_7+6 h-)LrVA8 Ü+FP[E4uB!B;Ĵ=Sv'*qꭓ򶚸~$E+p3\?QDR=c$Qs孉}Ț\HC|qL8+$!0woN9Մ31l3$!M$\cԘ@%Tw [mLbRRJBVZbj~@)ۑl1P{UDpK$^׼mcɒay([$fwC2\=ʋbkN倸qk0PFIww\E8FZ&+š5ƮLG/B8(s@I s3dڒgSl`ef`XTຑO+m"RNuJ} f l8am4eV6$޴v[PpݵfT8zqB8 \Ē@I@D +M.a><[FugJQRy&,s}CnOeP͍yϋ36≭|2I (>.,r~ &5 5tՖLZ!׏yŦNԔ.d(H61H+3^#4D TR!ec# Pn>iōl rCtf}Q1iۂџ^fmt?ڎ`*5*.PpBO <$; ucm$xb<Ơ3vacE6 z  ֕@Bq\7q?wEҜ-]r`Tk<)JbZ vH1N,b"t͞ (Ϸa*&F .01˫P" 1[H 6n;*x,{ oJM*;r,IҧF%VNBX5mgb.g(mWjr"ڏ˭7vS""UMg["A ڊj;+ 4qk. Cnڪڟg{.2ljhMfsL)eXU\҃kP:'δPfZl(3 @ զU]W9(+,{D]o:״o4!KpI[ 3T9LFW/kػX7QnqRgKex/0L1)-|4b>1Ya,m$ͷj6 _ZmT^K  r~lۖOMk_6N>`?v qeA :7{E 'Z#|Q9+lv, [Kǘm4f!+}NpRɟavSzڢRid,,zJq;Rݞs:kZ?0D VE*Iwn"H ݒSލO^l4rݿHu{z/!J%gZ ١ERvC,be(S9o혽>lm~a=H_+/}v2 Y$@r涠(^ZαJ,^&Ij鼎VL/#G 'c5NAÄB?ia*:qYީ&^v>#d.MKս TV X$iE0ŒmڣdKXkԲnzL+,3_OH9MD$hcf }΅鞣 D >G! $?_LG)E2 6W -lCq1e{uYF|YMjD.8AiꯈAsѴ!ȓדz~|s^}y#PöN ϖ nB7f~C r*=0l{aȫK4ĜjIsdR<3E8i!!NU}4})vP!zXN ` X"Vp*LE`'O6aVLP UEh h46[}M0Tm\^B۴"B|'9ɖ31r1{ #6!`/!+vEFv̊?Ͻ><0[ bLΫ"mW̚E ^ubȘt8JA]jQ^I-3PiA墔H7EXjlQ+ {Kիps `S W^$$ڤit&`@K fQSUS;0@ztN4Sk|5.5ZrB>]1杵NtxVB Җib7wǧT5m=NΫ˫CCnmJ sIk-x<ZL*c}Y kfI\tYVri\Fܥg`-S3;Džnb:inntw4>JlFHfG*Q&>O$@vaO(c)5mxyZ!K '!+UMp aXW9iAkA攂񬢕zJl"lYđr]ҪvcDSN#m_1+cUSPh+ .Ŏx]y {8O@8c d߬GM ÞAӀ (`SǴP8x?sdnrlP(Qی@[4gJFjXNfHA1Rhgۦ>Rn 6X$ 23 RDRKZkL^ˉ=暬Fy5ȘOu&`5;u Z[j{Wܗ'q[$iFhnQŨ$05@$"2>e̜zzAL7GkhT@ڜ8{1: _n%uIđ!sE2ƭ|%w^gi5UHBKo + 鎽~jkJ:ELA-eipvڡ{Asce&N.'#~7}H! TlíC " []@pbb\{b ̵t3 \%KVUҕdMP1}3d6) o5p(MŇ|bu[X*8j*΍D.m8$UT,%VqI٪ʢ6hyr@mU1.UK aAǡo% ό7o-Waj\(g(1 ԭ܍+lxZr!ZL)^ZɬhWdYjS,%:x/Bc##pCbYĴȽ7Ver )"9̓%FA&؈ b"O4[gSz@-(iD voOh.jQ9n=4CUo&7D%;j]xM&隡e/=T" JwG&r9#lDQ:sR ˗LrԈNA"' ؑӱSdeaYr)eC# Sԅ"ˀ=։*j-)B 9EF ߱z@>F 2U$ڄy* SX?~*'aG8  đ[jFPz Zڴ& 6@é-X}92=UŗTڋ$d4`ri} 85N%sUq/s]izC |vqQ6L%jKK@( sqXN#ыQt ՇBS lɢ엎^Z9J,eDG%xpb[œ]^2iGy88$\r182u.G0I"" P}wdFW yiLfie;u Ok0SeՒa[*9bؐi V ZUQ&rD$ #(jC)پf!|U7޴\1=+lA(ӺHZ Y=2fQ6atәm<*-1Z?#OJ0?Q%1ügC#?$@mWEٍFE(#ݱ#q-:( Y`Л$Gj̔4AT*݃CCzR4V(FtfeNˤ^YݮU'!ar(=Q~崫r0F ,?;<`ݨRQDS]gT1$bϥa~SZ25Ŗ^fEnXBA-l}FiM0WjU&%7[wi# dHᑀAoVnLkc}!ѰCB؂wm۹î~󳭸bY|faF/K_`eײeU`߃ЪZ#S*T5}NQ4v~6fn&6,оNAT@luB5Pj©N4$_)` =Ҽj2bAbtGFGĴ#c" gሤ,oqpWz[Ϗh:[ L)a&;]K^;PAjڷSjϴi]SpAAK) ƴ[uX0$/D4*`mE"讻"b \1jPULzfw[CkM@ %m/p010e3n{p@HVX1ERE~ŚxK,pa5.~UI݀ .ԷG~*CvGܙym+wHU7/|SpUn~"cVVٟZ]XګP1|Oo.Vk؉E]#Z 34W>14KB7a1rHF҅7V#f*IGzE\.D2Jn'm<(+8r񼭬.䨏)si^0Btb3tN,)\H$P&FIdMFx˓z oMb[Z#2\-ax2M % TY`_̅O昆Ҏe=%V B~$qFyxmJոnkVZ8hrXy`q,j*`}(ITbj}520 %B0tLqr*u׬$e4nM=ke_ici5ONKǁ3GJ^q;#M%*0lx|{trͫHLjRzO'y|O&&l8$bOXWeHh'{k=0\Mh99wڌv(B5TRsSjǭ6<[4d%oxvS,ir,4 5c5STurRujC7G9n+o 7#µ-fl 9蚓1)ؿQݱodlQ~$EGmI(Vz6B( $;":h<ʇ]l\&bM񑤼4[E I+i Ҙbz.UT$@r@ !ځj-;֗BzaU:ݥQMT@7|0ՙhwkN46S0yʏ]A*.Fne ahi !s .%J6DR8܌ Hk%'APSjr&[G@Z{Ԅۃ@zN2nѻvqEȚ8# spD)0ٺQA +O<7p &$T-^{;uqDBPDňX߁Ȯ eHw+=w@bذA %ut,A ;R\6ҟT6PSa@S>T Ә[MH*,V4N-g&thsLdB KVJc oJnv` LmkEQA^xv;T؋`FH~M<щAv+ \&4| Tsa&,eV$ BzpB[H'_tWr#'hf'8'VlPz`NM5aݖdD4DB# $B禼Ī+'W6m*U9L M䙋R&[R;F1knL\J Ϻ&1 QNDj(osnCM2H2 "L `Ib i/[M _tg֩4)fg*\L<o/jeh~Gno[Zk<[`>^ dٔփ'jcx8 c@'ECB,hxbY 6xgfC E"80I5}%0tgY_ M=4롍dEr[νeʦeZMY]f5C8rֵg*\V$o8 ؓ 4@cNdqGk1ͦHA;N35E~"B7ߡ Y N\ma)px js˻aCitឮL8+&04\s)3ȊĪE(CXNeViq26 7,ȫme%AԁI.\1hN:EV^B8o'VRn(i<%^:^jSgBDTruѽb5%FV)בk:kp^1 &@K ȁ]wGIAV,Z>M%J^mS,9vFdBBAoL * j0%,VfF#d BǓ(㬧ԭ|p6P3BAlV#b8)BUqE 9ʒjC2Du"Q ~X*$ F=FQm˓O8] FpKBOZK}IW0qfe/RH"{V(ȷM!㕁Δʔ<MQa5Xl ,aXw 8_~Jmp4*J-fB:MRWE)ڒd'U(/㪑%C4hn$l@9lYfѡ'~5 "ˉMQč7B;uLVn[ٙ] :,وqdDըm3YA vǙ!-BIߑAf"8jaW5ЮQ̄+o,#0UQjp{vt|+r*+o1[QǼ\),C 1 d#|`t*5g-n5$("v)}XɊm%EY&Z*zr%}k"dK2P5yӎ41GЈɲ:_TU+)\59L Beӱ4/!dJRY2Ƙ:e:y@E,V?YV.DA Ix%m6(FZtXuZ,N\RjV\&kwE|{dGHRRW(DجVB1H9 !R)L$|,ojՆri-iHBUEܕZF(W*~Sbx9jV[x<va$V[c)FCfZ=Ww>Gl7hf:yK FG[9/3Tz#g]0aRi|4;DTAj$TH&)r==ӑڃ}ވ,לsHŊJTY͋6%8,RGPxgz:)Ma;}N(Gz3Rbʳ}V+(riXIUБ2LRЖU>a6l}E fOUĄ4#6Ivl>S\EXw"T4 X&x32]>&YUQҧ9}hA.jGݦtxF81.)L݋ DDt_K~2mDʆwsc, $-(樝1 gmc,#0:zxlzv\qBD-larԗKCtJw ɵ:ʕSJ|* 1{ Q( Hġ,Z4-Qkd +DFnG)p€\dF,,!#>|rT$ub^#fV,=J$|[4GduY'SDTW}6v#'btQ"c>}C <>D[qE3K^&lه%(ʶTl0'cM& PR8y&⫶-[lrrZ*B`(;tڥEKۑXe BwEvl8Tи4[7 bʥRF,ßMUfbsVJC$Ij%˛:;T5OR+,_\m|Y_|BiFL[&j-%f jR=SNu=Rl! 󊽰% Ա1+HjHv8n6V_]qBh^0 JNaUl$kPq&]y% Y08".unFK$?fH %[oGq|x+ qBa*<Tѿ&c/doIg\V|qWIw E[9Ta X˕dKF"m,"iL,-SW(zљV ST2Y7b2qь}Px5dELؗ!Ã?#%.,o2 Z%&>; Fߠ9AVeƈ3zEԡrY3*Aj`~%PUEjm9bK=(ckZflZdL 5+dv:t :W eHڐ")u1ՏU&Á.N{q:$cMDiƵ䴕"$R-\4jPCUե A35[Pj,+j.Q$Q@OfRa`6ܹ#jJ<# 1.syl+`(m$%@_PҬN m,r'Qr tI% n  ⷜLDYU~zɵtOibWMT}u `o[YoȠ\i^ I6yR͍ll3d $".ߎzBH3zHI%[[ry-Vxg9)m64n*9ڟdFҨO_THih#Kk *a淝%Rj};倲 IR1dDu9QRP ]֒ԧ%p85Z .=yomHz`CJB0]Qs \fIEو~{2efr$̒TdR{M!eg D‰zV޹1L{)i.Sy;oDhSq\ht΃F+ֳ:+ITLlRm :sZ)!jpI`㺅).]gpp1A)Eifsy=5zj@?UڕƝ~gP@|lG֠a \X8wU~!{Men6)X a"Nqz@ rp  4r,Ȼq24۝!wUE]q5(`UXvj\6z"Hc fqy"c9˽XVH-^M)nNWs/@UU!+~&fإ#GLf 1bgPrsݯu 7.еaǔ5$gSr 箸:ViO {8D1Gq`ӎ3Dq݈v#gJf&/ pIӑmW}0dlOBz/S{^3{rPrⰊBQ$I ˔țMuF0sX2s9$lĩc,*u6aP?NjOa hKtmn"A.°H()DwԳ@,FtAD*IJ/D  F]0%fptXVj`gl G&dzDu12bks*cĬWi] 0MyP6PN{ 0"+) , ^+c 9٥SP|?SZmVYiYThɮ[hn>z剉Â=>b+։})5+ &%)D,51ES; gᕢ|i2 &6-m`:aچBвM ;/[r+D Ww#c h"fk74o\#V^R 'a}0m} a  +Y8*g:|r-Xm5ADL([-],iyB߈}ByUmȈ1<)xKηn3ma6QFrwz-lw.o7j*Fn2G"p_eȘef1352$BsKAWz@9MNjv@̄9E4Â+]rXSJ羧?k0K{NYxuӛ}z:8\t.ðxSwrQ6FFh 2&܌5׬;w<,vmqx6 .<"S=@Ȏ P? &)v .exkM1i[6r]e-$,n$I!0`v wvkyfr% _hqo݁]`Lp`Jd}Ϳs]CA?etAx}'ҭhhTI鍔EOLf02dȁjrfyc>LKuy+(!κl5 E9Y["?M8N\+4qgb HϽ gMs<%pM9*"*(m:}=u9+h9}a_lsh (](ljjEb"P}P+^3\l~w_0ec0w[aRp9? y]%uǒҬ`TOQ6Ere~7:~FCQ -U}`u:,Ń'5kFQj=6]IWm1|OcYMNKq|:jJ 93:5O/鹡%X*@蘬0 0ԨwU:ȊgNnzKWf?}/_{?\ꪊ{8RN~dEyqnNs*5]W-O56]QCQgM\(p=RWDawIC{wq)袀ED*9g|;yޯ_y/ce 2.ZxeQDS}+p*pzNV;:wV^ AȕAݠ;6@,BP~=Y={3s D@?䠢"O@ PEň?p +A$Xy`,Ȣ ŠO҆{̥)?0bsEO="h$̊'w-qgheo|9r(֌)5u+p}LUnQd D3 * )0h4 6c@7s/@n^Z(JR~X2!DT# NXTvQ  AP5V |Ȋ 9PQyP\T_BT\\E8砿!Ul(qݢB-(dZJ N VT~=n 梂&LO뗢-(wPB#mAEjz }UEZDjE#PU=% ERbA~ PE`]ōPPS-y (>=8j)Qb"@與A: PAbu(>J  @ /2 JHP^Vq6" FD NQ'W䤉P)W\X5Uzq9h7P_օP YOi[7>Q(u+(W+=eA@S9]A50D"| :.("^4lCQ}?Ţ*q%DQgTʠG誀l{R@D$dPDɤ%[<֜@ǚ2\R3W]aEH)e(az\GaXc{ [qF wʽ~'<,2O..蕎(XOzqQEqq8qQEQEP (((cX&)z'_BX?/Q>wP0g H:x&}L_.{=Kki)Mv[QWn _o랗p] W!+Yb|=Onx3TE:Svϗ>L8"q䥐@5q`J"z.cHh$ Ӧa 7ɷ}bJR^dl<տYKgy8Mɜkׅ,% : ">P(! v'9!;">ѳmKa:!lX? \Gձwd`c"Al(#7=G4@  a#b @TU-M2" 'Ɋ`Eˆ `rP`AS *AE hC5M !O#")DCWDPJh !:(T|IbPJ">1'EkPGO $_So+DF zF9)1;*,/L~#qmSz4/auZ+u]u]u]u]]]u]u]uW]wHD@A !>RR Q`3 "Ex`<榒X:%(_e9RN3'*l0vk xP}BRR^sV2GMKofM4<#?WxrylՀG,vd P3 ffZExh(M'ACD@*Dޠ|b2 ? 'M "ވ)oL+C E 7^ = //Q d Kd>];{?wgpuMF[ |x8n}$;}zlusiȈ cC?[@0  ;uqMSb(q4E.TeU2b(&v"1AD40D5qE beH(*p@[MAE\ɈL+颀  Q2bDPrAڂYf0( ɞPwjD=zD7 x#@S=Y=Dݠ V"\ɪbRAPQALXADAS"(+*&^g %b*[6DnD1 A1b)51a~3Dě£)擴"'jBZ#-rP4H$PrFt x w0T"DDA.EC qDKp(DEDCC@n7_ DAr+drQIȇ/DÎjX&DS/+1c& MNE‹ʦr-ʥG1/"..,L@Qƈ ALZ \@[1^ \dRGvT@[ W1CrT `Ȃ@ &vA~0`P{985 `cy޼xv{N aCe.@sX^rAx쪃_G.() H.NZ$Qv7 91cobԤuQ6PWk\Hm9X-Pwn.j3QHcS]PpO'-n;W3q [Ȋ;"{&DiD;CSG1qb((f J"T.3ALxn>rwx3I},-ow9>li(hkK;EP3q50M4G1>Q]z!HH")X EP.DGs& z8^n i*T3ԙWT\\D :(AA3|X!5[UŊފj"  i!+C] lCEPP aAj EECE"QD 8 A@f訛H S& . !}uk` x e*nZ#Qfnhb9"fQt\D0 YE Hh‚c Yc@%衠TKu3p30gAs¶݂ • J?dāL[&8:Ϊ`QȚF%+A4@;DÊH*P?UUu[Zv!88U.A41C&(l=n<>;ρd/7pm,p@\&]TD0((UP\?DঊeCә2^Q+U0s8-fWo?|eS&+6? /E]A㠣# U5rSuQ_yQ0b"sAvQUN"DKb LTM@\OEUU8xC_E-\q")0j!C-Q T}YQnG*?aD^>v@6laDYK٪ٺ(i')!ML_’QRd xh*cc`пW⨝N&bUzNc?we_u;>DE j*l*"` ނtp |YA`qu_ .C_B ]ċ왨dbU|@;ȢPDb;(MďǁbrQ?DOQ, `<4G~mtp_q"DbARD(v <$p"ʆr Tk )s\X/evϡv X~oWlj90M$AU]UD @9{%aJ'ײȪQwP1?)([ {=ꈝ@3pU 6&TW$U& gM T"v};(#qA:#E XSUEA3Q}ءDT}LS<ì\5bN `tGGTxxĚs N"('ql(v"EM(^Au0=m~UT47<D~\ C Tɇ3]&;r)AQA n";H5Q`*&GoyjQ]& qW9A2Mp1ƕ \H7}B=@t1Q9Ȟ"NPNOxTz4MD@hT q@|ŵ<DZ'ł掏%&{ܘ>bX*Ǭ*uM<;X)AX'%`GKD8؜ Zp1G‹88:x$ D4Wo}ZЈGbD}ޘ3li{ ('#NA11TgWN'IV:({x(>8QoN3N(>^L*LAϲTNzP*!>z'|@G=:nTZۜw9Hg+A|}-쨮Co{ gjh6SO|_j܊'Cy_]=H>D9w/y}=x{~w]okD3G7: xpsC>-_m6_ue Q@^={_ߦ-SKW ޻sCN;wQ!L{vͻ`! x< Cā7ۤ?Cb9;8<7TP> Dvo։#?Sov9Cy͘CEG{z['QhdAsS}^Lxyi,:{@N'm}jy~w/~p߱^;(PE3srbI#  ]jxMsv#CZ>_` AV՘^_}8 [Oi"U2?Z&OD+wo7+nxR?PN.j Cl(0bN3ފʁp5R}⟹Rq# DWu ?n]/MJ@zi^ќv/GL6qlV$`wo/R^[@ O+.0ӹc9* i_WT# ;;y18G&qIֶX rLJaf~\՚_R w0iV.%<ṹA>pt ʃA#I\|Xv9NkGFW$@'Ui5dπ YQW^ɼ{f9_Ŝ\٭M<{WҺoGi]xL6 !xagQw7oN]5 ]?PB5qrTfzO,vm6>ùwqDb/ i0>zIDV^5%jE3KڗwZ ⹬o.47]Ia<)|ZGE&q0n3hqG|C$ꜬT+ӚüGDTk u BXA! 2Mg !"Ҡs000p礛߽OU3^T=dtqC 9){Py8 < 9sca o/׺Ͽ@fK;B] ,T7@PR LF2&G!;]W1xN6M:\7eQ p%Q 7Mvg>l F!?Yۡ*D*BT ~\q@ gjs&,C V8ys/YGL4]&O+*};PA@1ٮ (}˙,p90;%g*2IP\I7/,;J ?›rNfTC y$iOړ.V#HC.UplTD%TkBPn9aOfH x'&K=!i *V:Qyd7?NIDq5I,GOc89E/}$o *^<@U6V"3Q;87)/)a|uu=ｗs6G&*youXm?s/V:ub< D09(Nf8aX\gd  @m;TWpbyȬmY`@ ISі ; 3 0-2Ej`۹#rTL:*-#8'Oglq9 ˟Ǚp5G*t~,EÉdzn?txIAܰ0#Kۙ @~,X <H\m:dKf~{?t!A9 ҏ382eU%K* bO]1tN1K5VH(`44u? #qj&.fr͂w;L$Sz {Rb,ZiqnFrP{A2@9L- JgV]3j\baIiaZ`0IA Q.Fh4̀ۛlE܍_d۬IHv 5`@ou(mG.HsQvK4-{u˭op'k"Ӣ?3xSYSHкo&`3F:@Ҁ䊵`cݯхrfikN f@0~^WӏW2Pu5M> вL>w~A9"$ `퓧wSA 5٠&u~ՑK 8h^B7koN@6X2J@p 4hq7s3OqB wewJEDp;$Y-nN>TQ1} £'\''vj(.֠D`vvrv{07 "wѢwߟoD&k.v s{%=ks -qlt0|5i}u˭ Y N=w-P7Ig6xkZOO ~ g^Ű̌Zlb.|z)cOysdOoI0~o߅vP)cP'ݣD] b4a,"$ @8e0B6ܧgowC93e,额'+m,n.i*}= wpPĀn"D[( X蠎wT_oZgYKa:``\hA$$V9ڃF"<\UN\mdNtgos@@F"CDpGBxc `~p8HsSA }887q{8D? C* &gqSwӜh#Tf<Ey`up?\?㍠b?'(D?p6r8s:yxPpQl xP7bGmx7U~MN&ѱ1 𧪀lc@" ">\P/#Qߧ<v[:{ho?ʏ՛C*'}; u ;y}ݭDzX Pxh9쨆|w0 -Cʋu%1GD9-#uP`5o=-86]CO+ju};]ϼ洔T7 =b.bwjPb=}=λmUG|?n><&y K\^&vr{S׎܎+&dO+ 6e¸$ 0Q0eY/\? 41\O1b`k׭zG/k#^)b{(dOH!cd|mhȏPb qNr| ijsĐ>\yXA9*|C7&'K;Q4=-ZAP9!}ڇD$M g90;(?NqQ"YI*96!G\e+@;ᗜBN!N9I7v1R_w2acz{@eN|0b$jB4h0u0Z"z5} E[vdS y B6-wPaKNZjv_'O1؉:N*\㢝uCb\*S@(آ7@iUdrH!cH Rz6rڂ(^A6E=$APլAP8_TDG&j WTÀ0  ,<ơaM]TEЫ8eOXLװGm03lrGʪj)ZlL1A-(=9b3'&l-#6A"QRԧ Fc"nUV[*4hr&_Qlks\?Ua^1:[OƩoʑs*,Y6w&67gr 7,ȳA'<8%YC(U^F(dT.@b('>A8 ALhD5@⤀H!C1>{JE:HsS1Gy9QNkk+WqC+P M*؟33A&'"m* }XHb(L Wi"/`*IdPPDUk Q$DdQM*-"DDTA60,~hgP"\*,DD~nGߢzxM,h,!@&$FDAT0VP)<` ! EC X"f₨5@,  #$TUARAH #"9 2(H H "@T=4APVIAdI>kA$TdDQdD 8 .j V)b) "*HȪH(/肀qQ5 D.(LD:XuغlH[b( qAOň %*<C4p@\h7U@0%Qg( & -&|" `$CɋaAӂ`q@EDvQC(`&,UG]W[[_"- qT0" A?oD" H` *EG*>;h |)_g)o'Ċ!9x q? b%V D0HN0uZ+@ ,>"QoAq"'o{]sW{8 ESE`(0=l@[j |l-m>@N-BuFֆfv#C*`CV0fU~p# 4T51PL:/@˶_&dI7z_ ~h|4YGӂlu9LNO-DCT \db2ZRۈ&!Xz C hO}0}eQxSݪw1NB> I |=B|*ηٌC˲ȁElȪSE+bBC9tw"Ai Rr0VQB 4u[9r3qgy΃θ0qsqռ blS4$-;|!ߒ>AAk1lo 1] (khڭ]"" x݃Qյ-DR#Sgg sW7xiCT+JBqd̬yyS3&;H}O[ @<.n9D{׻O蓲b%0(J 6 ZZ/O(vƩTx)J}*%}.? 7XI]䷙)yH!Ov}/H"kX4Nds46UNDS'{U}^1]>O*(BS%>0ȏ\F5.ߦa@^oΤsDt07=uWhWB* 䕷 [lWcɛ0EN6ګbx`7I>?%kp=&~#9W̦1JG`_f-_MQ7y9⥌d BH*&f׶3nhn3U(V}Bz)l{h.,LmD9^?*rv@PWYSlHB Tl.f@K _gBRe&2껞oMwê1 s#ƹ]ftͩs!LN2 P)<i2#J#qI/8?/"gb#޽,u[v%-ͱ##ҜQ=_ۤ)6 E v*Iƻ;anQ3}]a  $5Xl%u<*V^=vk3Χh/, ~O;n46( OcR3Ɠ(i^vvp\N<=m(#tKHa=nh>h`;zP/4ul딶q yXzސ'ѱڱ8y^BS ٜ|-V=G<!Ŵr$;5m{&Xk[ڶNܐ7k5m'=M4nࠐ+:ʢtPHxߠvjwQu$@zi ofl. Wq&CHf[vJ'R8tl^tm/ZpLUrK8 iE2ޖNC5/o1Sra[24R2AB*VRζwVT2&>HDe +ͷ.Ž癑k.WD}yI=)P͚Y$ e0 y5rJR3kʼn*dzF4i8/8vdTci:ݘZv^ VȮⲿpc(Ahj .],w3GU={bA1(//6ҹSC9jSȖU=R2 .䴋~Tb{%eƥ6WƏB^Nؚi5Nln,gJ/,u` CH**; vOO!cRG+k8"avJV4ײ˙zM]/Y'5n"9 7JE+2q:a{&JvMĬJ_e1xOKIWG(Wuo+vQEA~PmdAmjROK0H ]R eȮ<ɦ٬ӧQ嗫J=<%Yadd&ɌĿQZ\f46m@ @8VČ0 o[w|P03Ì$rjvb*+nd}*b%O2Zw4Kg LX hj'N ݘHWaeq'(@M;Fcjb63l%/ gw6Vd FJvz#}&[!JFc 28 o NdT`0Bhң]{,U<R^/zLDјX`u<'Ge7|w.Bcb7z ?e|:'[f8G*t먷Q <-sªϟzfÑ/%@5 )QqB A@8L :Iq'=Təb3cTkW F 1joױNQp)!*Bǭ^ \,qrC *oA LyG)lVQn:/yz>VSV/6#/[`dZ>ټ9U#};+݉^o ->Gmc<ӳF+fқkg%y}Ǔ+lJ?iӾ4|ʧxTBdI*l(~'ƐEl8v]~Iep<)-_[PxNz]GC=[OLcehszٯOj s΂lL~?\w1}6]&n3omМJn/VID͖w>O6"a:ۏKy*еR>}]L>xo qe{uŖjczt].VFo{ƴa<]#n2^Ֆm?)wr9\[>cft^ORAt> yPݲtS;0d/{ K?/ \)r ;vLΏSckכ;Igi}?W9z曬Y)mc -ULcqUf0~ *w?&Y[K缎8GPEK.s_$?gIU.kg} Wק%]ׯkuOFag|$38_]dG-'[mP>ۼ`+οйE~z]NC?l-E]e<[f)'oJplx|x.ỳVWKQ~la;OVE_ƞ}[l#jy1qx-vTNPy]g_g[ԏvA,x ꌾYKsi_yͿSh'bPبT4_I?ʶ" Ϗ;Ϋt[ݤO *ārv˧{oΛ#4;=jD`⣵(飴VJ^qC,Mu{:zo2 9Hjuj||~]^oOnUz}'ۏ^k81֮I\]]K0AMNҠOJPlqa=_~>Nl Bp gF# KHB(c@  -`Br 2l$R6hA@_@H PԟX' ) ^Cn,*ZISqIQ3:M1Si_&d~%~3)߇vą818|G=b/C74!\}i?75Şx(˟ .dEO۰2gm|NQT;zE.r{ |$󯷀1!4f?Ƚ~ ^z å-_`;;Vu > i^ځu/|ײ\i˷A*1p-[rjhnhx9 !Π@҃: %]ZmhХoTʄsYt_鋩(bcLdtn'իMEaCbC IŦ O5&4"|v͗coMȁ .ڍw!?8@&)YB I$'d%w\J.P?Mt/Kppʮe_TN OEGCo[j?z~uoWCh`Q&r!#iseM\;^Ez;~7̐^Qpi#+U`bM.&c#sS7- Ξ%LS os \+h nJ9es>`Ay9X5Zz(ϴ&N0ѷ|WHRF/..kE vD SȳԽD7-s¬'B:{XWT " i&x}FFf zdUqrHԆڸCAL%E!D;KH{'CavˍZuJiFiin-3c1;n^XrItC(2FyȠ dHmNR16VGIlڵtw>I.4/`Ll{Q!wDp@ ynT%!R(M"% 4`Ճ zB$! ihW&gwrˊQ2 PaY$V|j=jӻj H=Cs+ @0R3 ^U`(TMiTɤ06Idi5{;:ܶ׍ge%(OHdh|ֶp Q'a,b׳TE`S9tΝGF(-:jmh$A evGC?Zda(Җ>G# jmtw8I 1#Y"FA%A-sLH SS5XR'h._zfr&еi26)STR߭G (3Pn,`6.59).uKMPhQ1T%t UGnCkj (7S$\AN!e_((2RʄL&Ў="KvrM%:{dCLa|6eE 9VL 8(@ӆՇFve\9a.sMLY7 Q,"7Y:{͙ob{QE컾YZS+ ڨlr2뵶;]om2)cFH8xK^I7q!Ò@8`zlo;FA7;9jT_\ft.Ai ߌ7*Od$―""goHz֐TJVR+/uc \Gh 1jEGlVS ~Nϡ.t.'zM8d9] (:lJm+׼M;{9w95 @OVu4\(+³T ! f*1DE9|O"h59bH+URvnB񑇿,ԺrT,Yi/E2p+;Yg^2$LS$W.t00Arڠ\Ղ&FYT R1()q; 9B]-:uT]u)LXܗYUJ"-  Omv;t_BnX]S=k %/QŽ16h#|2@]Kw~-.ݝJ,C%"+򏹞&awXN/7f|'PiʱU<5V@Jڍo]9&9eǦUR^yQۋ$LQ8|(ק0uVz? I~!/R' |o^N BXA(st(4-MRBӿc"!Gv oON?H@j ZzՓv e2B0@EF!K@Jtѓ VSR af`{/,nCI={2%2 &@% M3L7O[:c"񓵛+sQϑ$H\pyy\?u,쩕V{{6]vl8! Ls{YY.MZG]|e#2ga{ MuF"j7.BQDd'`"j>/Y9 8P/{ {}ը<q8=~;xyhAU!T6Ӣ3Z;#/FmQEBAO׭S~ǟD/ƼեC|(mvŷتQZ3InU]=ruQH,2IǕ#QU_Q yN @Kc]h{};bfQ{7m~5R0fi@핓-r C JRhּ;}IǏ|Z}j3Uiش!ćErCXtBfdᲖh!Y3./֗TQ |vS#FKN25fK+l#./sȭSؿ д?:Vݳ`֬.|8܋*D/;暏A^c\^-xAZe'g9r?r+TYKXI(?{dFጱB0\ѯC@О\Ï:u86t !tS#(unNi!w4{C#zRAHc sOzb:05ktͩ8HLSIX-E6f$+ =&@Qdo^PkaO%_ ֖.{0 ٳ9vB{Ŝg*Eg_ShM=">|sa>qbvda@u0b7l{}sr+Y}~Ol0`sYK"a/]Ir{FP\<B+`P T 91_!TrZ`).Y~bɚ%OV=u'WIeW^mXp&V'i2j/" L1J}cA}d۷ 7%W9=/-l/=h,pg D8T!myi:!]RR(U72sGy.7sנr'[%HuD%knݫF|bg) U =L'}IK=4D-&2(ԴIy;qBh>Z}o}OO|xr?U{vSIdTAIPR+"H)(\BxM!'+0_e j읅bŊc"O=|?5^_2ЙJƚ]nv gZ_i&`RgřNR5Qfm]K$*|ÀOQ;E6)l]8 :`"Y 2uTf1)qeF40X3EbEW*s汱?"a =%Mm,ʊL;!I{ a3(Ҫ.E+۞k>7/ܴFrq9@Π~.g?,?.WXp(zMS?cv4_&x6r}edz bFD@qJhqG!E}>u}?MhY EUdF/V>kA9"g)AQ$iXYD~ w/5+uqπҝmTRYY>*\̔v_as}?n4VNtAt3(.3 3"|eN|=v"E-J,0r~}OhWh'FƲzn؎ [R tXHM6X ͘hLQZH7|Kbds-K& :N[qy'C4P8 6͚&Ma1R#"5D jJP ě}_c\bxC-UQyԀY8/jC8ڛ+&'VM_<{T;B(j' C_]|<}[J/]tQI9 A095Qdػ8⏖u˟U:g90S)Z5R|u3Wc3 Eajf1{ܮ2vYwqSZ5ը16iG{bM+B{_[3V%t&T pg!H IVhX7ID\I-OG{I<8u v !XE!AdJX,``;2bArЄ( ABcPmB{nJP9H)%! IC@ #,`s &PR d$!dUF.]~c?j4z?a &% ! XXBWmSLU(٨a"idSdRA^oX[*+9j*w?vMkmƉx/=ysꋷd7ejbE<4ܶ-Wۧ!m-ֿtFֿ(Ey4нS<}*1<*َ iz U `,( ;,Qaaע5 ‘@-m+P G.eP{T6AH -rO56*}ͧWabZJAm!ukXfE %  D =jeU,;(WV#mxp*dܺIu"Z: $b@\dHa Ք6a0`e*RM@4 X d,HI ِ$dlja [$F "ȊH@(ob E,2B*@1 ,5޴ [I* LmM ,JI$@ T$2(I  (H,)!XQ I ocq$f+ $!Rf IL iC2̀ggڍ 7$I%dTYm\gq<ۘ*mx#l9򆲂Hlͱabeb)A-ĩ"15WUہWA%ܴrin:c3Xml da6S ƖnfC0\Df8Ϟ⳰oܴW".e4a39͋fɛR败eBfPimS,֏ZR̵)bdƉ&FT6越w2\CY(Ũ"'N)ixX4COma,aZ[(mluN 3(1eTVq(2Pzy!Eo.>%>Nn% $([`W7Ab0 eLI(`D5 )&K!r 5lLP,`).\3jL)KD)kՔdI KP(L}lliE)J 0KL-KJ &)i\L 0L(JEEm]}.5fBquJa30ɆXfJ&4m\ViѷW5-[ffe2S.%s32940 R m̼ teR˾aTfPLդIjַRfkRJRDXm(rљv68!pF@8Rfaa J)Et0 &Ȉe)B޶`u Y0h2 W D iSjRZf-ݚE˵0)"$ڒ:k$5l&Ppe&&dP`aF01 &`Rn$H,!FK!i@VAC$6u Ժ K o`X!M̄1+&9 L"%1֠ 2GTԒf vVmI@хMX"25)2PL:ѢPL,9IY#4PцB`% Xb˶Fs K7eŒչ%12XJaRS&lㅪ>=E4f1j7V̲aJal7t Ն &dZWk 5lb42၉- & h5ňaM hvɁ!l331u0nfLn;)x4h<-l5J 4؊jE*ͭedl V;Zi)[ӚKmAA2k&k6 I]5hXZfm%k "EI3(,EBe(lݲI 1 ) Kh,CH9`s PC`)FLbG1{<:GOtsoPzPVڈ1 D`F$"M`Vw%Zm%AADdRc3 B1ʖ:.i[ڌibXDтem\l5a+ZGFӵ(mj#RXj2[r(h8Gpޞџ'-;)*Ч>aJYm4:«[j6-̩ڎѮ{]Fʙ.Y\ك]Pm3p60l Yj&&&a[ef#3.˙3-XZ%cZpf)lhfP*̈[u5aQApKl0孲TSTZe]Y 6dAdձEQ=-ۉWps+fX,Ys ,榰kq.0jk+b&αJlU]ek\AvJ (:wίw?ͺzNKQX( ,)YZ)1[TfA+ET^rZX! Wכ78/nŏ- (5է+[hEtwM)%n%~q]pv껅T\ JVԆ2awPm4AbׄeښV.p(mDam*QC1J2P8p /39khX"k,AEۖpUXy͘H#&E"a "*,V606@B CVT;\Bɸ6jjǙ6Isg HG.%a*Ň3#P 1J#R<8ގ>{783abcR,VJ,8d:`RҫeEbCnɬ,X"Ab6J >:ɻ1XLpXj"Bħtj8`07"ԟy9!(3qbY 6" 1Kw$m((YP "p=&zGˎQ94ً4v0Cko&矘;Sc"#"ߴ0" 4"_HȨȁXk&I- n]3s-IhV](+TtGڰ; |gو3L z pqO` Bw@y]eT߾}5ycR$Ъ~wgֶu_67Z*cr2#ʍ`QJ.ap"^#8xD'2$9;0!O⾱#|<"F*8/*&U&뵴 'xៈt>/>xG~Z{*WB˚!fNSLe4CP5Ga}d0(PGW0Es9XH3m&3N˷ssxfVhHƁ(JhhD2ى*C|SzNk!imۿߍnt ) WB4"з;D fPutWX5V3;$u` &j_BK#vQ \8PX`£p,GV.c1&jesJ A wj<=u © TiE~2QBP 6ט2FHij TA76oOMv[!p.@]¸ ʄvP8B?Z[w~1kNI"AP ||8톳klpwzrS۪ZƆkN-V MaRl" \N`@e.޷y6/NYb{ b̡6:23ʢ߹zc;~17 d"09eb L}1z/\w)̃h*k"9hSina\rƋAERE/d(4V#a1&!IUT >EXq`Aw߸n̉v|c4Q7zDT!Iuw:.>F#W:6-^$,6v&ӹN&9|+XQy&ύضxdݜ?] @Sňq$AEq&A.ĈEE3u >#~>ֶFAIH`@PEJ@ alP(|{ f̂Y*Ua= c g(D¶S}NIU2]10$.BC)EB6ҁ"5blؒ!EՄ39^ۢZdr>kO(fhl7?ookϠNh^ :t M2}MWlCvIDذra v16,c#okiɛڽ^_i'1<ȳ_\\Z_cV %CY< dZAǭ3U}>;i˛?h T$۟X]>׃rjd>Hrm0"IZ nCh =T,L EzbE)2òDd@+*7AuT0/Q@ZBApmX*IsDsadw!7NtUaP :!aY%BMgsѽG2BJyVL$ِ$b) '7!4Hd@t'a~AK ((PD-ȃ iIEqkA)|V HbP"$ɀ4!z"$gbTQG3W֜Ot;`\9E[ݤHdS{(dBJ r3D'=umW)j1߯N|wC>7 1r}$r3nktiƫ>r Vbuة%T 1faqPLx\h?0nic=@"3v_11?kMl{t/sNuM5CH~7H˳g_V(!= |ε?qI䝧 EلZci+m2-%mQpH`JE$+Yq"44" r&3;brqbh e2IKWn4ЬǀR QG+mK ܈J0P" "q9oﹻpM[`%*bL#7aeQ${*IWUF?wTN=RYU CZ\x~Ni`aiCITIimcxYBOI>ݓtR"ML|ÃD4 n[J< R꺝̙RKN10f 5/iG[mLh]~ 6.a-)т ԧo5BG;{x0/#QWGi&[KU\x(l-b d}ڷ<6'U0LLv] Ԏ'nSW0;XwM _=H tND9"%U^V[9Z;rA.dB !J $!l㓛j ,FM~^]PCpZn(עߪʎZ^'7r2"6Р"("mu<-D_wk$-l0w~% Q " b.$%>#5 CAoE θUE0r~x9eE@ (-0( 22(60KJ=Br.X{5ndR-IP!~YV-R0kP^{" [iKÊR* ݢ@_d_{&&3gEgtIW9}gn#/sS*5sl``H$MUcbkˢ9UՅgXxxx@Lx݊S*䘅9o#/95#'vrE,n"dRk&0E#ij|z]֗ (Du{Z\vW'a)f>Ő ײE=L\ZY8qV\ɛ4p@R1)BF#qO0:E+URNL1Hz*vUAU B8i_ 8E6AR\~_.&8CH!miso^o\O)!V7-u'`4b(> Nabn~6 _<3(#@-7`i[(&,)JD[V(ȍ>{w' xDB[dyk'Ǘ^xE;\/k#y@bs{ 9æ8¦zȲq^gn'".Nɧ$D嵯q` @,Q40,n`2ؔxOA]$!"]x2aK 2WMn;5&fP:<ͣR'(-#eJ~vxbB8QZ||oZRg?M΋a*+BBJĨ{* g3`02C0oL/Ev6ɡT9rvpz|Wg+L*02,QIyh7"ڑÜsi}0B4GEh۷?bZ4,Dw3i iF=<Έ,{*T:M3rCB'#pq6 燞$e^̆gT_q핰QE.prɹm&3pCX5ڟV OZڛIGJB]Wd~_ھ5muxuc2eMY&)؛BՌ1 eyYr9<%R*f;,ͯ|*▿G ?qW?8.W`%i5<"c$%rf!lj9T|j^gHzV+;H S0#Hl? s߳1>eGS/];zop)y@x.Eur){]Yc ``#N犇rpO<5lguNh./BlUIf~G ̼+AJ ͂wP k\EDUAP[7C4(g!15/|Ou[1I j壜aIAw{><'#bxn$B8ҩ&'њe_: 8^/HǡgmOpĽtjs[N$cR-`}}wa wR_(׶^kH0VOzM߰@>sANj8RV( BK_C&A2$a8M`H4P3﯈57Fl<5ja 3Gr*$l^Ov>;oQqjy{*>S"[[uHi ⵆtM}I1#:Ux{٬MpZ^hnPQ~>LG{J|Bo1=c0@/,QAL ;&GȪM!DG AZ) |VD7,П tA~~4^l$0XgU>s1?{3[oK]Ql/8a!a5Ȉ^i5I=tP5 Rq<ŰM29,oX۷,M0$a|Z(lο |s|3tb8E]̼@pu1?Prf@)XL@&קYXڞa d9]y_=Bdm,:-{| )3ʾI1..!s) 9w nn"jFOP5)Aog D Jt#jY*ᇠAZhUiX7~Fm}y{Oi<Ѫ=uG~=X$$P\!Z6RB,GC# {1f/g8EW8bʓ6 r5O0PYX *{}~o]=|Tz z~rDM_5vdx!I;$K.0zj2Zl |igWjh4$]rBr)qln|= eUҿwvwo"( l(MkK?T;W(:^hk}u8PhL( QkZ$TƭHEp #ö2҂!lUxx~J4[Dء"/eoܢ\vNs#=U@ $r*Z" EJbi1w<}:܏C Y6B6m9.>dhID'P!L_>,K2ѐPEo@JEF+f-,mLݬp Sbo[׫QN),)tʃEwBUѨZ6djהI-! !([jZ<ND  5w;hpoSSb=5( Jٰ-j] QQHq`C 6MӠ*d@FPAP q ]j !R5Θ?"> `"a\TQLH6ȼ*)*c8@IJ\COT ta{X+džaDr|GN *U$$CInGxgs*MY; Q0$@d@W>"[5`(%:簋;JC6K?oa~O:.[( 0WTXC6t{DS]x]O XMPNJ~l)qIH<_&s(/V֏a>Y)l< um!W!EPT+_.//D˟^{_cE#Ԋ R%"SbQA R6q܏9 Kl;VdP =E# }.|H1KbD~ B6E]T)3("[E h#"S@隩] ߃W EjlCh Ffɇi6P=kٹxD=\Sg@@H*zLdbE++ ƇVy7dP=vBi|@zAd $*$߫^!XgSfVޜ d8/78j9 79Wg%Q#b?;fN$΁qrH,/P)'gZ0vP[ Id)$ BOd&1I:R|Z;h{$1B{FBi7M&YP'h(it  }6Pݟ[`b)¤HP1&H@VGgI* P=s[FQq`,;\gZVi[&Ffa4NS;k?=G=DvE}'iF;& _4𓅊 5a/4 &0^}/+0ERhR^p;][-b.LPP:,_c()0- "A%*Q)H-``Q5n|%": n s6P) ")@l*,<1 VU ib.>2ʌ2'1vQi-50LI#TUԅd׃uy}ee,S]zdy?]yj#F)j͊ϋr ͙8=0e#AU!X- =ͷol, *Vo_^bfr$\z܋ V&$˴QK()?׌m 000)Z|PkcM("zPR7|DFܟ٘zǙKڗBCo@ٔH^`*M/Jm@ND$0jh8\(qwn-g*,Qh"_fh~k{2prw|.@ wS4۽vrx2"\@rX$&/hO-H^ҞoC\E3>]ZCʁ[ЪkqT"JڐZ0hxͰgϔ>q~7dz[((fBBa"VU#G]2ȗ}i|RH0sMifee!5Ǖ|Ua1QJRE{\c-Jd[#"Z0i#x&UxT9.OKՈrG*,@u8WnۃQ\a U!vU\ hރb(1[fjsɘ M@+&ViM~K!j :WLcNgIT/)1#+"lOy:gײvutӠ :v8y9$4 ҲL~/oOoLNg;#O B D`OwqOCv™HCІ0%-!.D >O׬jW}fe.\/xa[T8\QkVzz|&AlZ@c.&]}=Y`xu3S}~Uo{ظ$J*FWX&֤Zsw58&'c.gx]nosxC6Q6Nʐ3HQMV7rBa:/Q)\TiX joz_.*fkII0B{rU`ép(-HGaib*>6izS gKlX53/F1 ybOjV{X < Ѐ(.*jb$[ד8>쯸Q6 uC%V)t6TݣR4K5u+4FkYp/;"/l_jp5⹂ʽheM3 (T"hH6'HfC;<'rRKSߢ8wzu\c<5Ң+3 s;uN^֟cz7ak}z§UnI])|e("Blg\¡J.1]-)tʥsL;{rZI(iikt)=M!Bt͔4\sBEb^@M%qPF4"1u{Μ $t[_UGBiJı dƷ.uO &mZ6!YA<Φ3] n E$ .yyaqjG2}?n%2O e%凋^=^kbh~R[%BiۭW-`#=_8ØR fN{ߦ~`d8=Asc Wu#OWL"1 :Q :Ok#-*֌kv&rRT%%:.e= +Wf|؄A{HWӌ!:3uf'&+"Mtq16AP'y"E6X̝H+!Vnj?kq(Fj_3U Zʩa"/3A2 4y!I%IM*0rc˚ Bn1!B;wq_.ƾG!6~[L>J/wU#ѽ9ϐ`pp֪QXPtV71?J91}ʇo.9 l$h0ȑ9#2>B+h BY{. FݢD` DK`!D-,N b*Hlxj޳ڄ=O/w! K>%\H@8o7pTހl#13{#>W`ox!ggx5t!54fMBŎyV[ kh.䝶-.2Z2"oߝ AJ^]D~G26&\ZFO$>J_h&0J/4m $7,/p3JT߆TjP (읙LˊKU~Hq~It7,db*39.ګ;v?fGnq"=.ŹhB} EcePAmrFOhT6UYSٺÊdEaC~܈gL^߀j5Y7{_"D=lj9ngm1.חBa@AQbBU3 tgKTOM{]G'ImqS!4H9*J>ᰒ?HHy3HusmX O:؈2yb=((5G0.@`S3"mҏl&x4X ,2'ɇ֧u2v {V[@ߚ)A 8c̿jO=(PUQ)X4k3 ߢ[;)jrT=gdߥ 7GRvTuņƒ쑎Nin%e4A]EA%oi*ЋeאRS3grc g!͛" )xf~x0{'YM G?Y[/IQ1S{[ cgSQ~l^WB_CLxUْS;@+1{pBmJRW9ʴPM9 0-05Ô 4޺>6Yle5|}73@P)*b1`D ϟr@BA_eK()!H`y| Hlï9 0"nEDʰR ( + H'ZOvhGCwudY]0V?3OCX^y1ˆ@ "WK bT{$a,EƁw +Wbᐕj8-D#.,EU y9b7D8#ȫ?s{LU}Ǧ!8rt~v:!mc `l&$ oEIȖD+0z bKL&DTlH!I{Q+_EP';57淆-zT7)!_8ʹ)(hD}sd:9~nI h>+EU&[>ҏdZUKX}载zQ7~q#-"$BpQA iR!vK$z9#v&ψ.DhޟJ@ P~z>=5 ΢{Empvhxc[1"KG"jF#)fp NpaM\ \!԰LWW03KnjKbǁ* ФnұG7{¡BtCA֜}Y֞ǣfmͅ 6:N+[E49#4FwO';̀Jƕe4h^њ#)L눵Т=ogRyGM[1?ɞ3Ͻ8$o$gtrriWfR >Ĕ{Áˑi˫oŒlx l ⬋PO[Q1Ps)ߕXp>OFN=|G_7L$8>rr;@QmIp){Ykl8/EIn7Q[mR0'j$"mfRԘ=obLz9^I:bhЍtae *ZX~}pNT큷¦~`$N&^v76@1 |;OZjS& [Q)ncq0(#J V"ӃsmmĂ.sȣvYɵRm+:n *pI;QčTDuo;˔U|b!sBD ^_␓yQ+T|Ӟ7|&yqΜO)Ӥuo7_;[{ݳJ}88V.(4nByqoݗm6JQeEEPz֨۽0ϙ,`:&u]Ux z 5~QL~Y65n#/abf)m)adUg3yu]P;Paa9CnTQAlWvm6 r% ϥ*lνW3fw$ CYJH0KrRޚ\.#̓cG: (ŗlLp{1WG"*I E<?3fw:ŒAm *L\mse^me݂L.z1)sIif94(lh"R5=T=udqzLxʵ1 Z:IJ̃"o7*z~a͑ 5#>͚7%VB9TǾ17PqpD+ungd0K"0Id 9j6> *y\\۾;};c24?ɓ;̃r|+w4WǙoo^~H Z8wؠ!UFİ_h|s[,Z~ nIl)cļRe9WgϾڦ.Ȥ;=DN-2!dZfuթ97"' vf?$;{7|vOG v#qhĮxx{_btD `9}9af$I(E,0LF" +7%]e<ݽ^ǀ*@nEIઆԾǼ/+xќ' I Q2lvgw+Cg-{3a@? @F&급"zHL)4Sq;#*ֆ|޾Os?QRDj4}mO;@] ljzANw#4x9s8iTzX,7ZڔH6c (j;(8͚W` nMY~)ƛ:†m#@CL mSH~ه_mh'Q/֤T/$ASTrS:|53i˾þ/ _Yn9T)(, "x3i?9K0>Ŵ!!Sw5aZ8)+'${~˞ ,),kh[ 7T} dE+AK46\Aꤎ6;wy\1<[qw6gf>yeI$h ^riVȔ;$;B7{$5v6 T敻 B%Ђ ƗFX٠ M4˓{gWzOrEb؞Ȯ SXL۾L4A0Gʢ˄JXb|f_KX[mXX۬`eר^sp;N a\љz5 # $%\"<<o8DݷqȻ2"7ް-ugcV BzT-} m]`W)PHhCQi%X۸BC3(1GCӬ(%ڙtޅ5e.pdk`D1@||Itc91ύ"YB5 |&$4X6\( \.d97qkWMs-夹범:M|-pA9ȯ_a2YKN[^̹St'f'@Hb|a5L UxN5€/YJdJ@s*a3.ޮOqNx\ n&1t F; QH\YL)cjּ^m+$iEYi?5EXҞS./ɵC.1{,Z٧Akg4:p  s2ߔNzF$g0]<딿1wrڗ}$N_yQw? 煺ɛN= FSLBV0<&(x?D*L1SuL?`}BTt0:% k( j%]`oHN_\}'0:cdU#[UK!Rw&E(j.\%jb.pJ)EFy H%'HM dCx.E>gb鲥5:9f!Nk)cx\_ܻ6g˰|Y=HH *>5p_rL 0l]5ŌM5ெ"V{$SI}wci{!\"r"C'i5GTӔ<^ Hc ގ!2:{X6 R_~u}`i|ή%|BwcR̞BLx;2=X# YLsiiLJqo Kui[aH/uĂ wݱv|_ j EͲoUyrུ 1ԟ=F-gw 4gpRYp y"U8A!zGW8u>Z5>`*&Gsះcuփ *$EsIsC%I9efl@&4u_NcL&2_#'ZmJ`7+e_=3sa`!7O;_<`Kn~̩.Nq;]^%: i0px\ֳ1'jc%ê.Rs ܛIb d Fǵ ?B#=i7>=[U;Zk= ]Ԧ 'n I]xs0% #!y\e$1~_ʔ?w7Q+d|VJewdkF#Ȁߖ+OOD\(zP'PՙM#̉OعnQN!͆%yc[7>7iqkkLj5ׁɯ ƒqjc9/L*fP9#&( =>N j)D2{m(=G n5./ #&Q2ϳ󞏆[[?MPUfb e aD iKv=\.PQᩃT"u0XX*oEՋ4ʛ&'!X;K`EB.YUN&:njfsJ KdvY<+ 7vs?Ċu٫Wy0ߔ/Wz2W |::/0<2=AH#CD!El PD3i =ZP@bffBnBk> zQiJ2⹩JSM -[ha7lV_TECMFrggSogfmȶ J*-?`b:֫DeHc$f&d\!gm)⦄9]d Ep)"HW|͂88l{cz>ΣC1g3hg;'DJhOܧT+ۭrT:l4vYM=}K~@CaMF# @y|Gq" I AV$!Q!X$0^)C"`*(xUOix\N :9*:Ø) YP}qAX'yɝw겞FͲb.1wAٙWYK!tMtkk?Em=m;Ζp/GCY)+r #, ԃt4io5=0W}:C%JEb.W@ʸOe@$u ;uѴT3te 0 )Swm/nO^׎5Q6>U| .TQ+}˛e-ż_?`v0zغjp C,.{쯄gx #u1s_z"~k\=5nb>]1{dڴ@o Bď7f7pCE*=tB}SZ Ա]h1zn\? j/97a=Y L2ID h ag3]7v=5 R_#6]m-z%~(P#ŷ(2t<0N;̻/*>/`_Y^Y 0:F@~o2RFVHD>V^@ /N\DLܣ\*\[Qs7~d {)LX*G_.yi}0⽬ iW#zGƞ/9R)*)+g6[ڵT>LlHf.NճŃgأk['Dגe(0incsuGFF=.U*.yƬ5Bhৎgwhĭޮa\FDCȘ?.e.ލPRv%8 X%p OK-Hi4:jԨb=dDRȠYbR"ڿmn.š"# ˋx. ZgIRvJ| iyQdSi@ǎvfX P˥ Pwd"#w 4u޳_??IN,G{m Uv\Ź,Әޕؐ.Yuv"gY8Ńřw ?&\)9pZVҒ [ZX̞R@k(0(~hՃ.w #'fa;3NbPx%7k9վUNGGtOVwk].SlC>tmi3i(lvōj<Ռkq!Ur|䲩JuVbEC6 #@ tfNy|zTGs2O5Swq-jrvPaO)Ee36kNj1(OE-` 1ƖzDƾY17j+f̔焐2 C0?e \ʴ:MtX-jWndE8HPn' 0"u˨X7Sw>kV=|̄j~[tx}Id/h(Z0hld&%[D \Onez_/zԴ'/W'9b\~^`U } ej疔.GfB}_27* ɴ+ /ʁnSϖ~w^~[iQ{fD!V"$8 E.2|Ax^P+6$ BuX"=[h`S`4!}ͫWßܯ 3:fQ&>ЅSAT2TMYH7fEˣAU9֐%O$j(Hǣ_b +{׵$Ib1|W~rEgD-Twռ"dP:BpD $ŅDȥ !SCwcM!0iȴ{ssV!+JN[Ҡ+o JZp8hLX'+^e|V7WOH zT0nnf- ZCZ;é7 @U(gS[jH#v;B)@JP 8Z"HU@Ԕ"@ &CkS0F=L%(X*1M#0\KBR(9iS(9s1N茀¾U6Dq 66XS~g6}VŞxL3tpȨMa5) bjC0)J\k6r, bZ`LLs22(AS!er) a s@Cy!,Hhm]h2[hNo+B 1diC-:\`Үt1\n]p^+%Mc sM4]JϬB߅PVCC6q"^es[ܪhȈ 5z^{uޮlY!"g!dYOBd5'*63ؠڭہWOuoikE58oV|㧶_il0v|tB)~X! tGw{?%bPB4y03QU )QTj@KafwX;9 k%;X(VY Adtc]P=ьc\{h4g o2*gdU&g+;gD],M9秮O )\}o2kZЧTMIA\F52۝{/{JF"l4g*B Oos;#(<*Rse6)C(ݖ:aRtjj1[)R@;ؔ9 nV0|f8odv m7 dU9|y~BA,yugAtZ4;'pǞ~iYR(0^'tَSa_󟇛վwwwb \({Zٔ}es$E D;"2W^&UN$5.^k?[.\PWe0]!Ol#/?'C-ubt  } G yu_{ D]M~zy{] '~Kg[>o!(H@LlKJQxK p|{k_ekYc.= I(HL<ݯ9d6ouͦrV ڼC[LԃQTAk{ki aD1}W8yVTwUydWMPq9M'aՖ9DjK7AK)?ˊ0+ :\E /Fnˑ b` W&fdHXR%:/Bs\F6<1g3-C VLhrO[uĺW3|-ે $Iw7XH˂/ʇ}ʌanBz2%}9V3X(!.XŜ|s⎆CRWG PQkt@5=1,SL[ YF|jOX2$er2K>~?\-HH*#5gڰh# 2k,mѐ BЏEaX9 PU A.$n3,Jjl1d!BtmACqgA^5'hGTM'-N !օrT`pkf;ͩ.77͗3R\aJ` shW h! VfoZ{AŢD7%],4@Igsx,Ρ~fkX̠yLB㤣 >?ퟨO>(Oɕʁ6M(ʟ:j^T`Vz׼2 *4{0r4FCuKNROTAHHqA{hVCP#-ڿdb"A0*D+u$[>/2#d#G}aID==6ыǐwu2y'a]碈6F8ma Jݜ%/=meEPFvߛaxÇ̫*8cYJ}N 5X!Ru]?07<ןI舿9vzEbX }lQU.Mq3_¹=ICcܔ(FŋS 1EʎnXl}//Hݫi+ZT"`Ͼ!RuڣRbDE > ;i(p^Iylek6) @U1F4h^ѦO`';;A TOg@ X1@ j'"?-?B[/f3ސPS˹sN!&J+h,Nuk@lATz `Ǯ.^٨1F؟c1ŕb'yTIkox_3@B@cKsr- |PԿ3MU'J3IVP rMj[a1*MK>cu(peDߩ<,HR+_%=4['  _s+JI"bN#|)Ͼ}k""ۏ&v;UKjϨ{>ǍZta:-f)l\vlrkAe}l֚Mk<;hNc~id@aȐ` 7W5.Xv?8 "py7&f$ܸԷSiP\,18CZ޼I$/IOͺHq х{G1ڑd*W-#nR&em#*D`0I2Rw;MD2aq@H)EaRBzLX7MmbX6)1 ]d|l<'>W`#xw_^EfTmG3>Vq&klZ%ܶ {|w 7Nd7 x{}z`K3j7c1g7!\yj MPY1ۋ%)>|Q(Sf\Dԝ؎fP"d:}ٚ_1B(oβO"B=dFÐ#Qˆ;]40mfah#eJZ+I:`0}san0%ƚZ3D% Ox,bZ_HziaSaMizK??c׳90=}Jncl*x<ڭf oML5ҋ(dB:n,߲/9uLGO._`iYndS!BEѸ' mt@A$I JB2^d  AN)$|Z)Mъse_TSA/e,=ف *tȔ".}z g^S"7b;sU@#$s\"f]4Լʹ LKX SgTIB6-R&9]:OmAAA KBI'Oz| {7kW!B .]}7>/wPA}_%AN?up&(>NJl!yay#"Xwm8UJp:ŬEhAɨFEE#ܚ,uecſ= 6[yk:1Io@y9 /dcCᇞ<0SD1e5ҥm(b,ϴA`~f+ey>-mv.@X<ɘL9u/ sniﱲ3G~KrWrai~thU(GDN PJ_ ?)}ضr7^*PB#`_p{I[f2ۗ<]KDŒu`c4, yJgвՃO3TOKV-RHI2{EAz|gLq{-ǁ|4"T1<+ZDÉư'Fh·K@w%ތ].kTB `Ig"vJl@[[v6>'ꐡ͂3-f_ƾ֥5:yŋm kX;5dQS8s$R"u$) Hi&a m?cNOxj6-yNXCKE\f(f?, pHT^v}f q9*Nh'Mm3ĖNKE6R{LS3;BDOQC# ˪ob{{Kݫ'12bޔ"@u1!$ DD {G&h _sMUj`_P˄tQGҡ5nUg:ͯ9mFj3#1jgwްl]yÆ?oC*\~-I~k H4 Nc;<[gO6Spv1(Lf7=ڔ~ֿT^VE$3 b k(% :mn[M7p`aAzJܟ 74wl)-?{OW\߇Us"O5,j۹olط~?% LيvԄ;Hacϟ\m86y,Rw2sm}pAb'z^,eڏ3X b7al.l\_rPwwL}ũ $"!y>MF7lF( k8':˄ <1=8C#Й3[':XO#|wxgNd|kSkYۭ&%W8£f<6^iH)lS򋺦n3 @\^k oLq&'G3SUTfjR&6'zHL)XWM!6 *4"VQnqƨr&.)>"9gL1+^ZP*9GGT40M! %kE[h" L@Ia&EӍwq^88("4Ǭg?1Kv'ǔ3r{Q̔"H(zQ $MFdr; 6Z*ocU {ߩiJFI!Rh6xNl ulEܸ#:nJ+w]]-ɞW Ԭ= .8SYn!0mߪk%'4!6~Spkq#%Tw[E&WEŧ#q[k^< ]1#~ɟ|uh~w9L~eհcvӢӖˉ.&˻wt@bŲX:* YI1\Q9.דۛK1YEɂH^E7Cvb0C3 @ H?P".O]\Z2xLsS%/gfCGc9W?$ޞecηӋ| y3qG`[/_98:?hJQ?C|! 6e*@(::WVhL @+ ĥlNvl}~~}f'棼oo^Ok{z^2 PIs`^}uH\="楬,~"<^KgOksV$aA%Q׃y_ˈp [Q9щ+Pt$U_bb.2䚇#Icu+5܉)"JRi5O`e<c40QɵV:`6E>\/`Hj;5wfSQ88ym]OA*z{Uؾ8`Okq grY8\g4$A"7dk=/`R; uDw, kԞ= ֙ BGw NyQG݌kPłTzEOͷTC kVtcM liWb4H%Ϊq93q vpvˍg_֒[Ѡ m5-NDⴳCgelRp]r1 DhҁS(PK(|_z4pcvy6dY"3QVPd"l;Đƭ;YJJmc<T^/R Q-p wpZPG~yl_;3Nn[r^$U! tHvb J"0&\}]RaؾC ۊUHo"E3IBlAC ;$n'r/cUhJjx((xP,H:a4!cPT^!X{c+Ѻ'`O`͞Ok&C:8|Px٥HDy󰖺OkynoD&HDU.=G3nR71u^EEq}pT$o;*wjb pަhz °(: 7Δ6ףˊTo)k2z$*a {.b W̋eCו`NYeK\Α $.X@B[ V5Źu4^wzB$5 JJ1 {Ne%jd1$)d`H,c=Q N1B5d"tg: B#@ltR+L!ǣ|OMꚸtq=3wm|V!D 'J T6.B3GZҟUX|sJ-fyPR'a|N3DS} t>=3}?'O.Y͸^K _SIWP K,;>gSe^ 2w8 ">oRl+Pՙ(*Rdy⩷C"w:)2v]㛕5!ç>#C„X0Aɍ2?6éFgiEqg@G9li@_1TЄC+[ЦS(~|nUk!]48bݹ[PdopB~f(ett}V_z|h~-{䘐1ٖv9-sҚWoXdrHQ34%W"6֝]od>pNx=hhxvs=3YNex0 vJ[U%ft,gu})92*`3a&OM`9mk>K"d|tQL`kzt 킃2+ _H nk%WMQkbKY=\%$<\=%؇r66ꒃNSj6Y r L(*b8F>gcbχe-idk[y@$ ܳ$ɘV`tli*Cu !D6?)l>ˆ7dՁLT6)nxk)jx%vTLām&;X͝_L;7]MlcWz\߁8ANLOR^܁86\\@( U od_)Qe~ 3g?s8N46y2>]H0+!\X ;)' wADmXm fMG;Bzaœ7" (htL(-a{޿OM&evHMwðe|g/yy={-0A!7I A2րH c%!d[=?z>wn=x ẌH5yň( DT@x_M(աh.)aq$@5Br _AW`%ȠQ-p#ϪvݤuIEQz2pXI9Ju[~ǐ6aFf~ 7& +XYRʉ*X۝ڮsUmHiJ}ŖO[\7RJ8+16kLy9πv)#J/{ՙpS(Jǐ>'dq`nͦ+0הʒ; (h[uZkr)dS>}+?3Yy^ˏG}Qc1QOHN`Gm^aLm4Օ mSj<)O9ۥ/^ <*Ervϴ[ylveFϬ$1Zݻ3,9|Y4Lm]3`+Ao @01̸NCBm%NQ{G#0mXǃ%W'{‹6k[(G+pQ5v81\VCa6bM=ٗ)ۤ@!^0%7 sip2ʛ7Get zX{.?.U_:i0 /[m4y`!م@I_iV{E aٶ:X2.Rv@NOI:*|5_{Qun5wڈgTeħB쐴߸ q##%A`(!C2YFjџzJpH' B4R94,c2\-ˮdu'<)25/;c(͊Y\/2`[;RѵfOF T‰U^H}jo|1>A^JhгY{=xߗ`37)v]&`-ߺ|zOGg3Oj <1THbU;LZ cƭ4?ʽDvx=lNՄO^7]ߛ=Wg*JIWvBGʪ<~8-atPPDQY\JϯwqC?5AWe'l}܄a 9V2~Ό-D5I#bңEr9Wg8z^)<+ajThxtK $c h/0LLS\Lu|3lq:hgO]۱xab&! iTрQS%^ m&\וJ\iֱ]}QR0${ϯ@F&;Jd󑋠cnHv#稅e"usLs?diK44 ԫ]#*H?~tMҾšI)ׇzO]/kvX~֫M9ZTH?b/oڛk["=O>{l瞿_^z9|HN*h[g+HX2^d:(~j:|OiMk~23[EPJܤw#0V9HO B'p$D \۞7b& Џ<} M_zwdZ!n[tߡ_2 bK,-(w1#<׶YuWiwj}s+m62 C>za5;|@;|QZI1"?rU9& (/2Jgļ-O1F  X60?Ѯ,1aO*pp8gj(U&5lv6yE!h&ZE`U~UUbpF@Y. 8i[EzR\I@RrnbpcmÄXAgj2 aAf$TD|C~zc"$t`GE@"F<@+#뵶Zwd鷘fK4hS8hA~/{ x!ficTﯚV]n5(jdu"<ιgA;%GGDR|ZI~9XFH#FDJD1y+=N2G =}h!~DƪԵ(L@ .&TF6ZJA Hwy W!59SOh$o3æa=&|w[J=ONi ,'҉AU9ϡHB2"osoCzZfXdTK#Nv(Ph<6Я{_-G8:6#b]L#? 5*3:T9 npF+$榆H)A-a-Ya\smҝV|-<ϰP(KcGa9Ѷco<^dqJ66jf b"r .s&M$"H , U c  tY[8sf|ɞM{2sѪLxJ)S43Bm-i C4}Tº{1h)3ƝVDY#08[e  `r|mv>5gU~ RFD{T:-!?-w/2k&$,ύ?][+(1hy^ҵI$:740D; /_PAC7p"d,,!쥶L:kH >kx$2ǦY?~elv:Vr@H=\ jD$(_8ގ=qw{;R$МP  &Z,n}4r%lHC[k@5{2Q*zL*$ZdNN[&9_(2 Q8۰ q$!]lDZ_+=E=.j(d(^aiI0f*W h/+Q+ ήX㋶X[C^ @czMl~6?}稱k7w;>{z02Y+5+lL4j3*j )+,r$Uޒ&R@Q$$oȎkklw̋DH@g~L7:GڵJ],75 ;qfZYQh7mtiog͌ TbRIN Ȕ"#0!az\ZyYl`W{  Z4XqB]uB"X!YaDɽ*B~ !' DG* l`k`EkEv2ަ('VU@e\퓹]]+wUwf>e@>B{v)JB G\]h5ԝ/;`xo+E=;3C!R[F7Uiyk m&USWDF\ 2C)5*fQrH%Q=e4mT쿎n3o}@C `P{}. {H,P hlj3]B'\{N"C(9'늹&5X\Um >Ԧz6ޟ]_U)0hR̙-a!S/=OdfA4ؖcg[0~'0G5Qs8Paa~TE KN8^"QH)~)ұ :K#&\5Am2!&Դ.Dս8`VSǰ{bXJ|7a8 H@uaˠ&'4J*PjlBdee`إ-ɬ=n/܁#z U0Dqqb?._o$3wۋ%~Zh:P A;(b֌{hS 0 0ER&j(ř5 PDլO6%(UOo)m K 2ezN%~Q\:g~*r6{BO\57 ^bo kLr&a (;4URÝm>L+QA4&@Y*Wۇ,Gvw0%7 ;HخP![!Je +ɭ(w.VgP!{yao{f=K6"@V@$@Go_kX;v~8q m9,qɇW(?Gp"G9HJJNfA}7 nKf9\bA(dʁD*Ju%X 2c XC H4!}* Aszq/t"*^1\Aҩ.^./_4u@*PJqs.[(27EOu ' ?tT/ 㢥~bXU1qqkU~4g`)O?Mq7m^H')-ł}b̿u^:Ky$'~|." %GwǍJ4ӔWq9~DYIT6}lQҦ{ÂCw͝ύ*j<2T4$;^)QYLmcd_҈yEvh܅O.[5ۀ2Bco/jاLf/+Y膑{j:g`O6.dUFh[/W'Y!5qĩ"A`"\x1)k6#(!Ak \lA#\v)?,Ts")"DhIǜZ,%f9 K;h6fx vHJegA1ͯ:蚥QI>$BBE1·× ZA] K%}+IcsB11'z!Zm V｛Y< E A,k#pblZ7% cS@vfiD(63N'43<% Ej`q#9 Y*y;4JIBLB&z.SiT&X:W+2;l%|'QRǂQgTD6 HK8jg|@(.4":qҍRXLa QODu1˫ 0<6Ā-C8޾rc(8aMտ#i׫rmZw],%nj(F`4!x 9Ch령2]R3&5c[3BaTN &͌zeNQ\"DʒZh݄OzNqkFa]7S&Qf,mqJ &1drMf<¼IYȸP4"J֦5W] 9n|# 1Tao(PKt|xB{ϭnJ&2d@|#ǡi]\w xot` 1e895d!P{4Dg1놵r) _b+d7f\bA ;T~0J|yPHFi > >uAIaU_wsY[8fѿ `œ Yp9KD+$2!|9fL-- 93 OWr!3n`SJ&3X Ǔ+1i]:,xd$-" qJ9u]O SfbUj9\ẔVmR1e_5PBiMZPnMLmKqqoV$,)!"( "AB),( Ad(@RE ,"H $ s@لqr˷;I7`Ԧ*QwlOߡҊsp^m9TD(M K@-"*ute @:3e S.bћ9 KA²6!CMJj&pXZ>%%T= \\M07/MHΥtMe{j׆>=3'`#t'xD8]I%/X $I,zǒJʡSVdE Ij™tT"<ݛ-B[l1!}|A@ICӌa]HDU*;zL8^*ENt|ϗDrZʭX`m}e?Zl!?]w||Ce]V7пDk9i.@" QiX..a5+he'OT^Zh6wњKZp ݮ< NG*nN4ܙ箨$+l,3Z'تbbr'8BHZ΄Muq"&gzI'ae]-')jtC*(D6U 2A+ oRV2o8C1&X̰_ wk K<#ƕuP^y9&+EgH[Fz%sa!Ӻ{6^aLOVZ73K #p*Z)8QQJ9cd\x"Hp.TK")*rJ+Z*=|9-=`0DeV!J*Ik:8be6,Y pj$>.R*nеHQy:r`QH6-'?~V֎f!pVaa(rjy6 PuaR _kM.0 6io YoC5_M3U8V9c֛"|wONݡHJ87J 6@7\`_TG=uJ9TP^Km佱1#gd8J:.mU u0`A;-֮(n_TwXU~ a S.ٔfCD1̄Vuq$"+{.f/ W{ 7ZP`*+!`Ÿ ٩Ѥ%;q>;pE[kwpR!yN=f6!6 jhzcS-||i㲦**Co/"b%k'QWL57%*,EFprs%ݭHgɂ8HR ;n=3ӱbRtÊȒ ۀ}2g]n>XS`t}5ic J%mࡓ }2`NT&HWCy6觝-/?PY,-a1o+ aM~MlQAAKЪ%~ڂd}`T\\&.geb#/dR ؖnLZuun^,z "ScDŤZ.o_6Iٗ뙚~i]) 3>@Gҕ/Ꙙ99P_d4کI[d'<* Q> XG=M~-|:<;rw~k .-%U1Lb8B} ,LB%,u喞Dǻ(l'<&50h~9HT4oVl8S!N)SABk?&w',=Fu6eyHW,}A0SNE%=*$z)o3}gCi̍Y$3/oe|>Lc߰I0emu y{Ge.I?˜An6S.[QBj ;P0(9m<b aqI_ DW驁 ͚ -7$2(NHGu<̙H^޷vÖ~UaK*PpFY;,F0t :=4Q="U0@=/BP/qx7zrFdk?ܚ0pN,% {Z\p]*O݈*LѹokA쇎 '{ DĒzh9fA|80Y!0e^Q BA< i72 qw6:8Q2YŒXXi}=3) ulsXQNv q?aQ52R.c@YVTdՓHbJA,(kkѹguzrX-DzDf VЪ*,Xb* (E}垇~Ա!BJ ^q%@w]]xVptGp~➦'˧'}$hǑB,Ń B<gMӚюSO&\b xDpc"PލHU@S/r (G 葀 *N&vp<-[ ́4~_8XI_7"yp`y>SsDu0$j$ ;Ȑ b,peUpIK {nmM\՞=Jz(߷*.Yu [9M=ɪ :T:/ScR7Uh_>:⪹)(9Z(gi2$ j`( %YJiN4'xZTi YUx+0|yM)eSY@@2ftF}S(ԭ׼$3ßeDMbI0fKLB񮦺-0*Ȍ\;0eh!H00-5 | ,M_zNNI9 qj&QӐqFO;E;-U+ dTCB`ID)s P3>C3p[V4FωIKpXZG׵e 7x_6zA:H3!#[7 |[hz,^f7T<)7(^8OI.}k&(vf58>d 2YB6)ǠmRk_& G`sfD%cۊp m|tBdl>Z_aCfbgw9_2(.ylDIiuvBV׭<_.'nkjfb OeEznV!Ab~yyѡ5tiͣ.[MٝtC=!(W#skwȺo#+X0LY$<^}\SY \4W^z Cx\/@c[#U21 ?`PnΕ :Ȟ,x hò_+}N2zEVk:}R=K/3#yKqgP/N, <x\ңg\5l?'L|7uQAV!|4MZ-1ċPT)ٕg?x;# u*'Wg}V :@DvCƢF@Ccoڹb'A-qAp:Xbv(k\~& P=dzB8n}PbOW)sہI~BYMQޢZ੎BMq<@EZ뎬%Pt nO U-s]Dv/"Ԝb LeG[.=,9OF,ag&Kڠ.="$h6(jJxVXYjZy"0PlEJ=lVE~Uºϳ(.O+H!kiHT @ڦFBڹ,)#iLl숴<5{FjmCLz-.T+ ~DHZT{%/g:>d囑PN1&Vs@ MG4L!;`LVl Jc!A6ύxZ^.W|Z#=6 {HIn@(ZFw-7½͒bU9:&SWP;رg/WP.)IfbˎmcKls U1|J4&D&ىeR1R0 "~rv?zƞ][?f7r7mݙR0# 8?ٜɐގB:ҞnD*rY#:w*qɮN^zgMyg:A8ST UjܤAm{*>1 ‰ 0kٓY6I4f.ɰ Y6$A>._:]lXmI= }, 6Ѐ[1K?H']"RD%߷Gl\RhD:$K},s"aZb K eA'0jA"<^`e A5>El<ͼo#[yJ6Sό[)H:F,#4pLlfgm?WZFhpu:Pcj=<溔"6LhH(#N/7paauf*5T> IXř7w=0gDaE|eMTZ`p8{HCْVbVab#O[gIݬmc:Ls4įFfH#A^6;}321X)ee 3h|ڊOv^SqT8> rn=ZbR*۲ԕvk鬷4.&͸Լ艭0?g*A:- }d8O>S:gZgZ J S5-;Q0Ք:PFI LXN:([a&7/{'XTu{4L5 ""3 ͎ UZ|Q;X˅T y -;!(NdRܙ+e7!3㴃V֓#/JUNzy H!3}b#o}!˜\U=PEn9. Y(1+܎Ax n 9ڤ(P3w3[lG` 6v m!@Z?4;yhi Ԅy440oGtvrݾs?x1^4c>7*=\PWPhh xwtP|njp@c^D.4u2We&p!4*ARD`ȶqsCmT{EyG @ Qw>eh\׭_b 76܆kˬ/ȧ|Wjs^(H41XŰ43O*(p/4Yo.Qt-@Қe2qx1 zB#kr ;CĊA<~U"dO6tr$STzBK,*$x#Ce2GRgҊG>|]YDM}y (nBe<,.Tu%I2x80x7?}W!Y TkXg+n/__T.NgeQ2*JLS „&SHG7wGgNM `2(G;{'IFfrBBz|}<^wݙ gT9WU,)^ϤH)e*=ewV͞KmG6ya`NtOA』x"kIw$ey&s.$Ĵ_mB˛Ȩ{J~0ʃDv yvЙ>,K#k,ҽ!Ul:])c*rmo89fn~EtloH;n;/(D@8SrGe'Y3FkCoNg3ٳէѱd(Z"?fj$!v Qi߭YEɛYTewn0v0kje2 Ԑ#kIWSVr9{]-ṆʸT d YokеF'](v0G[o))^1LR0v cj'9qh}Ƕ'><^7z--ڨ]d!].[pJjݝ=m xR\/W{d~ꭩ}R죆'X%W"8 \TzgTft=P#ͮhkr/ws[Swͧ )3l!>5Iq 3 ,s*移 Y $Dba=^bmI&۳'aLOžf4>8cXwt.:'3>n~ '~.Y./d #D&Dbw5#}ssOaN]~ȨcO'UWSi\ȸyo1$ ``CҵHg_%<ꏢݓsX"wֶVFFOfGޘ9nq=sBEEòh>k|Zp Ie(vQgidtW9yit ֯+S7r}i2>^5b2KKUCq4_%遲۶{{sxD'|$=~}UzpM*/u2Coޗ7}'35?gWcM']EG&nr7[=+OyEi^%eSpQQ~oo\ާyO;S9/sei޻JN>mE|Q ?~Q`ĵR甗gIPLĮ&D zieqtZ]RW&) 0`XB:2V=ilVLj% . v_ί5M( >~7=׮>3{ @8Mcpamq)0GpuHϩ;;b4HDLP x81Du 7QL ̺0OMAҚ# MulW`y6*〆KX/1gԝh *Ae(lajTVSR|MDNLפBdQPªbpӮ2KOL[׿#>r62<愚kkoв*:f 1x^mX|Ĝyb 4j٘c & y]AJ\ `A;ס i9 e-GLj2`$#B@ёiH|H߄bXv5UǜJҝm41AHpŁ^_! yUO4FN6"#}r߯hG+˿4b(g66yݗpὂ "?B ]?qgj6o5\R.}UAQaڂZҿ8\?/4*_+eZ{d"7=>D:y'i6"vqZm_ъRZǝZSykڣg,M^#|Ew3?$8{/\3tM)@8yq?y5vu)'ЗD.~zK!3ZM%$89Tv-~oܕ޻ l1pߋKmҖDjo) ԻT9n8m"TǘTRR84g}Ht,F)<_mW ,fcu 3lDH@Ab<>E.%pdZŴ1Yb )q{.-#G?iT#Ld@(A$i@ond-XfP&:LhB۸g{z/u/ePL(ib4X'@G _sHOEpȦ/\_ ~p /HMS;xrږ`")J$Iej >sC0FȻ$pSttmǍϓ|#?E1O9E׾@F΍` qf$ЬC8J+z ^Ơn4},=>t TI%JSbTG01~?})=iڳcdRKvinbፊ\KБ(`R4>o7PC{{¾cn80{W@?;^oKϻ'CjOhd"q|yVȥ F/J0vȶX"52"pq9OCQV,W'3\,j; ֛;qɶx#/:N(ɤDG uua.yw~n3Q_(@M">Ȃq6,NL;iPшnj =9;^H2νɵsϹ#doﴯFj*y҉^މ)gIm{%$ CET 5b'Yy΋x5oYQfU7[2,Ƿʹ AE}~mU XOץ _ viV̓lq(ʱ9UʶͥE!wC!SK(1lM5~&^.I4Q/bL'5'}̇M7r3Y@D¯E^:KoPI}zdΛbT*I% Ǽbe<ߥAOgΟ^wH%sJi[ogJ|#ܯ(HG0g.U|n.Y+ޣkI˗I>- B4Hm "zZ!B7EhI ~p\ZaMPP rPgK/UXY /̼}Jh9rh=eo8t+tFm^w$OVLP?AǴ?0ݑԕZWRHdπD өNv>?])Í#`tnm:qKXX~`i¯)B{uV(IcM58~Զk3>Bq&);ôZe KM YN~;{TR0Q+MQLGW6ש$iӫ oЮ%9O^/P̭4mʭ O.[uqy22ǬKD}n B$ti[meS%(sƴK.%G?뭃 ['?qDlHH Dc'B޽Ga@7vwHñ'ksu'ڷoSAV Ń {UV)-?km Tm:%!Qz1a1'sNξEAWY@}OcBCAC7id@C'Qn|:\ӣ/o =Utߢ|x pR]]GcLv+D1OY+oǧ6254!k;ϼP d80PA1P.^ܭ;!v ]D,p Ihɥja(QRQ(eHQ(D .302ϧ<>J^eU y=YNP';OWHvgj-JXFUtr5N_]~wKEQ*osʨ JUvp_as)&VPK`o`淀ps{d]OU(q~]]i@EqC]lK?P4Ϡ{օgGY't%^`&5-sULK<׬ :Guu`a4}dG8pOR*j4}Ҿ`JH=..|C1;OYPg}(tŌ`d esES ;A-1aDw%  _yd0#VONgŁ! l1" , k3D^[9ٓ(e@)G'$؈7?\PH) AϿB$2 g:}W:]>Aoy;,{a}P@cN 5dy^^N̬X`o*ҷo`F5p)('QwwD^A?Qa}: \"=3` ::g(>4—[mL  b ǃ KbG >/vT nWhU@UKL4pF/K;D}Jđ\!+mVHqTXm$J:mϻhHL:>%}NqrFu7Rhr5夲xЃ:``)|IS2:o[L$]-eﳳpx#P~СCg ̨'$ABg7W #_tEuF pd; A ?@RRٕEDfgr(V$U?4E@$UUUUbȃR,(=:s:Ew{89SaPVEXEXď/35X"( TUTR#unlyDFFA=|A6{ҍIԤ<nb`Gw0̈́"{5O ?Nu jЬQ`E"|4 aU І$1PP YX"HPjH,2{!Y!Z#eAI@8xIl0'mz2Y_XO)={(!JS6rz(b|WI?HKBE_ Y]UrnYE,RB⊦NYuLj  UX]-3Lf&PV<5UE< UobH|!j?NA;YJ-_-9䁱SM9;O چh?=<,/3sb.ސbBc6!8S#leGnۏcG֪Al0[LX\KޡTt>5 bD^FIH {0t-[7(6FѩuGM@Js^Z=9`~k+a9_vT:Ӆ,ᇖ;-=Ez A Mw=[y箤#1[C)=W2">gwty})Yahr! (p6sju\ LsU(u`ݙKZP9[jnUyO[o yZ=h 3'?h%ȣ5('ԓˆCR ne(RK VJaeЍ7 =as0En6 ֑כʋMeԘTĶ >03Azi?t<[+A"c<Ё>)BK_{XDIVCi}Nbڌt*${BFvfblSsXI%A%h4hO0uvf]26Ggi>6ބYΝܶZ:@bvvsAPʼE7pkT]Mlᙠ d{r@}#I dǐZ82%Yw`O񬫷)]yȔq ɰa9ZU)}ѕ6sz J!*Y!4D' DYe ZHmdw_TD\7̚`)~0fx}w{nw;΋7ibj,!0 6 hll|/jWߡ7,G] ) 7.J:k7hIgF E!J+WnvnDn:?IJ$PT[mC U`4$C674j棬/aͱ5kBTudtpY,_e~SLZmSd@!!;ZO?? p>#8_ٲ`& Jy1YU(d(tQIwhGSPVm)4( $\T"+F¨88K*MYow,kwInZ!=(O#1҃@ JHzYTcιY*&8gǜxJ[ur11/=^ۙuNN3Dڹ;]z54Qbn:Of/Aځ7=ZA89EUn ZпG|&L+ )řMlذD(3jv 1uY wt!`%90^f;z:/ 30ٍpmw!FΌLFQ]ςװ#Df H4XZUv椂-D&$-j:㴞٦ӂ _a^©pf9:3FzT|ujsƜfCfeEP ;i895 e h0$UCxO,4L &AUI`-QaC5 6ADs+n1F-f h&SM|ܢ"iPyA@֯EFKIm.Fx,0>>U./lf˦2YpO*]!*@PnFՒz'<"CA.MS*U.޳#dˎ3'vVoP0e@u*DHPD5Vk/:ڀ`1\kԢɚJ/q&~(%j7V.]I$e~HA'dYV;`h Tia=ȍ0HizaP߻#4 ޮ5_ .)Ȥ,dVX <2~Qe=^m꿧h?}.^L*$TRl}a~ G 2"Cŕ!FD BIm9I߯,/*i'qCt11ڰ:G.ƭ}moWwf@X.Ϛ\OI + "_^%}VS~1k{>>H <~wT˂ **H"((OO;=ى2BF5jл,<.{~-TToŦK&:PLC칾ޟ擠۽BLE# VJaAeB+ *Rۓl ʅa^J2=W op`xriDBdPwW-?}(9oԣ-Љ u(QUoMN\M4W7Ю|6 ;znjB\ ?k\ߥU/cQ&ZULVԕ-t섐ء -ϴQv:v&)(A0S]]J6ٞmp|eT61W|-F= vGu~0֤%CyqۛGN,6bFYJRQ#k|m߳8om&NLz~F6֟٩G{o7yMfx0"RH?.J|2oP?j]L<= kz@hd~ @Rʵv\ح3BE]@XEVG?zg2not:u3MHBÝUx9Ĩk^J!]lv'*7 h.)/nʶ&Yy32oL:nkO63dzKOu^7$_JI?ZQOE`9aüᱷm*2ê+׸*xB:!w鄻{ؚ}VqWC Aq:urr~-Mko>)nBv}ƴc^_C̓ %nkIJ3cK lFBam#> v[y=.̃뚑HfteEdDV /2&@o-ەH4Br}HD%Wx@s'|ip<0Pr͑yh90 toFQʒcqxP Vб `Lx=(CuXX Ne=^<\GLZ'F  )9eJ/8L ޲@{M&BgD Ɖ0+6 2 c>S F9^’t![30l 4vV ^\cِTd:y|9} j 7ȅa I_::q6}R$I!T $A$RDBA>?&) ! (B9NԎ㨖1uv> 106$ǻD$Bed{?MXry[k6.dq"@UF12@#=O2s?<ڰ! P{BhrzLg$[8xÎxr3d~ۚ!γ- *hbOmoŸU)Z._n2޽vuƙpUtfvn\$ûsPG)_U^0J_ TQ9gx6RЙl'.ӿN/ZbWjVJLcj,8Y4z #P1"0ts726^-x?P-;04.c(v6:GZۧn@6)1=#0`IYZZ;b)\ ̢g+|oˡuoT(窢ih! Ve@*.r)J\ZK0pI2[:y;b{Vx*xR !R2ANe~zޏ<+n " d;9_OuϓSG_nM}Jzcg[[MxK tur{8&^7hHF!lUwyt:pbM6}>aHGN<0B q<2z՝_A`#^x" 7X$U L%z9 ܹ *U1~~ \^N_t=OGj@.9(z/ 6fj^bS $HNWv d-׬k~)<|;_l緰D+9Ao 8Ylٲ6|#~O- ?B 9@R@ *MT\y^Yy_8mcΠ1<_dJ 5B!q 䫂d mGV5굵RΩOSP:4^`[YSK44;+ն96 dnOc'>_Vz]݃"Ӡ9 f$3܀Y.PA9t^ ql^%vZ#g0P=$?Yp >c?/JC{YN6ϭ{޲ˁEH - 1 L!! q~ ;<}znQ!S7v̵"!%?@ <+wO~{ʺfufO~h :YC>jU#S(GFOFr$t:`h^.3lyǍ;nZrVn*c\HHO4P"S0V(%iGU*t8g` +nUt-8COӫy;l/djjs(tTAF&Q`#тK$C#vDl;l*?I>6RdFv{ unѾ\,A\]{NQRt;L(+S6Si'L!I OWnBsb*wo (6\A8fI \TYu. >ҮN}V`wK 7tsZ tG#7YS0[{ 1.r:E݀dE3POC%ؾk m(R#yiCyI|,YB]3"i#/bRN<@%q@SN@_*Pkw9YǁoJI.QI$% EE 6n>}>Gw4Fηf9k/U2ч*T}(5c*NF)<1Az.!Vܑ&zer.&w^e ~8<&AW|Qܖ8imgSnb$PnJڴK/f=*оop#'.z;Zwlo QyHLKs>p>:aUQpe5 cg,T VQW SuP J 5dr &ݥǑLZC]gkkJU*goF$'<p@\ۖf350wl*|[oMi7i<Ą NޭO4>wөRSL0bXJlq n5L$R-,JC@V s"<6r))WbW|7xٖM w[7 AP:H0fQx u˒Hf\R- EbE?D3GNJuer^.Ώ"{Hps'c[*(S %R4 5R 5V%]J?m KjdmBn|2C_ܐa]0Hb&kĊhoWzƆ|_l=d-Wdaa!8J Pc{.nq42v=QG[K3˅|-Wg}垟K, sKCf|ۈۇ ?N9!JusF.;%tPNQKPRI [TS3Qx͑=:]/B#dC/8Pxiײn+;hAN̐RE$!!&?GqxPGۢKڸ^1?o,> ug ]|VR;}nfuCš ٓӎxI^N`T9 Ԇ7mt>8x/yߜjEvAU+7֗ iRԴܫ!4q%`b);/H[B`@vS06N>r v/҅YZP$B %Ii;)%l rw OYr `=po(΋$  :i^zΰ quD;s,pʫ$ÌP4G7QN2ݽ=;$kJAP >V|'r\`FZ3e\oD<zIaZ(ƥP⧡÷)mv #>5x:"6G+̮y=ߪő QK=/a3_i^_tDƍB@ù~[Li店TX[C0Z.fk\}v~ M] s"u<< z-OeDF~JfT:ElʫB# 7CQM7Aϵ_.fRr?}Ly(&bk_+yaqVt? =gtB5UīJ٪߯ss԰}-%sgLi47a9h +y->.@T=m6B'/mK=rΓ-u/vY3,T2uXyMue8_G}FuxE @5[[~`>O>NOQ8޿Wf~U{?NQQ@@|!w?#,)ŷh fwÕ^C :,Qy0[<|~_k [;t` gǙC:wjcoB z1Swz>/TAc"챴x7< qBQCu`?`!#Y6=?qFmedi'5TVBkY0rt>]Mw1I.ϧJo|YFy(o78ƵE$CjJl1wѡ B gg&T OAylH+NgY=ǒb]~58w~uU MBe˅f;]pQ̈́i[bf[5H\QCCy1YBXT#4#<4[*k4J=ךaf: 5ɒr4P" 21)rv#fbTt U&V,J$TR:*PÖ@9 5I*I,gRƸ?Y0˘g,'@3$q8&j`q?ĵ?HH^;㧦ފ\S0F.^}~%ReZl~im`q9}xOJ_K ~b(SC#Y _\$jz(m?b 57mѰSqz&WDEX7^P"RꚍB!$ܷAΐが,J!Bj#M}g}*howdQ 0~ɃZ^Kk}'`hU׳AJ=Ow(QQpT9]}Yȟݖ29'*xqq4? 1|vDW׻BYv2z.A‚ }qCקv9~/]͖B2k {7Wk{DŻ)(qލk@w1rݝX+4}uF3Wtv%N;-cH/oaA>6\[N>w?2sZ/1P0C㨏8Y|Ƀ:bF=!`Zvt) HY1}=uŷ7*tϠEgIdk'ܳHܲt) Cl)ڲ4O_fSvRxK+U)?[ʻnP< %0HԢQ@{2& k. kF I m!} KuhQPXIb[em^ !^G_ZӄJ n]MvO)7hI3h`fr U7К} 5_>hG* }e6Eq7đHR,NiutIқө7j%ȆG(UG'ƒh"s4dE?8o'C|(,Skרk}fy|;{kS3:PB>7@͟+:Kh%d:F *{ѷ]*I$I [w%b1;S3|F< x jcZǯ3`QF&ȡ,3hT,I[Hݏ("&t75٬ZLhT/}U^eyCypFlrlC\2H#Di#!^gFNM5Nkmn^9ғ ݈+4׵C!IbEK>z6٤ ZB=u,jPT nB[M{r!5:(SgU#XN vГi%Tv /w;NPKYHjqѬTpǛf^zHǐ"#$60R{Oo&F><wg̔%HܿlKPC~4vtDsP|8ဉ'XGZkJEka}{*_G#".L>$"tOWzIQ Vrs43c{xGWǀ[5`080C+ع_X*mmϥ,K(A ֓;Khrg4˓/ dPO("畀EzQ ]<]%" $-7%'Bie DrXvX}9=,z$/xfY5SqcRDδ{=F>F@[R)t=\rTC%|cGFňH$95F&GZFg[bYX+-9g|oc|.J\ijFˁଉ2);TB%w(I r7OejK%&n uWY܀HB)O*IwznW=VeȘt eu5By\d 0h?ٳpjLORǔ=1dK(=(7y?m7I` P:ÖZ-s]E{FRjߴ:*3J)dqhVqnv_|5Mg7sOzVm.ŸyIiMAd&ۉ =X͋-jN6#g֪]yG)Bn/si>"(>?F>IA%k 3X&`ħ':Tq~G?j$"(#~˒qw뿀/Mo)Ƕ8K;g9ΦǶ9RN]S kwj?ɀ zwrۈm7H X@0k6VQR&hP;+;;7:ͽBp Ӛ+wpa`eB;8i+W:)qA0ϜnTlrt8Bw?# *<>{\myK#?ydVÅKr pHB\"`"UR2p.MPq['n|pJ! {O,cz4K\{x=mY`9z"ZGohYsƲcQ؁U񩾏o<(RGӉP5ﱷntDf#eJM/v܎)|^l|\:J0wkyx#B !IRld d@xCY=c]RR1J{c+ &|mMT[%lOh:z7`r@5Op.h4Bf9kD8HI 7HM [Gxq.S簾YEY0%y_߮pʫ[et-QJZQH=RUY!3" 9y륙4mSF @W4+}>؅ B3ILbhv>퉳Mtq!Ea 4LJm8!"I!?п8҃8rg0hyE|5״$@i) `N׶oƵ {? WvVM}rꎃAMjܟe~;yfw ŏ8tbo62_/"`!"h䴠RpXeav d4pڀ8 b7Ӑ!|X`v0iF8OGAX8_T. 7nFLS?n\X#vq ֡ )ȸƻk?/] jZigOe,ΩC!nxc^hH( 7ͻ.n;TSTJ5K [r?W=-B3O Hz0p%zT[jB tF9ʔiwԀ˵YgqN(B%)#Gض\F7oJW4c9y<[CǨ̛M6R/2#V8c^SƢEs1M>3 $QhИd/\*F}pDe5rf#Cgc1Ld΅aru@7,M7s.҉"%LAvhcl)4)gMΦͦ7AcRx@- e6Gk{q*D'zSM[eGUߝq[˗[_6B ]*I|۟x(1DUTF22';|G7:h+i{vǒ1PT`(DQP@Q"1THETdEY#!_K_x $Ii)D" PYvDDNz?WѺ $?"("ČV #EP"FEV)Pb1Ww #c#}W:'w|#7r+O9$險7: ~2^BFس{OBt?ɳxXŢBQ`i\fq( mꍶ #gw;xHDž0ZպDk;u7rX~Ug"x?gOPGX-sID6 ˻%1Xq'Yی9wEd|e>%kZ %Uu2fggգ"ty?ǻgx[crޗ'Ǵ3*bv ) KwcâƢey'=oL^^9ةB5BGu+]5;; w0j;ZUn@Bɀ>&㐦Fe4t…6VCs:w ma$W='G-Wŧu+lWT؄9˦ck9K%7gݞ=.w{ўsi~Vg9zHGMߦ>>Bt+)94 M_VqVw @@! w|ƶ}eCOjC?7s=^ e~;ưj'ֹE(|Z]'cܹ}2||] `cKJaZy А#fѵ4˖kAYRm#(=P J`t@ 6@XcȲM:Y3A{7f!B>P/|eW gvCh~ĭ\^a1l gj GtLln* 2 8r*قct:x%`Zy1vt;:CO00>) Hc<_S<lC[ɰl}DK q*t&(?R5骝<82CV(L`5N(6'|?:>dOع>E2蠩IP(:unA9Lb؀N{5nLzTƾu` `\7y8t>=8$^RyS{HS"+k7w;J˔Vҵj%Kbq &RR>v6?C巿Z>˝n>WMo[r"[x@GQP֖rb0H7&ױ8d+MW`.6P03QU!<$WExZpЀ0PTi4F9ɤ؊ K:L){QzfGxV"88QRfx e.0O41W7 MF>9ޟf!z=lܝ]wg-9M8 RTNR cg{.ٔ(ڀ,DL>5W#1lݩ+߸\b2et=UN}eA] jkQG_ y CڨY>k_ n]~${tNs Bpd!>0<_TCU֟'#ݣ+p,;]1agrMPד.;8Kv_5KS)BRSٿ,|͈W܎b[Q0k~ڭ C š^J_dc4]yYOZT%WO?.U󲸱䴑nb#.|_i[o3+eg.!W:K!Yb~ QS^#a蘕:Z'asa5jro9 #a  DԢ[b.Ui #k(>,nH(9bˎG{r17DDkзsT?vH$P ޛx;:,}~[;m)g2,}Ƹ}Lpcml|gbdM58+f0c]xrshGbiZGrYc.AűnN|úŠ$3zou2"o{`fM[׿T2b] z)m'|Umc9L k7];9ː;&L>?jIunb胤!6!77~ln7ߌ9<Ǐ}=6( @UC|>{?QNiqfٯdh4H.F~Xßn>㍴UDs*DA$Tv 5Nq\ ,ދFyJ˫}l:hroY>Sas3tzsymWo* ]Pr7TTr;aZZ `ĿC `D2-|'֔㢝)֜"1*z]kU韢ZTgO* =Og2 `)MJH^,4Q! = Q܃FQg HWUI͞$V>ӨԮw{?M'pˊAyjm%= je3i\}{+YV\q>^fKE۵uxpHy$ŬAh 6T(പJ* *s4iN=$^GxGApO9( 3nƊ±۵pm2i x&2?e9b#S~NQeY }x9\IzTo)oYHKI&:X(@8d'&͙{lT77&@Խ΅U^(2 zT뀖mu C:cޠū4@O:v>Q.9F21l>hbog3[ C/r{ygVzBS#2ty drO^=>F3LhN)uحf3SqJ'9Esg;Bc+[k=OH F[ڞzr*Stٲ<5!J1SX͆Y}A\H ;;E] ",1uU3$@cmHUh6iֽh4X=Րbmjni!ˆTs^[jf7B\`sI+@0>(1'B 'l .ÀAaڿC ".h 9n5b)p0z?MW}TOeˤ!!GC OiCŭcƼvP;)<`@IpmU\@$j)BOdit|^e1}aN֘Z :33Cݰ>m+ ى^x 37GTLJy G1' u '9$zSV4Ro|շY4&<-~yy;RЬN1ADKl?a/.9 $$"'Kkg۫0sEXDJu0ozͦR̢:o^+ h{^rSk7?Mq/\H# `wK `OO2``] fDCqrIwRVJb*>Q+(k@+ ¶ϭ_cA'ˈkTݳ۠qd!XfkۖȎ?iݢ^/q>^_+ /L9l`zTuy$0 N֗yv {nG/X>xZ@ LASc3l絎4dq?⍅1szhFkT]R@«O\o$=0\ tP;d&_zc(7B!~bC_C=OgmA`J;b찜vso*5Zۻu_xYe[1Y`?DvT+A`BH)?@Fqx\zE[Fe,فN56qƄ7En{ZJ\`Q G j}1إ\i0EmlUcDJՍjp@ (0Epsmsq_u<_VS6>LOg^x y]3@ Z*L8E@L?DpECMY;dݿRVg*Ȃ[aVh/eKywuShm^ʿ6"~ S>1 @) 0ɽOkOZ먤FgXUBgjxR7l˽jgrNыr/E>/%C8A?zyLe?ho<byZ3 Ic-Mzxj)ȉ,Aؐ嵆rEBY1>ln} Z.LJvmOui_tJp ! 있v ٶGl|; (ٮh 2 q栙YB!aqS(pix'S28q%, ,r*`L /~BHE=YbC|/G~Ǡq7$PRvVl|V٠i2q-7FfpU[iFQZD#e4xKG51W(Q,ĻiK-g {Ky(5={oQ9c#.}YtLe:t)k:Јx[W&DŽfTfyߴ&}w O-X`2$?Ǚ Mz*Y;pT4zInzc `-^c(W{I#)L?st|-4{@VʛM#* 6fJ:hG7y.yxS7b`˒#' 4$6kyG@ΪY\h/GRtK0L!T C nȽqI fU>:Sa"`?T+ڇE8rڪaF;Br3gw 5Tf„02 חS[mӖ84ƛO; }aݩvL d1Z6t.=~lXoo$Ssi6vUTk?Ϸ!;iCD(!;a܌CjMfMgs]6&tL@e1Gξa<<,//U^(|,+ nQ{id+yoU,fP jw%8DJO奜 ".2(n?Q.{is\du3eٯ59L<1oQC^a-G Y91|\_Dwy=@@Iя%Nؓ sN`7W \N 8%+ƖTW/r4w;/'ANc8aT>W `0xpR.XD(RO023Ӵ*Tr4Ws>OQݦH*?T[<[% n&Ust)Yp z߳w[ӢGQ =fT>,3F]α)Fu;Gt}QwNiV.nȸQF8䀀q 8c[RIo5ǙiH>+hM*7^q/x<5y> R0})6gQx P~y{k%c~gEVчteC{Hr X>r>fmIX WE@" ."@^T/^}w~9aڻșwW^E* 2E@}mͮ2MR`p=z0DT@H``l;m6Lg{oe|8`8@0@6X3XE:ŠFKꢠߏoO/#{%gx^%AOUz[^E$O1A'h6J95 >wzO֯M}?Cʫ0y=!O{rލrCCu[!˜1 r (&R P h]O|~a,1(Ô β`ssĨgOq;)]oT]Z*kT$%Q~/mӶm8tsbAHKJzӿ7u4)vI}ߝM}:G>ihJ'A~H`#ʙ+¾ ݃8ajJΑSyd.cT:9;gX ?AݹtR7v# ĸyM.1|r 4۷ !s.Z861Nzԙؑ'l'DOTLqS?I{e4{,milXC~-A[ [\s~B vD!! 08^]a^9M񥖖KdJJ"#>o iB{3\4Qb 0[b(/˹Kegsk:RaPNolx@@M5/ߝAyUHS:123elol MX]u7ڔ&QkGP!tT( 6RZM uHSl&Ӵi]LN3.Θ'c_=pA֪cs]׫~˰,kӴ$%R_ډ|ΐ:@#Q/s\yEdIn,itܶ/i~iE*kEunMCRGZ6VC'=UeSbލxaJ Z~ھ7nvuX6Z9" i8P{QP$%NxW'jn:eb<ų񥊛 2$tf*_l]߾?>7p~׿a, bϣԦ{S,fDOa!{9_9!u*]k +{ pHu/4"#9֚bﺝ m'7ez-8:ɯeI-#֨DR~,9A$O9VSI7T_gY7IuTHR+fU RF2Ts \qjJt/xZd"2m^ctjLjHe픤h:hPPw1ЊעKv5i4^XЛ{{2u$`s2<@Jr'z]C:os&aD;S@LJuVf }BÑ{@_%"#x4ܹGvQui}ff9$7Rj[*w{?t-v\uR cZSKejZ> iDZ #N ##Ŕ!ɷ(puOJ`XX>Ou2HV#r"9#/-t(Q֚ mXtdcX֍2L[M蠎[lg,!]=K'ja~KkA)Z&{WKo ib"#;uv,d^Y39TEd|W @stƯ_Y*@dsW"F! 6No#״r.1&Խ87puOSkM5 Q_?,kiUe-% >.V&ײR 3 E65i_BcD;M,c|`K&;{Bmh؀​}ެ">=wR ɚzݔ @Q ELz^y "@DB~?#i;a7 j+)(xIqwF|.39^o3$rG(6`Z6g"PKVY''H=?$i"NX2 oh-(^_.w0WfS5BKqi5K1ՃhHۚo&f{3lw'=ӗ 5e qk8gZ7C+Gng>:T8k1P+ p7{M. lQ69"d2+ "$}A_?y n{XoUŒ-u4e9RƋNJVaKDZ jwh$.6WFs9b>>z]'dDX'=/GEm=^5gZ+FG<*ˤdNhx0F<`8ΘBvHoR>}u ҩ ŏ⧦ý>'|s2e0$k:v>zBwk7r[|,-\g82KȵbX̢Z?|3,=\Q&+kbA@kT BpL&)ޜ64ߡ\ӗNOy 2f:'fv%m +%-&Ż=-~%nv1};.1fa6[pT+(O*O?i u!JUR->^ZV)rpb$@8 d,Hwu=3@'VkLOЪo$iZ6¸sWи/MzlQ+տ8=]0XCp}{:_߷4Pf2aie 0å8_G_MtcZ;𲫕RzJ8{U9l"r6|FjJ ]0K1}]4m,M<ܬhPt9V4ַb9k,0pxs|~K>ާ '>21#qqoeߐT5$YqV MsItIgznWSz)1_T/Q+_p2T&M<(4ޅG?N˞e/tXJP$REeR8 )֍;ηH^c3o{e *NJ< εE46Ȯ{k.[߿(IIIYM<=#CmJj:DD.b:%W GqnLE Am;U:GX-orfqٝ-!&'dbm\ >cˮ}-x/'.cn 7])V bk`-;'-GgG(mr'ǕpoiyCvGa$USK '1(I!SgnkIhr{ֲY#R78r"rٿO޶$)sϔ(6'GkDЍtNS7|,H IHR쉣>}'$x(0;l}";j~7Oǯؾ42S0w\shUasYgn`Hp a>7Gu}27y2jl󿠰 W= Kn C V v7@:"I0نeSXx_swP,?CRBpsNDχyq-,R\n9fH6ViO[/&G]+ݦLu?%5Ag}ׯgs{a^6v?)Ư=oΆd\:|Z*e,;g~SSߧ}OJuyRNǍ>z:/[r*yd#z:Ub7D``\@IWaV Bc6]|})IZ&_>ص/f>ܤF09tasX&{ 1֚ (vkA{6pݚ-;3bGАpSm0HT1OȴhdtwIj՗/Ukq-mOwVAuJ9=Ipxe,*lV 64(c~6h8/a1_M!6<<ADSjRW9`^Mcy0gsʫqͼ!Apc jQ职m)4gY7?e^V9:wN|-(DFb<i;:JgߒIT vdeBA3uedy(B( ~h(R8'~k4ydm q~ I]wO=]cћޤG0.\U'6XUMٷѰXL}:+lkWZ{KvZ_֊==wSzcy=6uke'dPDEDޭKL{&wu|lh/9|;]A~2OBrnjRgc|jY"$˵NҳGҷӶ v2l<D9~6bcS QR>4 _^BN`_T?d k@߷3g-_Zc[p .:@6m}kIGߴw*y;7 'pk7'KhKB2f]&Sxڄ$BɮJ^5 Tט|sͷAۂu#eѳ߭:su-kݻRZAk/ ΀ܓB CytN4_(EE0ຄp}K'xlM>Jo(OD3wTO_e(-DL~ݜKAJ[٩2"o](Yল5:w%.J,ڻ Jqu_~Gg*F1J6 8>m |V Or~OAI{SH* ;SWx8GȎi cc[Lrp|=֓o0~ڞ5ۂ4S$pK*(t"Paą#M߷P~Sc,,@rD1^w \2{ٷ>ω{^3nw=" B ԒE1<"/:)m2-@[ʻXֿ%x%J&goL;l8~C.껭2ۏ׷7ii*\$m7Z;ċʧ9:To-R~R)QɎ7 {]RlP/ +bMj *PYj4}WOGk+vMyo [LG^ɘWrD(P.OE{קxpJedS~VJ)`ÄLwӍzcp^ AרM؉ApUdC:gїoz)~*`tPZB1\Qsld7Cad&rx{eDB"I!3o50|6 uD0J&=)<ob'=x}ګÚ09[($Tî!ء.@BU➭E>*3D1ґ`ATrDRuB˧(0\.B'p"O/6nؚ'~0E)q 2c?*~)!mv5.NER+ =UdkO@I 8٩-3*InFHɓ;8,)(5ds,'Jkډq# VpBqnfDxvFZft}Ĥ26S:0NF36|Wlߤ˅흀TA`tv#Ze68n PbR2U3^}X~+1>ā:({&*Mʼn+w8B x`3.D,f0bOţl_xS0,)Υ eJv0QtJ~VVCxYq[Q:7$peSYhgVF0'ʁF[mg+ MѴ޺1+e\g 6C=5}Z c9KT>3AvPܧܟw4Dv ә[-H;}ݩcIa<.,^5_tFP),{^>vʯ| Ls+N~ЍYjZwo76YorX|3f-Ώ"ZkI+wX_%cp8?1SAY~`f6W]ab1혊u,/=UukO`2Yeih++|AƃDWz>W.Vf$C9CL,Ha]}~F#42OS?||_dtx~jĠi|Ab'^f$Q~}Þ65hJ2K8¨Z-lr/G w @aԡAT 􄨥{+Տ(fH$S_S]xqB-hҍ䀏Ox{y|/iQy9qp;vs%dт$Em??Ș:tweQ2vU0WE5?Cr:)8FM3PQ*Mc\j+N%b'_:fԳe8W| +ͽ84R[8r ;GUBjҚo[ҙ +ap20j4P>ߓ!`t /؏J $4(Q!F;*p) +ۘ &:jʼ(gCDlSmg K:δ}?AzMƠ5ƿkor7oW&W k  {}sqoy?/cɷg%! @UfGc{wf0}lYGKЄ zR"78i(!Srhm|A"߿O_Y()<:f^GS8ewPM0s+%da<~ݞYɄ;d\j:?⚄THǗ5nKA Ms┫ԴR&JM۷>/ Tqki_ON&:o+fo[zGxд-}.I zɤӦ# sLcdԽԻ ^;Ym]X}/mrŒW92a I$FO0tQ 2VC 2/Ȇa0f'(_&Ȅ.2"`c7pb`@AU ˜`nX˭n%fۭu潕7@5 8k`@ŀHd$T#dXktUdev0Fx2ᤪ &Ji? I \N駻irm[=aN )rp|"ItI4(R ށ,@!p4-gnN./glRXWҟ!K=}]ͰW> 8s]w,2'Cibs`?k3kV%OE YD?CPA-ɝE ӬH;UD=GV(W2k#H!`|߁~IDLBѹZy'LF]I=Th{o#1ysA2I!$$'ir6yϠ $Z ] E;ܬAŶjRKq ÏP{,(2P͜cM67\Ӽlh;W!7<OEtM;j|җ>AWapDRI;ņ׿1kp'_tZH*vœcXJ=Ȅ%v7e >J'u]olʜ46;걼F{P#DZ-Ɠuz(y s3~aɇEJwG=c Qtw.ʠ<w,5A~ZK+L(FZYhat-M~744BZ $}_ς;S:o?xo6P^m),pu>J}XJuF@>9&1{R ǾN*jio6)զF[n?u(9ꘓ`;i#rvHEm6JZX''hŶy"9 qTd3683rZ ~TI?4F:Jg4}5 yr"3 <{>%4n57͏Av;)37,+l2ӝ$ p!=%ղDskE[UfR!$2#1q3TiC$iժt|ȑ8] _k|;,i ^g2}YS\u_IZG}^uCeH!J1L]Y}.oW.v~No[CA>E[m`^dʣYUk$θ*$ӄ*y%iD< dkd2m` GY&S iK12(DL0be YpRI%u(9Xf(0\B+&]ű[+>'FԠ'!ZI42Ow*7'{ܿQwwXLhCQ9O(D?#-"ÛdQ9!.+U5#v gb ҠCD{?ޖws?)^Y`lȜSmtʵO?']&B`B*D- ŭnot% [y|Ku⃠=⤾B*W!ߨ }L%=D M?N}S<~oyڹc;J5M_OP/uƺI.H`-7q6E8WFi9(LJT:蕂 rm,&X1tERX}BIB\8n/ҭL̾UZno〄\D)WBt.y!ǫ`T߲) w*;#,='몧ܹ<\c>[:Z7)"Q63ā}Mdo=B6 @@S`۝ڂnz&G3oy^oQhjNC J!3V3=ntñ{#obRh%JrZڸz8__Tet 暲 ;h.~JtT] 4ȯXҿalSN$ 1o7+)b1gNesybti"jnY v詜etUTn'59_=b~au̸?14M;[дe5iuԩgש?L K:7$ BY X'ps1QBVX "`@04}:Fd`Tdвq ~EK=킔 +qB:\vRAp Wgƶ~d'\co3STJftCmU_#aުzk?[|#֧,έn4UE#9QE]ʊIÔΑ$6)m-x:.g]1-oϰyJ&F{ =n4^ti{;jYB eF`ڐ3Rsah|ycPN4;)$/6i~?KUmUuIzњ2g1ٱbq L>%% 7KW,eewY?Dvclʀ:)fyER[~ej-S4zae2h2C'|u iJdB9IJZ@MDI̺}+\ð~ S]:")= q 3j%2Lte ORQƬBxQ@6)ؼm@ODA#*އFwk^6?_9/i?ݿGN\G[<TČ"I9eOZnԕϟѢ/ /VzBzr9zC,bxWqբ!!Q:nƾG/Q<z; _WşbRB)v`,z_Hmt2CF >FvwfZ:ɣTb[bTz3v$|D iD{ּ跕FTtRzxV*"  I*&TT#'{2x:wUŢ}FVqhShڟ!:PuCؗT<_wʖeo0bsLdt`i"] > g_ZI}:H]44wxoEA,lwc1Lk1AR۸rk>Tgѽ]"j?4 4}4H Mq=ϖp*"> q#@TlÄpKm/q#hIxQK]0[4l8٫&3d!ʻH9&NE2xRw5KdܙLHdF߈+L$D!,ɇQ4$$pzn$L~Ug\4 UվjQ;6;V G4tK0DɰZA6|HSMCn ]网.`19YEC0N5wkX)ґL.DP,+R#e/O̴j!4*dinHl <Å6Hp[ضz\|pr4])" ݯ0""ݍ{fD%TBDF$Dۦ<= 5q#tl)r5޴ k=s!Ny>PC].!r$>Gߴq!Ir쓦0;)$6IXN#J2#}@= wcn9ӞmNVExcVSus=s{z4{ubMu F UT2nx*wd=-x^mu'pyQ3u azmhYCw0? Iz{>a<=lo}+΅)ִUxOHV+&2Tg.' +t̟ ;b@C;IKA9daΚMڏ{ٔt\Rޓ;x^>zgaCަ}=́ub\2+r/,m"C~UBAMr| Ö,OS.rV~ϝ "H>/U 9HO,El΢0FN]M㑄7pX;Cg1y;t||fM595qHA^5[0`Px 9MiۏNm頳|Z3Ō&W|S˶4?O4#T.t|D&X6o1a\;#>k?)=;x~y܈ݷnQI<.{mg뺝~Fc="y:œ]C`BBS@jub H8wfma?(0120`5 2a,dAL/U/vs ^ܫ<}Be𴾌[l\Wq .5uS B-VAOEKˎ_ӣ[msGeˊ%]J{S;Oyp[ ]Schh4X y}Ӿ#մ25p-|I0- 򒮚"vbY>s䮜YY2?UѕR#Ŭx*‘O=s P6s2IW JF'y9 q"D1Az@n`tڌ7B Bj1T-/V նym>Qy6TS*#_}r~ֹͪ!}>@ \kSN S>8Qy&bwy$fF2Kb+"7JK+*PB}0g4Ӛ)Tx QJq912#T}p0=R>GOGo=d:H- 7P v]YB)L!BqB FV ` >h: XVUr mK! u yЛ<‹io4K"ABiMNM({(;Syȼ@loﲅ,0~wz^9ʔT~{mdᎳT]vGSz_>nMl]^X#U<9?Ħ4PyU NYayc?'ԞiS:cJpZv*'%- ƨ4  .oA~檴9>)}7 1q{^u18>LBsx:Z{9{${On索#9ڵ>/d{Lv$ fL؟ FVN7'VtuRDɥ~7'-QeO&z:[Hr>K(>DM5Lܞ1@?}XXš<=KWȒFy~YY7~A{Z8$ߘڞ |E_=S>[ z{G}ᄓ0T/?81@Ihv}l ڋA$q "]52뤻ASg_c>FͺwݫrI嵃@10^y6ll.ElO39˳EuwZw!K-H|@%sf^ad,Mg_~G;7_5 dy߀`}]/m#l,7zL۲Z|cYN~hٺv5.}]sbzBk-[}@(ewݼ%h9p&) X;n4:&N&'Qzbh&(rXOQMK?itqﷅL7¡mͧy0&5*"Q,XW *bgdREzapC8GJ`J!gr0κg_Z[%8mFpV;l|LgG %[l}\Sֻ!IƟ5|6,Z'L=(DئP3zUyT!|ZgwYT ăae '\}F717$t̓2TkѥEHO)exBU6B t?v;KI8yTkZE*iR᝸\`LX̣48e&ڢ=.hh.-i*O&Odā/29"V A٨Pƪ@~ֻskp'E^H3"2\UlTӲM1FbbC#3( |y_cA=9} &2`v0AA .XJ .  wL櫁ҰSkkP0&6XI|t ]V[ґ#]V~e9Ht¨D;xwܢA\ cg;Z <> g7 L͓hDToNH1E\M ل eۏt\ ̘sMm3iq@ikE+̬ŕFy)_NqÝh16,:9Kn*MNRϽ9ATzZytHtf}MTXe+9r L ϐɄJzSTDgn+G>zXOrߛoiqF2LfUDą?FE8O峲Fon~՗[T Ϊ܌͐FU8_DrSlC\x"]erdŸU<> #ÃNrd;Z(H"Y&)ag=MH>a)؍R1y搛,9AՋ`g+"䈭hNN[8ScӖ|x(`$Rz͐}[ѩ}ldZN{dޫ8s1V(N3{`rr4wn }E`Z*KRoOX_J[:YԿSeVO}ۭ'B+xDZ6|_V,XgeJ7iXr7XL=z &VoȕVo?y5׭mnëαǜ.\JM*CV oVi?3.qIouxRb Ӳq$8`;6Xa8hR^AҨV 8@ &錭~Ӣo?}U~O uLx&h0!0uj?Oa/:~F;=V]Iה BABH(lcVDH~؂|"pT/|UgV%D0gl|j% {=AH & }mrk!dڐV>G_{>7rRKl ʵqq_[Ouۿ'rS!t>/G!n:YD5qE3 [Gk %q*(1H d1e,L gxaImD'}kS\:ҷUkhKK& nVT` CI|_@׆nY7L8GGƂSu\_~7u/-ˬ-9Ac .Ke<;9|ه&_磙;N\Lg`&P5f\ uk1待UKv,aB5'4߸c&2#BadA/j)B=% وu,FK T '5ș8,5O;bNwm}Y碫ԚIwxΜ#Y W\䉮$x' @яǥǔeh駉Y[Ff3ĉ$tH@ l,b8BH4F8_lyyIY|:T#rsaqzm:EtxC1kp{p>P3jf)&O mStz]C1mW>a'F;?8zXbI$5ޝt%"EuYi&5=[^/\HIdC*+j6LEY.X@CήjTZty_= I"mHrArI@#+k8 LZ]TlSpRT&# 6UPyhXםRllZ nIc .!Hj|^@BzMG-$Дnp&%;v=sB*hpC0QɃ  r@CH卙(tb[/"92:c *8=mgl}l4+nWZo#ʿsRC޹tbnin-fged!:6VLrowu n&k[gYsBv1 I J[`wt<=#iQuNp7\^E)rI8"Qe!ɢay-ipaiTҕ=xjϳ\\:=ûMYx|T~Gdx^] P;2T+*ʲ_3\:麵m?7ۣf_3]/l#kPLǩud\c &Z` Dyb}7*@U`ƳqMoT&!J{_  &ԺšU4zC\ MVw1)k+ft˻/l>=?J}h⒈]_aV]Hogwhu :JjG4Sy;}n躹Zo?nѣGիKO.%Mg?%iZs|C=w=^)hAVGNղ|hiBJC8d$i0B]UZU7׿0>!4@ lw[pOT#8I$rZK  |{VUf4PX Z9*@GxUب#||<ٻ%;+~zILb&.4XÎ볌y(S*?9;-/op߰x;:ԋamyZ۰XC'`;  0 J1)WMDeM/*;. |?#4Q-IOg7x iK/`&`Z0Z%o*p;_f?sC@ H"ԌF;?gnث~9m ,'4)^jXoϬƊZ➋ mek$S*xd?2,ndף_^o(ԯ N Y[|hތ؅ j…X(xP$rpFϋNPV"ƿ<}.4VbmI@w<9DnOU (]\|*SFJ‹>B(!U*;[/vxjN)#]RU$0 .A, q厇̽7'U:ثuQ/ОInSi7XqY3">󄷁&nBLt\v+џ=窔s>#?t=?gV涪:LjZNrC]go饁oO8WTU[EY%!>]PT<9d}g77mYؐLiךJszhFЀAhoYL`$٪U:<XKu)1C{8,͒NRm8,PED%($MpA] j; QLbG$F<4*윈g/7 N6\B|A`eɀTq!@93.\9? |{$%/m"4r46 ;{'&͝kKr[lShMm?J y9ޱuW$'F+8s)ݷǯQ>>bE"[+ZQ97ퟴkiv4j)R9AAEDPqilb0]uZʆ>P`Գ6!@$ǨPdCyKRcW!'QJ4Bix}ܻpG,][ !褸Z HGN$L+ n=dFJ`e &GYIfjeۤmeVr!c`v 2@"U"3,R LKLW(/Xf </\IŐCy6;+bW Ӎ [)QcGB a /1N c=ZŘjHVVwq*B p?{q>Pr naK.i'~))6ER,WQW%3$e<$NY[[:/y>t>4Css Ohm g{^ў:w2HYRʅk37j7/ )Tͪ} gc 2 4XA*8TAL ~ganpɬe}t=Z#(͗z!R&8$` n,bފb0zUg7KXCM:\& É^ҏC'=?HֿT[Ysu,}ge ULY#w;m`buġOJ^=?aB=o).b#cw| QuAD8(Qǟ*r&ȄGxysy%a3&|3Cf6x8=WN*eA`$BX,2H}6YMʹN/V#R ;ɥ-cMT w;b[ iٙ+j~mUY6KeA}0%,ޑ1;,`yFy'I+,Y-WjW}kvWj{ޖ:].Nzb#1x7="Rr&^~a߇H5qujj(点[{[-Nן bR>hN];~cn3c$B[PJ|cM$J[ o}]~{}w]|,1vŽ>x9q"_e2q<ގb'm h$N{"Oa!LثbltlHH0&3>4OGK< <[θۃ2NPqlϴ߹I>xSiTHy0T&{aqh8}˼T)D! :l!oyɷstvWvl~k$eh@ƎG ^kHX5Dvv3] 4,3).ZfopK¹*Ebj !vr/J@;X8e玽t\FG{r(I$4oG:A5*xث≧ n6訥ԑ˧=saIHCP02a~8z} /н9:wsu~C"u M D]PzQ&H!m-nT\>Lد͗Sq\1眬9(Ōp 3@jiֽayǷI ~ .0XfŘ[,Ms@ZJ Ĝi$ )p:Je!R+uSłntH( %$vrK*6Mb)*YQ)Kb_eAQ $I^RRsePIVjfjk岧Zlp40Q{ƺ"F_o*ȝk`\Ye ܂DŔ<ϐp0<[ _>=HsH@xo;μ1ގuY@TY}kʏbw=-lJԱUrT} [+ɺz9^̕vW奲+Y٣U` 5} 9u>|qW/6ڶ>3}# 4:l]f( rp#9w1ABr]29wk:Ҷ⢗ J#eqc'Bm<+2e撤'_%qP;?oka/{[_ee{3{pzJ$فY{^K+`hYwq׽(-+=]~8hUu:kxy3T:#(%EC;W:exڭ5XΩH^\`D`Uk9ĕhHǰd5R . @?%ukTL' %vMb'~,`xT$՟r=4]^$M!5Qy_ar*UOVEmG.%xs,̵zG"1/YJ%ٕ,Dǩ#J܃sr<ӭ9 ~S>?UI9C(I$3{t:Yt^ksު61p.Pc|f[ѵq忪}wdɞ~5 .2q 6=-g-S\1#8-p?8klb圱h..|_#3ބOZL!wZÄc3zǑ=#yjj?^+A (PH'y>ZRN[/̘ؼ)8lAaY(i/}SE"nss|*4OReys,5Aj PVbsC O"(]VYAURNF~SwyADh0z :S.`=Mzp%/d1B/U;an)x1kZ }pQVj,8^h %e-3AhI_6 x pd/ PB wi2)kF!M|/e q8 |n3 0vHs6}փN0Fq3/I&XKJY xYKB9n@<͆6䭑 *zܯü@ p m2'ePB8.}G_0 k{|PV} U ħcz<$$v>(+ O~fָpPYN@4 ]]@RDyJ(Y %ܡkP-~lb\S~Y bG8[l(3š~Ci_'whm$&!0"H(A, br$W>c%yu(|G;Gl'[vBJ\h \C ,X{QB6/:vG8gx\kMq %m͈!aH H*XX,Xu0*@PUUA*AE((,F """#QFQ((V*"HQb bA" DEE"EVF"Ȉ4AQQ"*(V1 ŋ(b* PXQXkUR(*YШ""ED ZDX(1EDEQb8]}i-DԦ(p$9`AtwZYQf#w8g=-r7sq)"®}boSmLtxzD\ r=qi N :&U7;z ! au*1!BnrfL+am!D#?#(2؆c3$M&*K3u`9zYt?,ܮ dD;=K(*<)^M}YO#Öb-ASFeӷM3a7t>2^N̢b5:MSfUF$e0}qQ<&EREšzEg~~ cq*^<)zȢp@DuщD^`ެi9k:)Ѵq> {v&xOQ).[1d f6o Qep]3̽$҂ x߷WQw}fpՠtތqpl_;(u<3!2y*Z5'5Z;.3ۭv_{vSLXYdWfՏ7_cȤ{ҦL?ǿHL7͢廗t_"?_KKԇu>,s9Ϊ?ckBDζ% Uw ډ@8dP$ F~N޶M#}W?˚_5E\7z6*>y_maz_yú~I /TP}F, qBÙQ_.m׍=|z_>oO_?rEEQ* Zd[T٨<DWughgy".?*Kڤ (T8JWd-U!-[lLZNoȖD p Aŗ(ǣMC*`N6HHۧ Gr6HWB1ζR fg߆7i8dT~MK~FrEO~eKfq ݸc[iڼVY"ˮa*:rm(zMm[k1 "{;+ xwt̾592sW̟+xB! v$!M6Zc>/Gd2_96 u}NZR&/0g 7.QܻI(+!AMDۆdGm6Hߎ@)ρr"0]907Us)KԔo#쁡O9%Dw\zН(sO|͡ 8 xu &2=J$ZH8Ąդj%JfMbX6㷧Lʕ2uGGqoWw4h{p󹟲TIQGd@I+t@$J +-4ly@',z<\!Ҁ a4j@RkckDf}W4&id HhBp(=d{Bk˻b"ASZΟ|Bt1JC/RY@rD.p53 #0er.;@1 sOqm=غeoOs7._RlH~Ȗϥ:/wBSjs,@N<_Ŋ7R1S;Qw2,r^/ t$׮$*ci?[UiY¥f@ҿr$s]҉iFZT,ڂ <:fMlB彪 >ޅSw~HS(LG+{@/DqAxy { iֈZQG 4T7oJrVUjD0.p,֎ovX=W[q$L3U:\',坍JC; &3~קV>#ܷ6AVg,?`P@o$`\ppD7]imYc3;,璳sD6py x~%1ϟFe$A&+ʕ*Ƙ\8.nmG~"<"+_IkH߃K" ( +"6wKşD1Rch$GViljxsjZs<֩Nzm&\iy⻶(#Y1XS>`OeSүx/ 0VioAVW5jf\!+ԝ5f;[~ñ@2F8a6Z7/1x;0J6C]t89%!tߣݥϫ4]oUQ{-pc!I@ Cr ZC!~>x4qzl7z/ NS.EQVB~ߛPޖp(_$%"7tBaC(/)! b4?[˦BQKp89dq;mh-߭5# 4ÔDEVZ`x.Aa!*W[p ё&fe`FLv4 FIdI &scsNu\ =!H " b*bC8#3AbgL5Ok#׎0GMMZXH6%f5!Y?kr;(?],2u%l)2rߕ{ 8Qs?4ل!#comalvs1 5CFs:S^ũ6[?uI @eHR`E͈|u{ji QLYò621)LfO 3\M Itͭ!R$|;Tp?+M:oބ1qes#3i͸!^#\$ 7i3Jan:>6.T+ R8hH,ɱ}eY5^m+,S ;ogpujw8~z~D= t>m*~ṞUr>Uڵ:R{{il-GH)Ƞ6G,73y*5bܲ_P"ۓ!|x+¾%,TSRLHNDɸ%1g\gC`ʅ=WGk@H(آT 9X( 2‰ ;.k/_\(e9_?^U`fCD(gVry(Jb*Eو_:y􋍭PS='ggjsȸr`}OSj{ڀ 3<"#{Z d$sM6v:mʓv_ܺn0J|j 6Ekvv >BBe=wv8_涒㞯kf]K"--|Cѿ5`QO:dNOGєAA"S.s:jQ9?4w9B%__04[hkd2I(;WGξ <_oC  z9W|fH)=̨CیzXdMb9uvb-qT9)Q_Hr-6Iu?'L,КW2kv»O'A%۰ &uWx86\u@돰%X$hΎ$%w@R",DF,X'[=o|ϢXUGVpZUjֳ[Cacj1#(;E¢ tX4!FQ쾸sP20R@u1w}Je>>WPF ;~SEj6 -eT%]^MHTWE ,;2M U1 ҫ}*FFO.rɸ3s @!BgkoDjTU\y:2jo΍K[`,2)/Z$W|/Cfc_ꗝ/;|M\\<ڪ&E5)Id}Uf6 PAMЉJ <O@+$2H t;?Ig4tn?ЋH(AU*h6njmkGNAY0ȝ9x'wkFj ((M(( NFV֘iДH &_|2v5 NWu"{X @H $^g>=RStT/~6W$W5-wX9/_WqQ$xߵm5u* P lJ{F`Ht`ލYȬ:F !C TԊ,3v1> *`Pd`äͻ6`L3jiX]3^D4(wD<ح4mg z'CV(QuPZLf N`6UNIONtt$50)+n(ZY%xct S+6{/UoYH֣ [VvUUҭ:a]141_A"mqtђ[fȘƙcEaZڳeVZ Ng F3 6:sZ ?^5RMśJveTBZE17QʴOžguө3έfF0 &lfAokX wMBȮgaf2[A k"  "./\o^'qp3y.$)wa{{ogchs튣 2w\ߙw>!o;뙀v!'lM`Ng|f*x\5ˆ?Io &l)aֽt$>?zVیt,@X{Ϥq6s}} FJQ))]nY|Zϯ"cH0$kyٝ_sNNPc\$NO'[E/Y>w+l , ˆ)6Q,lha:1&~'"!Y?/@lc;;Gwa69[<̳d٘hUwnz_C}/qi>w$q Ѝσi6FP@5 .5'dH dsyL[VZAPx{_”«} #1ue7gO_߫<*p (y6@".8HLN#7\< 3~_<\6 \˭-R4IoN76OO?Q2S$g3]bvH dh1`kL}wNe܇z~O !6 wd}Dl-@ؒ 8>Ҁ"3>6 (3Btq, q9'& AZM-+`a̚7Hl6=I.x(Vʐɓ;C),@.HzHoCR!10*/NI8ƆUF؆ߩvuQ$2DF$gX^b%.F WHHfhbո׌*,c3!ql_(ayPb-| l_ hm*x9o ߅3NԼ, dK!1ϱF XVj+VkG{6)riާk8!nfŒ\+Zv:T 0j Ё GD &NEӟ\QmĝBW n5D7ηKKZZ{"3TR [9[dƧ4u pÜ]O爵۶@JsN=v_>>aQ'm{ߡ򉭬:S8l}'ϧ6T"%*Yw e$$kD'\ߒQ&I/$aWwt[0Ƽڮb_u}p)><-wtky )G%@A99q/=KhJlEy~xeH^4)*.&KR)S&?[Y$l$&R*tLqgOVqje) mtLtذn# (T!oBD0D|Qcw0PQGBd˻^gd0-`㜂.ϐux(3aQG|O e`TdJ֜*K1UkA4b;fQTK6oƒ:~\C~zewsNILo5v/:N&/PAvQQ̊L-:7g[UCs` e)@^RL]7`RNf; M:exr  *rx+6B=XwY9|6diW<|,1?%kg|>Γ?+|gm:=ȼG)BJG-ɮq@)"9Ί}U}A>Ӆ֩kDI~U3f.uHO4/μYoSD$]HQ0G"4lCl;~='(eck|Q6"dEj4WzM?Y >I3O2wq8=-C=wb&@2O^rC2Cd;):oqFnnݿTyic.mVB{$ᖞaM"^tvz9~JXKP$7ÕHֱ?j1p(,<61K!in=S(zl>>mZ\Qyngl=#~x~CC(H`} {nKLo,TUisщhQa6l0BЊiY <d.oCcC!d~TF>A# Df0ec '+(N mĩaS3 afaZ/J-g KR ze'/kjt x6/]R+.*D&W+* 8{5e↦^ i]T287XCqrh7kIcw)oln;dl*Bsk?u]!pXu5&LcTلӳ7a zE/7JYY9?=mWsl_ܦƠո*"KF,OeMEH{DF*_2CER1D" l3$P 5xj"N$W`~T$#Y=k8,7 ~Ƨm;s _˺bWa-^Oս^n_Iֺ~/^{`t'|>]o/;=w֙K*<0lo -]zH :E6 & Q޳>[-ğ:TT22C{;~.O0g;Spa В#"m6I5R} 3ߵY(*8|ɦr|dHE: 1(kᚑAUAEFXXh c" DFR""D$I (@$DwfAa٨dШg̀!C@i/#fjRhUQ: وm,Цaj%2Zy}L^7x\j1Dp"6"zϳ?z &+6nRDz`Ȧ 5x$#1g 4LlHd@=1mD[JO_FkmKI0qY\2|J)~2K[,1eJՁh\-~2ʂUO3((a<kx6#K*΂%њ# 9Nsy&[61ciL-5cRi|(?mZ%又S[By8CpIQc1''_7 yه`zxrᚭA<}lĖLI%:NݧYNu.ҎꛛȂkMyUAuG*R|F朦su^5¯1t4x{Yz!c~orr38nW1j@H}}g)e eFP,HNf-Z5\Jm|y$JR[u2ܦ cY Oz. CGXX6\C͉hs=Ҧ/Yvck÷4{vP41Ueq߈-$Z ,b)03h?OgN21V6jc>M8UV~%b$9Q ƱtգU6PVtN)%%&1+:` , 6̴Y8gBŚJº;Rrk'GU)IȄ WUB bbT  ijʼ$TAL7>*:3)Y>bK7ÆLauM};8Nٟ4ȧx_HnyS w)93MjBWsL>%-hF5ύO D؎Qȴ$j1\\^]N,a>}V[usL0?TԖO̥'35 D+[/ ;܇T\|gŕT6 ǫ ;ì!6\.R=_pQvN L\5hwB=b"(*yy|n" H *հU>}L>tv }CzL$ᛂԿ+_NI腢쑎e4^6۸O{6N܊E" 1"Ma)Y8UK~ $%CoG5 fPeZ0DdQ#Tcg~׺+&[/)GF'y-漁[s>^Z#4W @GݸdPkԪsNC"n@:`T:4^2^GPugfBҭN9e6cg]ZX /!+Q║Mhdn= }P:hY#ePY1XX` cjx~zPBT3߄Շc iVsYBZdUZ EKF[+7v9m9 3ښ,7+ m'Et9ч.CXɛ@^ $kLBP"T4,e. k`$Ǚ]2qcvddE[D005;)km%\B qːJ˓`pÍgT?{N00+ob @RTUFYh;1Zr`ŗ}|뭨wTnӪEW74R*J@HPͫ!w#\G X,;jbj08 8>?33$EE81?ѷ؅O-'}I_d%Xdonk5w 't5$r/ PF~HH @1!r` ^| 5Oh@ZuƱҙbs#ϢQZhٿ6FwȨBoG#fPa 0m+&p-9A, G Rc਑*'ZmEZ̕_GW -B!q 2y"]U4*w#ʪ 01 XCߙ@_5HZY(!I=UaӚw? P D9B ztԠbH$)b1E A`ED BI,$dBEBD$LCzNS#5s7DsXW.K-$ffI HQ}ߦ>siOs+;`R߉:/VHiI/A/8Be#oc b >V^ַz5@vdl6,qWի8ˌ:"Va~]( y}4ϑN%"FH$0蹍ˑOo PQI""(PDD~ЂH() !AEYH#E!b OlPvNz/K320z+5]߳wN$k{%_NǣgA|\Z*O_x/;Kԗv0%ْ]cġ(.1Y( E "k_Ļcc0lS.fiddFG3m;cna줐{zX# $ 0bE-Ȃ$*HQEa" Ad!!"`) TH dY!𼎎x!u/? Xd/le (nY @S@$]M]pQ/L:l/twdwmN2**"BEQQ@YGjz.C G!s>knޯ& "(, 9v;n cw?ow!TP])Vq:5**PRx;{uoqNΗwСR ugBO[+ 5["C`P!$9ndM)SE[d`CPt̀PQ Vo'Poݼûˎ`<;tCݬ`9e]bE&b1f(z9Q@`Dzןȡ7ɦ rڝ?:3jHvʞ,һ@v~{ߏW. .&k.Zwi;UcOyJOQI l?p&)7Rg$*#+U{{$0&T-]JAlUŸwMtDn78l mmWȷy~p^ J},ds4jSQg6q@JT>#2\Q$l{`fxt3~ݶ qoV_O"*4FB~&Fy^VgRyw}қ[vL '*gNe*y_ƵX:4?NM5>!>}w%0ojc$Is"LMqf]+yeT=0ւImjF(!{SyFC@6\_S˹Q0 ao<7ǟ}@%RlU"g^c(eʓ㮘^Qf&8C p⸟<˙a.N.|jVEP< uonW'o6 b|߀e1m`yu"J( 'hF甎:_,Bn0>>pƏC{00A5b +?eI4YW?o#nhVi|;NL zTMY}+^bf[/(<y lbP}D|Y!h6J"[o8^?y A)I9/ڛ*DזA&kI;m1ӫH)Cݐ0v M֝6~hظ; {̘6?^>\kJvd PΒ hw @J!|ߐzs)""Ý R"bHgC$YDT a Էq! S:L>Mn+j_D!̌T|‘:1͐l `H,X# ((( TY9?o7bR)PDATQ@ )ACrA~ >>l0lCݍҠ 2F$";ܷ{<CVNgm.ܥbGCOֽd(Åv鎍(zvL@kM6ͅ \jTvHj-_آEUP27ʢy:s򫯜Bo ~" a4Y@ώK /-3A% V4FӺW 72'n)H Sҟk$6IEw*c0'ZOMնEEf ٚJSfO%@JR29Y2Ҋ e&!6-NXg(R10CVGЎm0+]ah)V J8T@_^h(TAgu9 1!4X$F{Svm쩡xpG [DB BEȄTqŷxcJfp=9_s]Nh^9 WX/d!݃7 ēWJޱhU$QC|ev ɰ`ڻZQ";k73pԩQ҆`& 1ʷ cZJV #+|3ԢɢI 2އmG~WS m R0 ʶUb̴wewk?8X/g_ٮr=3\ 4BNokvE"C%{=KSxʷ}Z.18 5_$0m}O-`dE* %_ߐJ.÷;>:UUE%BĎ]bA}KQ`4`xX4i; B %t\>M# ET´Pl٥if.+# oe~{DJ[*n'MZ.2r%+9fI *:}rۜElyFt f`E&b,(21:%Pxʾ*N3vd{RDT-`NoH6W\ B{\NPt]~bc@$$K%k'0 ݩm8}U7EH,PQdt{/8: Àѐeֈ ~ANg]I]H)U/K*ʺtF?e4Zmq_kSkٗ#Ό&t-W{7yع4jj±kcw&uY۹ͫ#Ŭ>[ݳݘ:= wwBJBDdm_K׋󣰐b,%w%>-0x0\`>&ڢڊӟޠQLMOU9"OOX)">l95Ps{:FR=TtFhZF2H$$R'8,i }DbBe@LL"Py2ZNyۂ F- r0B>7n.=x3'w\4j}42"Z`4~8MiN(ۑ4"G,HTQޟx^QH1@5!}PR FrEIz$Bq&)vC:R18hb #92&6jM4Q(j&*Fƞ!TL\VeZTBn +R2(SbHqgPm*T %yU\%F=ņE&%&!P{ h4p^#N>]+;L33ZU X$E]bWHt6xX[C-wťrpo{aMS֌NX_$DHD/?ϰ~o471*E%F3&ʦ%K֚[K\Y_F)i"[d^RuTa=4gZ;·sZH$πEo I ¬Tے>4ʣG#0H+U؎y2gP׫vΞ= I0nuO7~(@&Ѐibq%z(up6LX2RFZT8IQi7 5ʙ폌>{m-TAYti;A]+JjqSaX"myҺ3r=K-e:š1gc)d,&W}YC(Qa`>?JV]֯A޳Ts+ kn 2E\r[G- j ]bgQ1YBG!0@G\rVuVNfп].^Pҕ8 a_gY̝/Ѿ#:9^\ry ݐJ>bt3d⟌Wz(8HR0;e52sb"ꣵw7[2YE=a}ou=ݷ ьiW}W!&ݷ3b.Ir_T0soD{tWn[hSm "@-* yAxy[2\0SQq>m{z)#]r4TUWTԛF"X(Pjs.`0z{kt6dimNўb+@zA4sL\$ HI  Hpi .DgnБ gIrw7@JNf$y#[x=VO$Vy[e| +Ag҈_K,s{吢dH!I'tsfڥVm=Z%x|Qdt<5Lyy-d{XuD ]0WґִQf~E3^VȾ>Gc[ ;zick-Ԅ%zP~WjNf 1` i'5ݖx{~o XYtcTooؤ1߶mݟ~+'}M+q:[޿tR^o7m]Ch6^.dnܞP L7&0 =tg2NL?ͲDHNRlsn#x0X4pigFFqmF`}Muސ5ָa踸$HwIs6o]i_Z޻:>m,S`wȵ\[XG?MH5rW @ymɯOVZ,+ǀ2my^D|o{ocL;SȢy+[ raj3ư.Q~VD1@T;^`Ah; DYT0g*{G8M=v}L#zIbLvNmlyGC3:%LDNŶ"ADREJRu9ez9_ppiq>6 IƩ>]`H 50<x XVe"p4-ng oU;3^Y1D?{lWbhAҭeֲwI->0@/($NŔ6}Dcz_a _(֞X#=T]BDhp{z`_?tSKծְAY2CB2Ό}t2l)Xi,u+sR3CۛTBHQɫ[76Q4',_sSFG-[{Cvޖ`J5[Uf.=olCR]]>NMTkJ q4<Ķmpl#炼6C<(nOig_TtGDtp߿KT`# Ɗ>4\Ę4 .Ԗ!e6}RJs Vo&  iv ;4L桥>PlY"gv^&I ȿyߥ`{8iQfa?n:;Bx_ʭ.. otpg{G.KRN4M18$m Yji=c`0ۺLQ5$ E1v10+ jү?tȤlF$Q[M:ƣ<4IB>-bP$Qﻥe+ŗ7G $- .~"0 >Ԝݵ&y:^]J`"{SEI2,0r/4!rVr8\)%gcKe!y8~tlDKۍcX/eZѰꕰ\-7Ir?'AGnHqzQ\|.13HH%"#Hӯ豱{\E-'w^\$_  H9-=$굍 5 06,YauC C!gdֱ29 $?~q!ZحsoߢldYCĄsf ?_mU~*3%-!Sz^&2rn S -?s`Yǿs;E&o`ϚNpռ)CEӕtJd>A6}d~G^HAdw6T.s7!=?$)Opoyv7e>,cq7ˏW!NP|"p tKB~8:%44ƪ"2O3 р*GĎO عO̘NYu"AoKBfb)_7]*v[)x'b9dC,-*K{\BJ %zQDd'SeZ.?Z1T9NoY)Ew7'u"7%pʬlۄig/{z-I 3 sVl%¢B 65MY>V" X>)infb^ނn`#ƂBMi%&&9R-ӿCs7.R}25.u2Te1QGLa~{(Xx2&j]*RIȤi^)!e0~뫿k"]k|K۶·nC#`Ldb]S4ԉGEQ~1?R-l{6 &SމAFlBr9Sۡj/` 3Fz,)8|jx\ϗ戉?Se/CXwD=vQI {`Gx,s{ D.Y(\DcDww(RۡTb!`P0*]Y 0 ع_\DBl(߽Vo8'|DتUї/V m+ʭ!!t,,ʊXl-K N5,z[*In/Uǁˡ 3IYGک2PQdJ^^X?p|cGuURٜ=X?OgC7Gg";yj/~;쫔%տqշ :_4}BTP'X7]=Q2ËIM&)TRڵiZO=N<넯` s =6UFբǀ-~g#oeuX.@XX(0$늜Z$lq>:0#4V4,+KRŔ 6Z1V`xC N][bUnX(Tz3;@-5 Ѝn*qPyȔorsGU*TOAFݙIڥ d-*,:ȵ4 $unr BYDrD"0Icg)_&ZjїWȇ1~ۨ_cHB++e!xb!bFuXRp]UO ]rK305c:k5U!d?S1gPH@CRhB&p?.:V|L18.kw)Av͐J 3Rz&js{%ѸGIiR lYz.w"Ɗ0ɝe-eG42UX8s_ޔ!Zó ͿY<9{.u *$O/[/|n{tC8/)Ͱh`X5>7hmRĸ _Jm"<" >=j} ՟pٶ7Mv˔#Ezb$ZcA1M{GE݃Z.m5Ok5d{ִݔdvJ_UA1IWųk|")907Y7r^7koSsX3*~GVm`Ii;%5spۻYmýGӸa+fNo}-94N8j֍QztP[TƟ !!:ϰ~ _U;_4e*Cԗz(")-R , ʬDQ,HGٲr?y_a°xwBl͘)*xD "̨y׍3_KVm䭬JTHK{`/@+Yx[ *;r::oX |,p8`Ddb=\{0fY3&98s%dSkmIJ/Ly H$(=|t#T&#~0<qX<7u_I*cƧµ}OLk:!gMAb:~arliE:\_dF<V%&OZ `jގCV8^@shj#,F^sa5M丵!z35aS թN@ tx *œ0F +ՄM7^;-a2[cN&=>*I RqrrhT3(P&2".$niΟe4N!#ˉJ#C-J8^[VBV!Y|"=LܚF.9zCUf~cxuy֤L |5Ew؋(SKB$'p4X2~/eGpOÂg3-4ͯX0e.Th "@,Jqg$S }uy> ֶ_c |:c`Io.FqcfJɻf9ŁфZ>qz mB,4ՍjئAVΤ{߿=^l[F\-C.rkvQeK$Udw[4)| H4AG0kˍ`b ч.a-1,{AUlU8$厽au`|gSs)Sn{Us*NkZ!JcRqmwtx4/F6CC#ytmWWm(Cl+C=oDl/]7X r&9^d}YF /va#l k0H)@P !K:\P0O6jgn>':vz43 mj9?W_El4 ܯzfyJK{>o#3Vl!ηF=umyCPiND5ӧ:z=~9=p/.jZu;ton^bqP$E @tCUТ@4QRt/^4"yj<~h3L>hוTdY65 0+9?zP<)΀97ݿB!d00A='}6w8^FU]K<ٱ^j$*R\# !zԺFw0BC5lh7dAk9ɃUxΐMT yaE?X< | "-~~9Љу0,<1f]ߞg+ DW:98j4.  Th'B0 6O k8"ʎtrF=z4sKrF*%*#O2Q?65?[wL\Q^P>!erk/}oVY63㏵|$(0Ƣ`ry;ck{<^n Nϴ~FsRkSp QvY 3H`YnU1J(RP1' U$`J*.iWWϴ;zJd3+e7m3zii>Z7 ` f_ڵ\yȃeI/UY( hZZ}'=Y`ɾ )  ҝ ,!,zIIV:oi)ΏUҧ;Dk L6W ˇK4#Xp/W'kjk<)^$[_T#ݎqR;¼YS2JbyPN9ֽݗc0qܰƋ }u>$ m#T_phn740l%'G\?>ALټ9: G'l7V;'^pgPtq[P?3!vBywl]u}X9/=5 tBӞwv3I}y 4vilЪDk؈绪5ֱD_k % B} ۚū`eey8o#na2iO gxɎ  BSq^nq"[X {TWvMo{bM뱡Y;N'@8.q&):\(?׺汻BȻ~51~\.oŮoP" ׷b=~k_{\*ꯝgȚxKG4bCA- ~4n `[dɈ_ !t0 &μ}2 "?eU10xg8sgAґf}I(}OI8GϫAMSWnG\@fO\ߐؐ!=OX:=dT<*Vm)k1&۶_(7%' QH~Kdʜݶ2|Wt- JZ,WΣb˃3) xSlƐJP8UWa1hK #ǎ"L7\nP̡5C(r38OĭxN% @ BQ0BW*(3DE.g22qp ܣN( <fTqƜY?j8K*!s5; `jr#{5ʋpڏ pOcH]f:,eqPV̖TcH:724T(ehV>!A3 QxYO5!#I B[ љsoLy?`/36yqF?-6BX6B{u1P7mhRrK7[&~SByB  (\W33@%S'ml6ׁ!30]x"u,OpQnPZ#P}>","ro/|m*7 l |gy=LI|-b&^s G|j+<2lBiGOh#lr3Ժod(;|ZUr٘ѐ7a_W q=7\) -G`J%lIb2ߡeq !%~L]>=4\U]=7팲 9O!O('0'FB;ȓkJPyPRۧ 6C=$VHʋrm7McwGGJ2E{x%c(Jjo(~z5>7~/3)2wrAu=cLfoxfئDlγzBLga)h]S6ݤ%H.2m=w᚛6xFO8P]D=$w<ߕ/s/"`uLXE>᷵#Iv|Z|ҿ륙Upl3ޠDl+a6K.ؕ{}F!l'i'6S+Jڤ/In.J}\ 1CL@o X$4_Jº3dP8+B?/R9 ,f[o#JI  w{+3}=[Ŗ4~2o:wYZT̴4>=fOl{6_'Úi?MRAs1y!<!4٥ #,(/P ܁ S18ԖW3e]kƜU#ҏr^`AYz./@N#,-:ү2gcy| RLɫguu˵Z@g?a~pMilBLF9ٕ󲟟cI)1Ey:ϼj+CB  hE$aё6L̎gVfzU}xU/SlP+W͞zҧ%JQaIgʓf촖2eC8xR$S-2]"Զ:e'ldi}fB0I$!k`A!n?>%TH̥NBh"I$ yJ ],ַiZVu_!Pj4tT5wxxH5uZGPJE1r]bq v-.f5#D*7! 6ٜou:MoQ؅d#36W-`"A !~ES'RI+.feL/I O(AO~S*qe0~8$F**Y`%1ko'7vS4.N[^;/!+_0䍎hal?_gbE_{|X7T)swztIZx~Mp(ߕA%xAaD J$˃yMma{jkCO+5e(˰I_:MU]T~}`/0ُu_f9~^td_*3ٛ.y׸Z<搴=#>|)MGRl * ӫ^y v>0&#O> so'ka;e [ڵe ˲Aݡ<]֪rLP5֍g~f0m;El$ߴ0!d^aַX]N@0kmG$Ytt!YCmP?J.0th~){[30˂4 xyh/c4I&( d%ms%C_y'?}TKa 镦3 ,iβ(In𦂡DZAF23PRئ^+JF,8oS3}k f.` :\ DwN1_,Q qL7Lȧ6NxG9)ɎJP*H H@H%X5G)/|ŃhxvsHђw3^6[wp! n mGLsz@yA s5dgE!¢=DOr nJ]ոygJd=poQ`9+ 0: '7~R6$ A9K_'QyR<1p@+0D7Sְ2h2t3tlcM[;a`(-t>?u尘i챃 AL ¿H;$i.ϭ1ejg^Z 1# 4Yv&(5?xwzM}܌g:rO}O }xdP@t~(RS>ZP̈́%+y;ݻ[ǧ[Ȇc)8j@Z08  [~b>y"wa>qBNtB,[LڭT#nuօ ª,}n1͌C5qڪ dמ bJ=Y7$N0Zǩ@^So+O!诸ܮl[V>wem9SƄs9 }vXSI4G]S %U F KTn,Fo婑V^ip t6ώn?elu: -؟PeXSp? Iƚߵc *)h*6rAz"bW =;#y_1hi2/u >LZsDCt 8*`vU< *dxϋz9aWXPߊBБ_xQTLߗ޴H+8QLg"TEGuGu!` bI)R{oh=kJVẠۏ&&#Ȗ&[*" WEQ<>.ziP5 }RJf==s1hs-f:o9{*/xyZ<W/茨 JqZX0ݞ'AY:TTq #I]*mZe"sj5dE@D2N?o2|.{I40'+`42T,L[~mŋFaXxV3PAa.C|Z)2Xc׸&֮\k..7vJ0ޅ JPNb%؆V .KL`GNV* Anu\R ZK"oLJaAuH?&ǩqͭE19w76YӬ^|Ȼ-P+]CZgC6L{Q=_tζu>f]{sNouxr+1 Ih&wpWd d5) ifN5r<-S^WUDSqʂGl} ğn;* ^{Jziܸeu(D!V!H_5?O:?=tkjh(ux,3,$R:S;/̬x_IkP3@㶔ް[{LA4IR !2spE4R搒'hDW\9fv5yqt?d1!@4, icܞyA:"Yx%1#Gr]_@``g٣iIet*PG!*TpeQU{y;plf\)6h*[>Qeus{Y4%Ooc2 (S5v»;wJC+02'𪉕әvr*¶~E.'*lh*fJ h.=iyԴژȊϳGR31dΪ`n6CTiThѸ+f4dtGMt@OVt@bhHUtn.:CӚQ89LVAqbX:AlM6Ck-lM˹:D`펬]~fHϑj&2M/R)/DxsVѾl,g}`0ư8ǿw&8*iL%gR:(fA |-(4uhx~8l+@mCC } Jqzi]=UJ偨F)IV@dIÿ˺yIиD`S &c>Lml'V)mqlL Ŝq{EMZȝ^?i-Vmc9RޮPNGA >>yؔq>vmS.AaŅoc3*h,AOZԬGLL&K<3aVUf(avYLgYf<j4jGimo"g5LcYƅ9<|dc6v%MYXTmdkX^,"TmU DjLv]$N,R~:'CEȪM09Y=g+a^d^{{X+rշi_v_SП ƻ "#1<6`=iV d{DU5Yꩣnl\ .Շ/DO8I*6~N妦eaJ ~VرO@:Z/ VKRXR( @ye;( RTڵHfSvO]"nP(f?lp|Q uU{!$C_؞US8@(ByhQ=zbqm/ר??<K@<-#Dv_I(T#BWM1 %z/-9j4yxp孆-Fw_nl>ڐBbx. KҌCcH)i2H3W2hG[jӡ'C/- oWqͷA Pd,,J+u2B7@yA}}HC HMj7<+oEM)X.$gP;@ +Olhyw9W4lM:aMWQeİY/z%GjlHߴ:+[T~q@ĢÇ1LnJA#׀!ud.R iS YN$0IۇF$! _iQNJB7= 6_>fScRpP%^J$&/GIU~?~4lɺϨ^cvi=]΢.pǐ(thN&1y"QF/Qy=Cc' &yK^XQ~] H#4e Dʵ˺Վ4j E!pSx z_ȍbaRɾoҚXb.C5S.Wpkp-,Kj#YS*VtʇTcUD$Nh`h U& 1Ga?UО=o+0< -}F1:u;%DwQ)&E%C<=t-hOf{Qz{i !y!rZw|¤ XhgY'8ȱ/rj{z9DV VC F&{3͓dR)=]>n&+͵lCBjS/VHFYw⺨*W$TVLE?3Tprmv"w䍎sK)Eq2Jx*Ɲ4JVSYb 9dFN"+0 (VD&bpWLn68JzøS72˵)mIu RWryw'P)뙏jdl'!z.EdbΧqFD_>_;:Hpif6o$fc0拏̡^L(;F3r44yrJo{Oc߃r¦rLʆP$!g͜߷DuWR:{h붕fUkVOiVo~ʟV#Uc]9g>?V*՟GM#*b).S- Ga!$@7[XxI7z%yC 8%ca @G\G H$y,G[ ^L+0nm#1!'Ej,]9O>n;Mv7儑8媫+;Cɝ-'OD9 bxo d:xmӏCm|Pi{WSd 1u%:v׹uZ9YC]U]5Snm;xN|8*Y_l/zj _ g3ͦr^5bGoE ѿel/1OorDWՓofClZ!Ŋ1(3H T&QuQZ1tYgLnSA7N5E-B$͜dT5tgGy*p toU)6ýɅ5{=6;Tl"g$_fyG kUݯnzJ'7#> eG+nϴƂ2)"2k]ȁ  $!!7=x`qMة;IxЮ+B~oׁ["dM0! ]02tǣu3Av|WTp6H(zYHųfPW?i@oz,;)=Bi#q2O~:dnfvMH-kxv=Mx:4Y2!K&r*{e4w)|C)XWGADo9 Pk v"`Uf(G_ז[N@M[͡/%,S?NkHRK;wt?@RᣅSS4"IP~d<љմNn1 R5vاn6gq"LBZѲ78ݝcp!^ f B`zԡ[//V bNDN!3 m*Q+ |y#f"I"22,"oS&}KW[zK4NR2}) o(9Ni?$MA9]}? {D{\}/meU=vCD~o)׌ Ey%dudkOwpGlSpcf2fM$ T8wC@@"\bRC _ajOz*_ZQΈ-]ῇv|7OD5!&IE1t,[DZt7!.Q\ùY +tGsT d:3s9NCVD!2=+eZVsϙ}m;TO7Ҝc"Pof.-@_|>d, T[i#G[- ׆.^wq~M1wrӢIʅI#0V'PsBu=`č! ~ޙ_`n1]d CY s6θR܀1Ø,&'m} s]oc:LݑV~ %0)j ݐx嬏x!=5?$. Z|}zL0[>egW@{3ӥ((d=N&ٽWf3߿6Z63ಾLd!aPf&4 +^^(S,s:Sr>0OYiBNDJlgҲb 0)s}v_ݍ:ye͚qMJXRs2d%rt'4c$2?Ȝ4x(og3D1 %TMlDu^ic5X6XY-u.?Nb>9G`'G[I*)#;v^Հ1S.drȏ243_3"u~bfA 7( F9yEzWe֡J$c'1.m8a2y@TOY*Ә?+_ZDӺ b]obQNY;bq^xQ! MIN rVҢHT7 3 p4 $lgT 5FPlՂqB8^#Pn<%l:C0ѿAʹIfWˡiB K-+j+YQ%4kf߇gCcR2,. 6%7 ?s?gTcC 6ygS%I[{cgC R{kgw*.=awMn?XD+^BcqDWQ1JRc8p9 2Ie{rHY [7V-QxGuQMhbEĐ 5,۪e5WW6q*!wz%Lk$rfy+jPVXƯiY4KJV5WI|tN%y˳"Ɂ bі\-IM:5FV'g|yw|Hfh;1soueB*AwX~u5R^©D חJ @N@L9JWU w7)NR7,Ϧ4a\:Jm7ͪpRuq8 :D-TOø/2c)~O qJMGQսqߌRRhcdZ lMR)z !G s,lߧrE|Vi@Dh E~:vg8|0I`qV(~ǒHCQ<˂<-y}Uju[f "JE!|g$q݄˗cX4\U3;[sVC U dі4ΚmA{k&e9B 3 j]B0"Wqؙ33ue0oM6fIb7]}׻?ã8_>S|N^^̭N|jn.r)ƃG}bz0V2α Vp+<_Uޣ;diT5L7ݭ@m$4X4P>\^=KEzZаƛ!W פ#׭)K;y %K] "OAM+v\ {)dsW] LEz~uJ${͇awנ\Xd;tNIJ;+(YWS/krϧ[ZpQ@( "hR[&*H^[At)n`V25'cRyMdZ弨9ԕk ,| xfPgc`(e0eȥRK8Ҫ%@b9 ,Z;ɤCtY މNAH߆dkY=eqvH˻C*A)s+h )Ė̛+74`B4*'$A{eJ8 NKkޒ@e^ǣ$3T c/jExtd*S}oɲ*)xkλJPG?E/{,  72NTqfPJ@\& 9o##=P[fM%ltyʚ[]bau5H+!sKo&pzMpڣQl Jc }ЌfZ}+ʮ.gf "TgFLmaO#Ib1TpB[H*VO^lzK|C"7D h b_#EquȘPBfנt"m:Bk2G2_( qDqrTxO,>3*/AJQk|}iͨ4e-b;= vb㞁߻/(9@hJs h}*1b_Lc'\H@3@W2VV OoZDfX@-P'&#VZy܋?~)g;a~AYJ7 ,c:f6bb>á N?~g2 *Em7o24uxN\FxDTM#j3(C{Pi䧬5_ﶧ/u^fje9U iC (!"CMs%{kg R3ˉuTf7ڙOTS Ǥdb]z' ~&l߻ -z eB :iq2fIS2Uf*Lda ^ (Xd?/*TZ H/ƽ5^_*O۵G8'kby@q>dȾ,7ɛ#s|)aK!,̿T'q4͋KvřSXd_ =jk~P:vnl5  jU$DF"{1/ƫ#*2a(屖pgt11@(?\`427e~fp0fp?1oPWq+hM;P΋iSxup-5Rd(`\EK,$uS|bjrpcv -cVn Ŧt*VL͢r4gQ#H띂57j tSӞ%D0v< Y uRӑ~ Ɍ&p^sOE zVFϞS~S|hZhjJ D1A(W';f< NbcQ=kxn ֶ7/WR`IC-S;ݨ Mx%,_0zx?[zI$«̱r9K]T}&4VKg& -![7݉GlO߻/?.Ln%uxzH|CF h,H2'S?Oh7#J`H~jYM:kok&T"u^E*a07óPN,.QEE"G9u-(RbFpގA6m=N?QHUU\R>Tdqv1oeZÕrͭ Hȶ~9MqSˋDvp$Q8F$ Q~d[cmx5ܦnł6*es֕J)qh.&lm 3xZ@,'Ac]xEv* ޶/?4i;"}Vӎ rCљ n2ahDf\'x5}R,%Kٟ0\p:m.N F*V]q$ݚXkK %(hXXOgŰ3( Ǘ?_gySEG8̄<"VbEb)КxJ=))14/fz[j4P5zAf#=!)V"T =fKݥ# vz=6'ဒ7+ϼA(IrTLu +siK=YƂȪ 4Srjl,K$'Gȵh]A{ ڌ@ʅ{O+H.qD"2 Y1 "%seτi1[2ScRJZc\uƙzM45ԲZ@ 9*D8цۨ*@_ŋi  ]ceV%?0:j[Q.ʂad|A4k6 euQ[܈R$Lla(9rmJ|`21fO:n{ K1GQvLFTQWtFi7<K{QCm>tH?e➚rvEe 0Jt20qN?<#(Xbv I*M'N x& dE>Fԅ;T>PLe8$ȴL trlT}iR/T*SW!] `-D\KWg{d0c/,c$*<P e;thc F n;wחDVGn[s@:C##hCZ54A#WϦIKZwv+)Hïް2<țҔb%k3/O57J694Jh#*ޫ'rI.0ĴZK!ap$=IM|?c[6D_bꐒPdxTb lJd 6A sz3~ Y^C,iY%(Ъ\ j-y+ B SNpD2dAqi- dz߆h}{Vݦݩíp.o˓w/jz.U7e];KvoIdi?6Я{ hnY^+J.]kr}_U?A|}y EKxZ".1/^k]ߪ\cfrz) M5ڭt?}[˝H^/B>{}8yYˎSVs}J ldY(kvI5d'IWkĭؒ5*'Ț{8Y-m+ {}c\w[5 އ~&Rjy,Bs'חBXȼͽ ?=btd?P 00#R*H:-Κٿl=kl1uOO4iZªn |ݷ}J1uwW;ld}u'9GuvQX}q+diʠP^m _"zsAŶ4.ٚwZבQ=/0_r|*q`9z>m+3A(^Ybqoa5S,z^fvqZƹAP{\crea~}Oz#ƕ&+{mB'TO}j>i]7(|Coh~.Lt86p DC|r(}y~GR潻Kw?8鴿el'mVn{uо:Qj}܍뎱oل=z>mCMpp0TWhS¬_UZh>(ߊ7i~y!N\={cymt']-/h6ѣ5j<6<]G'U–ry/9yNqOႺtu U@]=[3ױ_%VsyݵT\{]䩪lO0V#"?b]w-' $r9D' ]8ccيst׆a{_Uݞ6nhg=SZVT&Ůã6gKǨnuΤ{%6io,?L$㚕=xV]#!y|s-=UX\0Zc{a5B2O9q?cqY *krY尿Z^'*y-;$qVl<Fq~=*)~p)s?K?{O3 aumwWH\sU|3ѨFnUk ;A`jT}w؇o'ywq q<3{79Gԛ~},Q7dXlˡB*&\[1 K*upEnGxiD1bUʐTX fljdq~n'g%?N"E?e5~0;\d8wqĀJ8FIE.QI#i|xK=SrlߜO5JA':  rN94'|fL_EC' ;ފS1KeclP(?;Y:"Xҽo<ܼS< 2$K3$brMLKNonY ʸ.p]nsǕ P[򓣥^-Jɀ`lZW]^LJ3Ä92,3EmVm9XH$ *]𡀁% )#NF~5۴>2kUߏ6~S<< S5̆C-l xvP)k#PT(PA;ph-D$Ҭ +R%l!bh}}6[ڍp6y 0no~b^hH oSY|VE)g: xeDDY|no䫡*٦{ˑ}6) ",SmbA(.D(Fb㐊nKqo-)a4g8OP_oqq~NQT'cnai $n * E^1w5Q$"fj9^Wf_-U֫\Bm춚EQ&&(]9땮/aŃ; ]!L\m9 ˖Q A l'I.Y8LIȀQ% #f; 695qEsّEDz=y=ϯq! *h0^֧gi%SG+ vSGd Pw:d!Z^uZTA)1T =4r7ǔY* WtG2aA5%ΟF D Q1&}F|ylZ(@UcQx P@ZnSav7 fA 0J]Q4g˪m(dž64qxW69WB2BNA@Kjx ]P aBF>T'iΗFt~% ep)^c⠭^$Exܹ}gBE~A*I.GgvπvGM<=~>EF^;kwr .P@cQ.zUYiB]u;v-7&3Dވ$U&`3P9eA@8Òa&n),rцv{bag񝉢.;]mV jSc1+$M ?>Lh@[C:aO~&oĪ7FcGMtCk9Q2e>ԡ|YKsFS2^^x^ZbOq}X^[%s*|_/Ru;p)3d%WָED8,2/Clr`4!d7bFDTTwM~x^Oݹ,2s'uscW!lϰDQo-EN jKFYɴqzдE2ZǦX9W`:H͖E'r3EƴӌV|r?>͎%d IXQ~l.cʰO]BiFU JC;oǠhq _NE?>Oi{7_kn-k be^;뎗6*HNr ,d*mY#Q\]B'w?̆{Hq? 8p5#kv*_K_7|i#=gAx\2< snFWp}P;b4C8 +a9XC.7VtD L'a&fɞ_W_GG[6o]8_V+3G9dq tbimzP[P8K;3:SIJP,ў^WY[lJj:ND!Y~U/#^m7Q.»YѺn8tL2 o zj5k:]J`iC䙐08$Ä8.cgFG(JI`"AF *qp@4UU@JJUAJ859"Ste}!AC4N:U@ }GkcKZm[\*ц 9O{uN'_>)7ͨ%l 4-<5Dﯧ'͐>yQDM 773wgyN=x9^Ndzc'׳q=vey/Mv>;6 ۚou}ͮF.o^^WnlYN^Imgvm{loNE[OK0Suрn<;:kϻoϾ{b:=ۼ;BUHwD\{=u=ukEݤAobL]thS\;}3o>u>t]x}wA@1 4ѓLFѐ4 S 4d 4ɓA1iCA&EO {Mʟ~FOžSɔ4#=A@C@4DLBi LM10M14ɦL0 cD ~ML #Sф0!@&@F&F`L 4< M0MO&M4TM&b6 02e3Q5z$ !d2OAMISx1 56Fi=$4dF0"~=䞦i M=5Q2i]7HY/bj7g+IM#qv~9%?nP L(i7P%j3^3 Xe?AHah{!=R]{U9րHCNB?e9JY#ם7 vm` ?Zam41 tZZ8kg6<`7zDF@ħ~{C)BYʗdLw+fv ƽBq P)'Y`4ܚ%;cKܝ}9lMd{tfa&6ixͫY[Fgx';2@яrTnORؕVFr͟*QQo ŏeDWAz})oRk(dDDhs.Û3Bp"n X SjOZL]T4q3avpQ5$l"%E1pI\CUa]9(|[K<$}Ƈ1^~|n(9ޔmDy~{>VF} _ FS&%mvI9 R>:RI$`Y0\>sea1A'vG%hD`mbA#倌:WGq; tjYutT:yqGq4 8&Bmz`UYM!a)GLK0D W0ɂAsyBGTBFns!HWT%@7ĸ<a'oqsjbs3y1|2Eǧ}1ALMfiIS %Muce7F0!Go]ZU[XcRjB1d:;1(*H+kϓ\O]5A#Tds#J/J" lNQ ~ݶ}}-?=wka|\JV,?51C;L^ ۮ G^ZS`_70a1-\ADWpKUDUD$^hzjJ<ܗZJ} {$ՐiDZZN\74^+cIK','޼_7+fGI*Q خfݷz2drJa2,_?)ˇ9ˑ\3\9˜?ƪHMf}Q6֖u#L$ޑ\Z3Y{y,X]])ix ïxta$33 Fָŧ]Tb͆8,]u}?FE}RիSc^ ZN ztcP{W`[yr&.F0bQx9/#%I|&R)8 VzˈR|1v,cxI4 N^sE>zxpfwessJ\50ڑB!)]ŗ7|X@"$w ZX)}߲][-@@s@xM\/LdG}I;3oӦZk6Y+몯g?_ M~,܍z׫X Po.|Tb`*guO$Y1ouq!#gWz:dSc!~Qj&=J[yj< t\_djbcRqЭEkaV:+9~!@x6{*6aёsxP:6TUSw^ƒm{q%-=cLfɂXW(^'ָ4}q:yYiN_ 1`G R0GyM i-r23gD8KRcQ@Ʃ&U8+_[/w[KCMiڶ t^3WMGVPI^Wd/)1(l3o<ڸ*{zK۶s_+[FR6 N7Y-D<:.w m*K;eʾvmxϰiOm(vBS+3snE⪴De$ʚg^s`C_J8|%. CIkߗO-ߧwp4pMCߖ:bFH4̌@X !p]ǁka yG-I TC%c.UdQVYf\`Ǫy`*j?=s%bipsog3&.ܘNd6XddV9[H;W~vƚwVxQ"[&>?upQTHy˰nc#upnˤBXE 1B ٓ 7vF W$@']p)fYP=_ar`tM;.Jj# 8"жȯBmAz78k)*%{kZ5SЖٺ8Yۭ !Z袱,e73rrV9G)|:)QQOGE3)k{\I-<),i[*[ǹ9xܼ{&:  +%#M\.|,.Pt0\W6R>yiw_[eHwƑXc m ab'/EWn*+;/@9Dn΢ʲ5}-u82)mα?M֖)aU]?G_B,bہqE X?MKS '>ҳ|U'§ȸS,ْUt}F+jFIt&%.o$cIDKp0$r$Yc=PAWbǮYoSqsrG?N)f[j7tqOLynkonr/#Pd~ٖK~u[ڲ(ptaC?nR&D-%;no¾Eԑָ1rġ|~t›|TNq.UA-jn Z>:^MWW߳uJ+m󵭕)bBhbo-WWqᵫ_><Bj'&271dMJ^/^g>i2mfn,܃ն4z7 M$]q39spX  ˹83wIC%1Mc+c!")R٧;eu(ןI,'#PIitv9ڵsДZ 9r 9|Һ_[#C(gƳm0bQQeE[#Fkj#KQ!<!֩J `F"SgıŨͨu ݞ5C}>ijކ|HϩS];A %C @69$UxjՊl)xOiTjc@W7=XZJkXdah"mcsI=cp@ & Y(,kZɒ v3Q Q_K)JNM]GPI?L:9NoVT?V*婋tuFKcV - 6)ƷV=;풺4jb:ٽPRci]خ,lQzDG8"B瓽qEqF!:iT ` *zJv>GxCRƎ 'lY(5O[Է$>+ֱ g+YgUru6V2T ڲVҚC |ي~Os|~~IJy\WihFiSZ͝lo~[5xnQiOvN\QpT<wq8&5Kxqpzރ6i-oHǀBޠ1A# yxKyv5=gt~FIF#9(J& {dz!_cظO`#zt>/(?^rK맡ǿi,T5|Si+h s;QOى+Z=z=}BEUe/k]eԾ)(8{5m->rP)F%7$c_͕seGyd(q'&uڨŨmy[׿eJG_$kۜxL)pT)v~e1~DȟMZ NYo(iLMzpЖQ`kݽaj%s}. JZSЋ=$MN05?[!mEOU۪ymOkr)BONB6VQ=HO9M{De (0 Li6'.eiMid@Q?Kkh'Q=>Ȑv849xG E/+r-Lw6 j:#+ Ǫ8YH:$7LdWr]TW%I*<@va#rS"s6|b#gz!HF!n^7gX`"@ , x^)O&036YsJ]vO?Cja T <Ocr25w^V<{Ic8 oܩ,a@^ڰwSfi}s B zlXlSfxmepK|(.s;׍&^WUa^RϧW[_H~^17@hwǓ+I;jWshIbm$H11'瞚TK6uwSWhq.W_=7g"QUWƞ^x:*M/e]ݳP/#世3BB%5|Y hR5>u GK͉|T۫bw~.uS6:s G8-S8[z'5Ǵ0gh%krtNIJJxkz:V:ewQWIL [Xp4SI*zsᝐǢz`&/UR4[ro8{ [}dT &9tNzl[Ne_h![/~M-Iunۨ}#NRfS&Ҝ3" %.< _9al29OBwd'ۦ*h%]rCagWytݳ(5KKn!Fi͆9z qskMyC3 !(Ko4Ǟ~QTֺG>֫_ɓ-WyME87y( 8Tf^GEa1H`1#xco i@>{/osV )A]@m#-4Pڿ=m\Z'f:e"!pG4A7n,j;e"P`kљ)003Il6x?{Av{(p $ $*5T(AvmnC{-x9qmͭ(ePԂ+s"'5R\KlrpBhu86hŊɫE()[y}O}>]tդ;,(&nh.;J9ﭒj#bvr"ʵz]c-PzX˚akб3fcg]_q<SPs^r]^S ߮Q W̽x% w W 1e]0W$0a? F"YE{ADch/^tNq-K&cg6J~_2e?wDH=jqI}oI$³$q.muArP2/[0"pVM*[lW]Hu9Y/+#oxBTh=r5![mz%J ~~ƭlů 0b#u-Y9)UVdܡG ApZw,ݲ%pi֋5pr߈T^-_E2 ,|A9  `(Hn N;|o :BoG'?9H)S͗!1arPY (ة(9j31h 4Cø0{{!i>2/ayXe"}jx[ȗ%ٲ2&Q8sgMe_%s.!Ut70RZd4HHJq4#%nΕ +3ʨ4;EɭaO6{Ba~6byhjL wzӝTI#<$gbB܋C֙FfE?EBu(@azǷŐZdL0|"cԋބN׺X8EFv3W,14hA c&`cK_%!޷U,00PF 9$u2Q2RfqUV5p] ` ą,q{{1opY@U4f56^.Y? f`i@R1y ep0oCMwPCESӸy[=#2Mmh]w3-\T˺p#g鵨5R](m$踥o$=0]+cȧ s~EY*zG;GLa&4m^P<Ю0Y4 YV¢\G?L$o%az 8ҠD&(#7aR"5J&WeX >[AB¦PОmn*3V0JWNq578OG2r9(<=s[]*,&-EztVBA^P9? ,dKsմD<qFzrZpnk('_klFn8B#LrSRzܫF+34Krl*4xt@gNZXce{G9#=۷!³R馑7;'{4"n(a^=JU hu(kj2PC)&eʯgN7!# zgBX3z'GKKSZjE "daLe.d?& p dTǭ|d<ʷE**v.YKj9\}U~{ hxn7S1~]Sg"yh bYnB5$2|wx ޿2rjb[h $k'x͐V rry Y~9 ꚭ*4 #?l>7ؤmt 00XC^^kld%ڋ hwXvA5a{z'rs&PLmp J "i%خC!{fX&9kwC+yn|hƁKҀMpy;Ud]s|e>6s I͜P`6/zu2l[)3iXg >$~Iķ~h")#{(le1[oBۧPqTtx 1ZFj 6@PlÅZkYS{/kF}zc^_zGy4HFk%a5Zbu:@AˆtpXA) $"rb01e>&5@C4!)99ȺpK=D;*iԝ9)8f`jKz0it҇a1 g9f **p  pЭxZR4ʖ iFX ҁh 5!1W_(J'o.xlCqެ@e^ "U26y3(cJKYMyׯyC\ ݳ8FWt+nV ZbR 9S !_I-ȁX 7aSX08!/ *bψvF0e/vF|-l8`]\o_(q|@3]}OAInEvr2OPX:@t$3Xvk@aJXivG c7~K5,r Xp:D:]YR;;Lj/®FFlÉ Md5D0ar@ Cf[Y'_!71),Y=5W@ɕ잼a*F_& [ׄ;Q[V9Kԍo;ۖS$L'S>NyM!y>= 5@z'b[!D$۴P!]+Gz_` k?.ڱzz(KI#Op|Όk)b~;Z q@}RJ b.NǮ;S)";(;=&Bpi,lPz Z s(y&ZޛR>Ol@1 8zYw<'(P-@Oj> Pc6} . ヿ7 º}IV?rZ֧͐wpD;?M8̓%&|sgʬVDaTrIcN`J:RKIF,S?'dO}x}Zu)||ʘpʝp\{}Vs|=7s1<j^74%OZm3H䁊x~P$DnP˕0y(K== :>+o˫V]al 攜{i#^hF^)jI3Җn veٙl]q+ȯtnm w:ŒZ_-ȣNPrgO6Ph4B=<D`}U &9_w/ Vp!4pЏ0TBsPhqoqJu:!Z]b_}.=v)5~^)#"9qN(Œ{oee}?'Yi \epjxe@{EY,Wu{ӏX7 Oep!fH"T9p8[' BؿώS/t͜6Ŝ\HI"L= +q9JKʁ{t~U)E j ( @#\3xW]&BnARc?ꨌF0dfAtـ "f./7+Ul6Np;-дR8ɛa^4O]m^+׼ðFLw}BbNc) (#(Pp-Cvن8B on&y?sK-ʱ)}E eNZ +>orm73u~rAN (OG29_LzhâK<">;SR R:>ѶS.!KlxY$h@~{VOFO׾>% b$#M\vOuѬ㲒S,}_?S[>x%]*l[Dk/R%][H[l3d{+CSxqAc$7UŲv~ky.^q6B%=u~2GLE"A. 8+/R/߉ 76!LgQ ԩu@J"h.8#9:Db! se fAt, fdu2ړ@q P_v6!v1(h&txd }tH 6#]+qհSm+1ykzvclϩmKqfҳG`v14cKГ¬CjK`j&blБ_[t Lo͛=Cs&MhlOl91j!A c06b9pbozkzN&n􍎴#l]+`ebFʾ<߶. oxX0p@qH7LA$0YܿY'La =X,Zu(]Ke,(\)iD'Ơ6 N[B9] ZJ6VA $J x5ԗ Ljp (e|J"ѕ n:s[:tAψ"^MDI5@vaif[96:~Jw+Ĥ@63cvX@c|sozD v4"YVB.."4۾7pm]NP3d .K Fʚ^Y+R j$$!5A5F$$ ySE3bkcyE3u+CFb][J«bB Rtw<7)KŸ򅦢b!f#Pd>>G` *0U-jρbIe*{iM{rg]:.r"4+fV|4%[E`E:$~=?iK_'xI {[%hҷ1 ^A!`+iQmf 8*>ZRJOOſwNJ3F9}W@IJJ!1}+dHvA=\4-):_%w-?{KqoAl`KhϤp_vb Gm!MO0<[ 7sMG>' 45qR+zAXkdzJ&TBq. !_&ߤqUt|ѬG7=3q0k,N!vP%+Np"1'\ -j$-{8=5(;889Օ]"r{? ɜPwL>Kߛ3e{ x6o`? Ieh1K_˗rm@URc\M ;7a˶,uvqNXBg T$-rWn۰?a`KY [!AR1욲_Sa3t?o^QL&@+#]*a0'%ۉwyw[zϾo1wAt}qS/dyD V`W?\᤬ cVaPcN>CFmM31/efbrKޔUo^pYBX` +&(H^oZç/@*MΈ",KfP΢p nV璜%8b[ċtODJL<;([t$MGxs"E cZǏ=_mWFߒ`~ +dP"u[AkB,ڋV73rnY5-*6/ n 4$zR-*)Ҧ̮3mM\QSH?很uQT?n\p=qC' +w~Np%䒵z8J,ͰHvhe3tKyG x%PkePݎ8ЗvLTTF-Ȅ`? NxhHj>_훛&5R0R%k\h0{=1 i+`^TIJӷJpm%rS6j) Z/*Kb9'S<̙C$NCҔWNHi{rJj4bzjƖq|D%f#ߓ4IӱkX6- 89Sfkv?Un[qNd^]Y@^BQܣV5{Mdxjl n4;[-־= Vž v޻/jNhT8+ցJRCmasy7%~#{.󢁎,:s{ϣU.m<`SBsr/uU@zHhB^S\XG͵j˾Ci> X#)NOQ,>%i9LuǮ n`@I#x{7EUC1eD ?&Y&f}> 6z>_Gf.5+i%!X$:;($B@""B~祿чˍ2.:QsWPUv;v^z\]ÁdExtgo~wuD:- J{,] GʀeD Pn# ! sn EI0#<|eQ@.a08:.YZ(ƴ쑣d=42n&}Se +ڢG|FϏ'R.PKW6xQo$\yA+}q{꾢ItE6|K4m$iZb~Fn QS~+[6yK"f$Ggl2F}X_>j*kX-qׄ}p툾"IM+ꭄ1ӱ.6ҙ^6n4Xej6`Ŷm2dWOF)?grI&ww,@+4$:Ѥm8r/=11 $)}_G1CV*dB%.l\a?Vƞ _k-ņ,&Bo߾dœZqPS޵ŝf}~Xp/G^?^-_ȋy;$>'6!^2@EH Ӆne |C&q0GpAH"-ojdMRǣ|Ie%1LI?!L9R09P7g4 5Vsd#5'!xF:7n䑦{[}鹡WI,01B7Z;k㰒GuhO:Bw߆_ǩOP +:$ஆ|ҽ`,>m'jE FRbK$11C1!MTO5(Fjn%hr.V hԺiR캗mD+Ty Ϋ>2 pȁm91k)>821 #G *.Y =؇LB`@3vs&opo,HA9vv8? FmNwKlf?'vA0[ 0"34# AEШ Q-*XS2h|}Z4lRq·zSo+)7ݣZgy{Ȗ}UBD}g*|[_f`e֚X,b*aoʗY$@2H m)A1uhJZ^R461)f[jV-\#+"'.Ww>lܟ"qU͢ZR-<..(\[cC\IU>F+Jsȵ'?b~< ǵi\wr4彬Js^ԾimufĤ<\6`?cFۨ8Wݭcs }may)9;]k:.PwǦm-_B w 7;J I:sBdweUx<.>1ݰU-Zn+0`Rsқݛ;1H&ˣ"ނx["t~[3ިPy'.'S^Rި SJtN =:?R|$PU.EZSL[I%xWG7ZtwNJ,Iۭ\erF4wj~ܟd` J8#t9m_~(X8dZ4͈-{lGtrMa˟73c546P]C…W~j>3mZfiaP踼&U!=N&>&V;p,D5*&#ȌX䁃`[(& m#up&nqipꁐ#`=!*34^:JYl-)C9UHb"WDє/o3tqQ@~ӽ+54YH>syWI<.xkjۥv}-}ٴK;8Ͼ$4Lw# $cco4)VlYz[b>vH0>|2`׷>?jk̑6otcr-{wCZ,b$slYD~2B\1ak<:w]&&@JY qV;Zޢ"{0L5N%Z8gAo| "` gWbpbjt *87םVa ~mQXŖH/{VGjRKZ-H;%(QXO#E9 bm)T7XD m|~OeԹ὎ kT6¿ ӗjOz!W%f+HP+ *u1{<< ڦ$պ)tWqMzX5s0aa)8RFJ_oFƸIEh T`,{9ѡ}Kݯ[HI-ua{lCٴ]걬_R}*cu\yJ*w z^.?:phJY Fy4G±il-7я'&.`_s~Kb8800 @lkc*HM&,&Re_$(`cPV*m>Fi,^fo L3lǜȏZ OWpڀZs@׿\o7TkX-/L$~V3*DsSD_dOyF{l ܘ(|oX6_onшv6nk?8A m@'_Ͱ$$+{F3[ީ ŒKc],ݞ^H7:9%+-]oi9 : 1E[oQ6zLO 4oYjCN6P~J4kZV+F'Ml15|-m2vGY ׈ R密VՖd`$jD0lN+*bTej_N)p+sn?.ݯ9%Nm4˸},vk.5=/qQB}9&t@2@|*vT@ODuRł)(vQiyG7#t5CZ96e$CTrcW*`sm5V.xͦƮy4xk8xG lxzh3AHA@@Fn#$2*lYHA؍ qaM"sNq5:bORy.Hbf}̹09 BmB%[+ˢlZ@li#;J f7js@6kDESӟ-wqo9 1ns3GjA`q 8`p   sdq8zbXOO>Gn,hNKedKKp2EH]3s&*훞,9RHaݲ u^qz5%U}-\Vfsy=ũUQ7q/TEB"šf~t sY}g%М=c#؆4\X%N:F ~7 B&Y iyd[B+|!mMϣ5\mxu?~ĔQZ)=&䩖!R\sYi;Mk+k;IRb%ZX-=p{4g5ӓCk4ky^a9GTN9}<ջ׬ XJ!$u穃r#9\X~ץ@R.x"U[qwX{B}y2}6J=bn]_2QYTAe|/9KRJs]AwaIKu)Û$YMڌ% Exe)ьoX&)*f)n:V ]+~6Α <|<1}($ĵGJ);\nc[к'xm&l4 3>46z[|f -AN, _@6S3aS6Oz+DK =t6=f H7e[ӄ,f4:L0(lahUrךC5d;>u3ɓ!BCcF Zoxنp 0XF"b8OV&F[7(3@8&4墣e+Eꪧ&2~E? xN&(MLuxjr sqB8M#6J&GyEkU@g`bg>;p#ESgb,y%a̦K7<8ӸnD[ q̀ Λ"?0\tMP+^=ףKyӼ :W!r(9&#́=?LVxӖPɻ3_IoY%!=$ԥEJ^AMT#1~ Ń _;t{PK˩giC(fT &)o ~?8xSad$vmؤd 2:Be\3b?>CpG巆ߕvɛff;?8FFg9`)$ؠX9||[Da޽AwC<`0x]-,ݱ2}4&xU b!\,c *ac9f'#sAlUې2͎ǥ2ZecUAF qӆT65X2)H *xo$KȒڳ]W#l[{W+6vQ K89$7FꇚHyS -dǟ<Œ{!##^ԊƩon*D ؆BΘȔMKlVߒ;6j{2-hI4.GmakJL\UՔZl°Ko [q$&:`;x6KڽNCtץl`d̬1]knrbɳxpH'-{K5ꌠz،N!9X> #L;qKۆLVL@ SHa@e H½,`vʤ{I#'v&PC y Cmj5}3Tr wH0ylV _w4x8.V!nT!/vj6* ^' :ӵbLtBgj{R#KZgn)[6?ȫ2n^(2}.,}F< ]>~UEAoVxۛXXfap5Ú"N8#a5*H}[#F1>DWlp"P`4"lR)˜ *1dTɍ}$̯zTtؓu3 XLkf?׃'=^3vP,0H x0zSfBH I3FwlxNQW];0;*l\aI T66t_~%T$ΘgM$5:y.i{43Q4}ŻI>nGQ᫻]Sa : HgTgҗibs5Rdf4Y P0ؾ2?+3 簮Iig!KĊWWKIFxkcȻօbύK>l]>+Z J/fF}rl{mۃ y8J~K4ٗV'Rg\r,]. UZ<k<\\Izu(̿|:]%,ȃ- p"Cq)mih;yll޶M"cFaj`fE?2J֥kn-z >8D5{ Uba/2 zV>؍|v[8 ]w֥%ixUc` B^I=2+9rRԍ*2> q3nܝB'B hzfZOaPi ]&K- haAhJt4J<ߩҕKIYZwqF6 S} £1𔟢 v-+ZS߰9EvWN٦ў$3`_Y)U2j]ȩqdY^16or.96bCŖm<} fFrJ%3(wEs2VwFzVk5f.G @8?*4^Y[%f>6 NIǝw+B2Χ}*68TVk['DLFL&)˻uvdtYX4lx]q /NFٿ44n;{E8|SF-!u$VlXjQe}hţ^˔ ꞓrJILW$n e?]*Lw/Z,Oh^䝾V4P]laTFJ)2m .B]5O$XX23/3K~'u[4jU 1 Q]ˡc8qNf)t5reaEJFӡJΠGF h j U7Φ dNͦ-\u~~CqP^py*ʙư`kfKCRQ O(kXƀ*68f$$ELjݖ{QJh-~xAԘĺDXqG. MZ[\Q3A#5әrFkd6 M$^"yKxݡĨy9N}2&~hTW).AI4\a8/Q[?Rm#$ONG bᲖb,:3p.,dF1K5ã64 $8z p2"E!(H] C. j l"|>d҈'5Oe=PNBDD}wD@;xE90@F&뭫@ ]T͆*}B?NߠkuWxwOpt>\9:d1k k%a{N]D~ɊזdԔEoVY6g E 2h)DI^M2Ҥ` 0VJ"&nǯŷ|\ztJ dQJ 0F"1EH}) |==Sn. P{VPcڨc1z5 #|q:-oy{vU@;i:W$w ^<]2>({pqoZJ}~( x@krUwQU^Go-3rrqmGȂIok0wi@"#4,8z}MJ eW`3~@B'F}v*5T;dC/ur v7 ^V=g¶CP@Os~D(oCƜUA;a@?^ŀ'bDk9WWǼUWAA: ꈨ| (('CŠ 6T}Prc^w<|hW>U#+Ҡ3ġ]C҈ }JN J2^wjb!~; CQO8֫P>IJԁ4sH`Ž=T@E?p^k )CCƊ ҡv{91IyYJx"zoki3|[\+uaG˰|5@?Vy+7eDy>;g(OM:k$L9@nNa q_ӵDN'!wT{Qco;”>v8vCm@n%,? k8 -,=+^'08{ߊ'gu].6 >%dLY;86UpU3_t"=_]Ir( O=`M-Q?# ĸ:ī{}Rix1 4]ް0= CFty[SЖV\a"`achÿHoGzVYAka?H/Kow˃]񱚲b{ .z3{_HqѶl!YŷS\$u6ɸ ͍80qRo[f`1$@HFqۑ$ӤHxϒt9#$_{aTs΅|{4ܤKZ/szzۜ7{CCCij\!U>ejNK8TcA4E"~B]?Hc{niwڭ-^.2#N)V9]r[4ek}T% a@htW,)1qj'0Ƴ3tx^$D=}J8Bs:/m_C۷'nEܡ~>l~ϵcӈL@CPA P*n{h{H?zU@>D@>@^/*q(GS TSrw<3A\ϩAhD}N?Q |PEj*/M-H(+ øWDPNk+"3*S+mJqK"1AK/g_GM@ Db`LD* o` %jp`@uQJ ׷g>|ʤeҋʀŁ@<$ p 9FP Q^4DA]WC  mb 7DVPCID{h#-H>K𢪙CJ(Mt@EQpT )QJ6PWz?  ȇcN;ĂSR}~²0C7I$?oP|uw"nb(D@ 2 +h5A; |T8^bZ(HqRZ/@Tvݞe U@+H)঴ _-Iɀ S a91\0JgOoB):?dvx KX?Ѩ1CR"P R^__O60D%(H3}ʎf{koR9D4@3)CRdVu" s]Mn~LqGb윀&$K5-sTLBXRQ+n4R3v+f˷ګv^0Wm4I#[sKgצ-0Km6D6U !i )/;H "y""Zt =| >|}b5}.)_ũ<:X; ~A9hx#Ŋ<"r QCN,:V(sPA{ "V(@렠yP86q7pE; T<)t 2*+‣~4@P;Ml`PO5s;ρvPT/ӥW[5DJLQx*beAPJʊ{nR8" GmYw M:Ӱn~%Dqb1%<D(` .Ti8*~!P,w#X#!X2I_h0!zU}@SMh !(wBZmfS`%΂%؅T" "hAM0aL0( X1!Wuu5PBL-` B/9)D0L*Y 9Y||Gt8"X&"k]U4Bň 6㞨`©K|+:]&3 ^&Ÿc9r]w3g;eb"etNrOOa@449X5XrhLh!vR wy8TBBY4kfE˟-.&ǎuP Ty]?k[H+Ԁ|GG3M]!ʁ hӃH $^_ErwDD5Qu[J 9u|0w91)3{@ENO%keml[edKq8?L=z#臇-U ⻠RHtw*UnЛpV=1=}.~:GSnżw_X7x\Es(gJ qQ"@QoD86R dBDZ~G&Q,zOE.k";Xz3`"b#Ztc'mDUD9( Tk@= &dPO0đYSʁ`ȊvZVTW &tPj/" TDp@2 T  tP !Ɓ \?f!`TCBhehqvw[b#@ǀ&QBlu4xES$y(tQD2ɲPTAB@oY 6"(H!*EBAP@S .<xԀUȈ[tT6} Z~UmTT@@U"h#Q̀- DIEETd@L1E!PUU*Z ( "'YUp%L0P[9arhW& dka.([/V9` \jB~?kz{q`(5w76{>W%U")t9DBl` E4X`* c45%\NgBJdc=Πk4 anzHzjC*EO!3gXTT9&][M9}lɧgq:): ѱQMDMEAsZ ARCÏk-RCA]VCȵ 7EYπEVAPA IXs4u@(|JhD/ ,E-E(R#"MW-FbDQ@cA0P*(;HSP# ~T^|QO}OGD"y|x>TPpDob\U=TMloEG|hP" E;2h \?`C^oՍ< b6@.*{RGETH+c"m {H ӯeR( \@T1ADL0@jr*v@?9)d@O]dƯUs5IeVŠ _k]UđzW2 A 5uA]Wmu::PPIG_Bm^Yn6mzqh;4@Mla e(66MžU&kuk|D\E6-㝇|KpjR"V{B%TBeO3" ɕEH]1)@ q0C/=>}Pk;x)~ ̼< f&΋l~_7F1i q#&F Nh5HVsI|4MKӿF)`n^0}}lwʓߴ0 'MZ㕏/Ll=3e$1"*$ dDbh+ccHqաU(PJ({>__B lY򟹩B)D4Ptˆ}5O~9"5PL kJgT()҆Q} lVA!D.PUP಍ƌaD.EGHԴT)$.RDm-fh Jtd+~ ہ? Z[GȦ5}F,%:CcǑIb7BPp=Lr[L]Mo q>_9D K4$og4QfG>5t^&P, ЂmVIm)̠ a$$hc wpD <((s5N j$ 0.&Gux|u]a*f*;N:k]Rof4_g;=u? <[@h$>;e5:DKKq! Spc!iD(eHR;:”}Ēy2 v <|]!\:p:A rCAHMrTdr]C$-M!]}34=30 d< ad R۞Δ %{yՠs8|eY_5YD]Bo]R bX74v.[ƍZ D$g)Pv-A ,IUzFoC9!"L|~Z@b[P1BRI!ӇGDt@j YMg2lhno;+|=j %^{c¾'u րj2i!(3R}^:أY?5w{0vYӳD|;WVt/۞ <%MSJ׺F&q|)Oj %D $\%\XAA]a(H#FX5|,9.'$uIe&'m;0.ꆌĈdcm t abº[ӌuYK* -?).]DmG,<#۾J~|eVKt<>v_ Js7`9.QJcv=Đc)P)= ﮘG)"`&M^`α{u P|zFw*^4<HeF{㇞uYCK$1VǃD6@BMIcSʣ&%UKz‰>o&A4kCmK}:68ZE.$ )ae2`: ~r_Ofߏ`!Ϯ!;C>S|B8 ]6oOwKΦEt#?x]o c$|sܷlcEBF\nC8VicȈXG< ;ՆKWz|٘7;Mpӱn,qq]q"8Yx]m}'bu]]6b8ѿtt5b۪pZbzh%|>WSTbŇ)EƛJy4bO!hgR(`nI2'Ay$[q?ʐ^ !W^靋&Es֟o'f :'aN'1M3pfSwk Q`8ОAw>]6T "p8r& N@l2D˒;)m54 ܚt*9r[0:>E56`|ӂӭzޒ6z&kƌ) L{@ nyIB7e[l_RKo"\j3YHK;HPӚvjeV):{i~}i^դ10qnEܷbq GƇJ 9' -.z WsZ\S8P^;O8f"k3IO0ÈZ*X!$1bKg/nhg!T8}^>.BD?( [FEG1KS9K&ʨAeKh;R1+؟*{u2_G(4Dc,I$,w8e 7jH"ŊTJA m>Cy^SP}-7)+wmV @&ep0²s~ NM`ˢU'?򷃏w\lm3%S?G7 a:AbB-)a8/܇}9otx$ PjV^(sp{#d^y fjՂjUPtgwwYO9uRW^㸗ɡyQTc5|-ꅛZ] n#8z kIj&,cVU/pRC,J-;Q% |s4m"`A {~R}jm-xc{\ֳ67UdA+eg$STo h Ch򈰐Wb}rP_+a?EFصq%+OzíXYC^"%(v$ij&,*R5v Xˉt0Dd$9ëś>vϙE0Yȵ ~2"04 K ""Wщfwv)B(~AfAmC3s\\i'9ķ,al`Z QqƍisanNBdJ]sP2AҬ]iFmuo橔R`˩n h5("%LZ(iyW#].I DJZ`-̺KLAxDZ ƌlEd@*]ܹs5THd{s6%6Ѣƒ4ugڻji5hG1D wdX˻zd3K1-2RD@2-\YpÇ%$0>?c億+jv/&MfC{jbb8X6d>rG9r}CO8e}sň3ln0]$Ҵ X$؃xRAJY: GШst٩O+ې߽yHjhRD 8Taey8U@j9vz0qqz}Z2O&vnNĺ}^ɺ̃ZQ[^ |@nV ȉXe'-Xk!(1ePI64UVvWx 8.y,$cݦb$sn2TիʡUe{hP]oɛ,["rV_/[92.IE$E!iOa&x|o뫷uWNsbW[[ZmbvV"o!#X DGS3%m3l\)U-X8% ƄёW*gݶ/4ŒڜQ`b`f`g_$5qBtB@ٞ⽗[x0_5d8' iAsyiⰹ2Zb}}SH,dbHmu. א*WIц)ȝlZXJU()Xw۬+QaDarEax1?RPQVd[=o]8ԎnlB` [1 ݯf;aA,X0Md*y ;7.p%ה^,Wt#{f5`+ʝĐ.(hLTӺccRXXmr\ 5T- 4%@doۭ~w8QslʳQh@~Kc& ~TZC  sV.qY ڣsI{I%YdK S 3MGI/Ԗ pLZnYʖC by1uyk``H B,@dH-^C{*Q.U_EҢs1*Z_L)T@TPVpˇ@ӹ)l eP!Lp07V/a5F[rFżJ>ۈTIZR T?BfptF❱=|/wk-u5n|o`>H>xҖ!Goh"J@&{R+Ln^-,yyTLV$}KBN%4-HU}JeNX$FG[6}DC)T% ubucŊ ǥvl/ 0HTOTZMWHҫUԠcNspkBkҿJҸֽFx8$.#6,- W/\P(Sq|ƌZ[-aEHK ~𻫤XX@7ʒpdNQZ<2ˈzoIa«&IFAR4; ^mք'XBm4p'ѰzKK6MnƾP &ćK rZgǏ%m RiSfh5 oY8r{Cϣ!9 1!R]鳱zkQv=SN収ZKSB7fo8V7 z* an/Du2' @㩁TNfJnS'f Ұ(>Y$C܂Wg2d9aZ( ʁd$ia|]k m쫱a8C&!#Ǹi*͆ !!غ_U#8d,1󇃑1#xy[wzuBFGFU 2V(RAafa .``MٴadnuۿYlJ T TZ* RBP,y2Qj6q.(otqUEDMtAWqz4&]@tAfl+4y(َ7E巷pip= 4wgZ83gɱ=̛";&@ThÄ6BJNr1?1 3hlF!..7A7z ϯG|5imqNts[zo)NrYn.D+(Q PM^boETRkdn95yVMєI17 z‰DRi:6mG2:s\fyXɤגiԶs_ 576Ž>48o Y6r5zr7o]Umpl3bwʲ5ɁY~AS}JW$FcJ+p?,1Z>Jp#@ ^ _1K$ \V.0BB]Mʸ#!XٌȼN&1x zƳJ2aQTu8Y_7<]q5 XդCUʉe ʵ8tylcy|.Z!N&GshIQi$@I6D vXPk$D Itshr"I%5i~ĦqVTpfMl\Dl7lÊQd[4TKf C0f1+Ā]/mb RENnM/ß>9~7Z`|",UרH Pj*YJH"H  "H"! k }50;) u"y"nz 29YxC2efя{}.ֳPSEEwz-DDE_*a]tZ~/_{)"$ :guid$j*K#چ] [Lÿ:k]>cL;aâXzoZx/qn6ۮGeLf/ ]Llu3RA#ѹH ;L6H&/pFHg%]hxh˔T5$)gLT5/gRjF%X,s N+2QL K0XI<Џ*H푄3k( 5#KVay7.e#ɠ JnXC7PU q5+!+Wv[ 5իq6V{_>am#y*Zv Go 1}$X+āND2`M宸x+o]wZ?K;6cw$1~W5[:\R#}+lCrOH"68606>zu!K ^\>@ ʝz0l &Ea"·ăEntQI&'# Afpc2t2"΁KncXy8*d$vo/-qSG+OmGm{S@k0*~dw0~*|8',MHy_m{~@90.RVyP/gs) D]Q%3Fݶ;}? 2rHSQ9-dћ6/ߗ.7'ݠ;oZu9{? ]+.i [jRݼn)^PD uzJs[[sqI{ KH_ppaB܅5X*}r3=`GvX6+fSEL%gK0wg>\uQXݺPCIlUC If-jp]`#!04_ү[K{wcud#G2?,l:2D*de+INyD FVY)Q^1> SHD!̞LMX}8k}k[\ 0SH_ &IC\AA \0D]=Ŧ"K>t+5 (@*]* t} >hkt=[ p _wml_}#7kkAsMʍ~w4J-g.ՠl ^=W[yWGy%+|y9 {?VJd>{$9PטY r^Xl0 ]GW @@DVU@{Eå 0zw"+_7>P_ K;[;Wl= u"#&b0?hІqEbA9鳛V ʂ[˰LxEjm(E2*9#eowg||Oz@0v4j a͠E1)()G`79Z+= [Kpɉ'8jYtƪĵC2T`v 8QD/@H(#3ho?,ATl^Dgvd?OfCfF:tLv&~HF-Po%WK=OÑu0#*׹ot$udlaD$ C[(d]lPR5_s ZpQ=gύzOsqQ`O m;X 3j%LN U umZ3̦t!3Xoď|ukIg2<7R¤F"7!=#/W&iQgߪ"m1 ؄,yȮ3Ƈ,TM >\HjR^ .e+C_Vrn+ር\jh,hƸ,,.P *"%@Uj ~&/b*P|vW`S-A|] 1 އ>&Y@RǖG5,"C?\i,A墨 =kip AN%\oGL,n&IUUJ\LE TOSRF6v#eSn|,H7H=94nv:H|,G*&HNkN =a0j3|0zwA\}zaqJ e(r?ͥTrϣ-}S'4A9R@=iH$3- F9\]Fĩ[;Mk~G8o6[u~{'j|6~ڴTҊ U6֣UTkTkcXi3ilEEFF-b,-ǧR `921;Hˈ4ed\#aٛH-Z~#KGgsG8O0rKǹ_);te%Ui ;EJ{CH<%j2hm}kYj]ْɐvtOfj2:|.=gS321tEm6 fy6hmFsGXԬ wjb(^Ki=n8o`_#n89ۨ:aYj V~Z59v/[vǫfξ)S_z_lQ_ya=3&Z]J=ۗ/ ^j_~%z93EQD~u3K0PbuX.-*D<_SD=~ Ev4t @xn*oUmnn5T#P'S7Ha!#׏/řqsyT? ae$dZ WTʋ`3b.^tkr>Cq Ѥ< ,.],*֪?#{KZ_?s^-{_[{]4rz]𞘿qvnߍxL :߷|܌[HF\I=I7MD|a=GL$j_GӔ#)psd04t=o5\'ngU!SJGL>Qwyc>6 UKnv=L:?*Y`V47h.RБӃ%nI.P]U8\j_@jTꙮ_뽶 2\P;LR =^#b"Ϭ% k1S!l}O=̂\sWq: TcE5c+5Hb$zȴ BE#D tGRo뼼 4xt-dRiᒔR,=\E:dw&ow~'\]GI"å>LS|*}oXkE]0EPȪ2윞tj E lM|he!ܼ#Jv&!cɗ3ʁP΂A4+1MeRqR6ӫEMlUvS[ZF?8MĊTAAp "Lj75?nsQv;bsgTp`BOBN>h8GJ丵k/AwZcge{|8JcM0Qaur{+!!!5BEM/bcnkAKCqXXC61abR`NƏsgn}f01LZ'o&4o@\gƒnS}=_/` %Wme/|(v{OYq;*+:<4L BF0fYRO=***@.-Clw.U>j(7 ĂIbG++#i}r"j'>, FmXwXS>T;ѱ0WOaA0e&Y%^H/9,劉 V/hXAs1U[-V6P^v&Es !+EoH) D({؈qw_s;H-.aLKᇢRƄ@`L* RQ oM!Z(>x~qa6w|C*W_MfpD15&=V,K\"9 e;>~›lא0vYs)U_1Y@"{oY@aэw_#g_\F${kze 8:ˎèo&$ bx! c9`r\]bE zwްq.[0.n%L3q_-}X f|sԢ+] @iiKkIu~AuWvEgkBN{ػ~u!y 8o\X뇛^R$WucÓ8k^//+:L6/cl]s6jh9*N!+!  0Af1ٲ.j5 x$*ݍ.hszJ aeٚ3Տ0Җ|2{Hc5|0jjXR5y kocK% _lP<ݯEϪ'42e noOy`kA79-ӾPq\J=V$Gjܭ`Lh1/Fؑ,v-)wO}TF;y򴈫zAo\Ǣ@c[[6 j9VKiB^2x6]F|t_'%H|ޒix߱`>͜\1n1Q0>G9/tߪ=')#ED-@֟ǙGo~e$a! yMCϚ9՝;O?w5/e00v.nսQgGIFIMB( $*Sף {vʫP@m+1,UQR{UZ bZE]V܇GNcBvm2Ֆ1zOjU  9 ?{j \~|Tո*b!J%CKLmM\J?_IxۅWP>~Emks8Gw%P44 US#ZdE =,a-lVN ȒW9ti+Fp@Pc@!vcIL\aiF-[rD8(vLc2QmMTHm qWz eOqRVOq a}c{ oXYbG?Ft-niMя.Ò^U!X2wK1rE|U3Óy3{Jcŷ}e RDݥs(zs1͂®a^f0K/Nӝb9TDS\=k_E%eZjY wY`ȺuTY2k[?: mEL!xn/ɏ_W\nW-C AYw8 9n&<G~q? .x-{}qЮ-ύIB,V[݇"ԈbxSx/ EpKދ?֘U;{@_VL`curAk*L{jG_כG%,gm궭 >63!`` Œt2Ja2xZԥVzw y9wD1@]Q "aZJςjJ0N\T&{Zي2(KgyA \o/H-Ֆ-_E!l5#aGB [řjzRP=`ʬBAVf gpcem&Ļ8Yʼ毧%/.K41R, Z>TIgOq] ,R+d0av|ubxv4eLj[p/frm?+&I/^]4Nu4!%dOY^A cQ^Uq gٖ:MĹN79r&p.]w {ۃcݭA{ LyqB{^yۺ6Af@Lu,VɝRjIUr̅<[f }?&>Leo,>ƙc@>"; XA10xvgN%"@'9!2(p>{ 64SF$XDjq>s"dFtD$GS|QHTǮs) $'I!Aƴ@fdM` Yw4VcmI--'K3; l*Z $XsKvS`,¥Lab,>N,g+cLWK̠&pYE*+*rޤ]\)+:JI"PMϚ죞!\mrJFN  mz28>(0Ό̄٣&h\C4-7s);ѐkѺffad‡h\yMh7[pyYkY u&&Ȇ(-{rH`7dm<8⭸˻^@]PPfE}`_H}I ik RPºk!]#skJ̎d֏6B.b0AN,r, @"v"Mi1HaPJդ\bjE)|b&[]MPgYH R ()w-=fɶ>K8hGgYm7fP66eA7pC% _R,l mrPY6`#0`]Qf5.m'uW&B-qyh dJ}0IMIIgq}%p~fZ4d*q׃aǪHK=O,hjH?[H0{u-f4&R}@r]8u}m[ xWǷo8$oH=a& Xʇ5/QJ݆ef]_bH- n u'DzQI75\Z <L˅dT˭{ c͑.;%- F:1#rp mBDZ-6mM,$ilVq3ѓ(3=aGR[ L2L [(BV2;"~}7pFøi{f}Fz%)B. u8B 65XQfNZQ\6ց<\Dޝ}?*K;y-u77sE qBk[ !zc߅?l;B 6K+9y;'vj[unK 4"z O;}Zw::AZ+~AKSi :zSogfדHMrȾ5Znff`Gl5%\:5} mQAڍsXh%5굫^3q"WSC<,@۸SK$/пKeڶ^>BH^fF@nƂC ?n Z*Up_j@$|Cp7( `QSBRF}6^)yrFCզY4I`y;dPQ_M?kd_$?Ґcf:gũWn %YV= e;-%Pw1Kь#xM;o{v/hgeb[+ުQФ$@C$3 ZV.H:_ma[>򢬱zHَcfj>Lzl"[(@Pcq# ZXU-,ȜO:uV#՝ld.VI=>I;wg0ޑ~Ƃ (قsc2zHeO)0Q{,0΋$8T~C46:qa ![NkwyE~of1m\LsJyknG8>#[X) $5,C}7o79or`I_Qn5ｸ |^ywCYj99^d9fWU(7 *  N*cPCAJ8`{_݆Ej_}% *ءBiVLH9˿D-d0eqN$ %߼_=185xeٖH-NMyUP>ȼ7=eLlFQo4'%׵CJȘ8!%DJe4N4[2KUD@<255lyM mHf`ĀFDo{^ ekދ5+]Z%W6kI;F l Rbة뱡E64n,+sqx6-a ^uS,}ROk!0A`V-M0\*WRB%U՞"^/ݙ-em*Iq2rHF+f f/$. 0J~o{O`cS`lGE/Z4&6i:R25 xbF`eҏ/ڌ##&0ŎRHvEM(Dح+* Qz֌ k6&E et`CutAn0D388-K. l׮ 2UEf*ͪzW ⷇URyo8cPpY_8͖Qk[MI*tR5 n~"ة*ɝeL= 6nk*cod)+ % b7LU-%9 ` ܣ6n4\ %HU|La,Q'"eD} @D~+]GIR-PBC1=[fG❵C\[`EZ1{d] DQȔ@{"RD0fҷ<^q=.9N_37IK_-{} RBS]Pq7d8UQq:- #,P @[e ,f8LQV>j> (qBm,$.$r왻;8du}NC#M3ḃ}F`Ns3Mr/TYg;&ս$>S0p?s83 L^H2'D~dz|糽QW+obpE-\l Y-6 Ţ<.6~AC7m<݉0t5zlP SNJg_w4y˽95VڍEm"02_xp;^[ضWܸޭFocD9먵MV 5|kkc2PFz4 B M=bWl2j'F4z}oRyOWuo_FS:Tu^kyMȃi=. | L+V:d-iylroO"!hskuGC[JQǟWwtwX 1vuۜm ~͘! {z}81fvԦTYA&jDjmX2h ?=b6\*r ,w~&yjcer1 R6?]}WcF9Y8^ynC+ˣ)3 y8;B?'aÝ(A F#K'CSUY  7t+\Lo`DF0bzFw|n} <^H4~s-t{F1#d׈u}4(A+[`K̏WX`B07K ,U;Ƈ]P& : &Ba&ޑ,r;e1+Cy.6,WXu<(_JU %^7_* D). 637 [Sk}Ă=cdMnU<&$xlXwUJFk0o1/'"2Si>@lT9o?g0͂wGv!Y$=yuW0*˼(@@XFCEhNǥݤ@L,UYTS-?#G%D2zA>;K Ci%yMLq\-z~‑z!0Y+@"^!h*z %G8e1d=W[)kSvn(V͖<\L j|z}[aΒvpnA|$vVLŦx{٧OػuHY~*aYREN~y{z< QSt*֗]N m}X]8RY Mqf&O?3"&NL [J$ݜNmݴj@8Ȝn!$ !8vmq>LR{SM{!Tv+PRh X˫Na }"90v%Z$l-OKQǨ4@b"\S&EX71mjwiTRRIEEńSLtBFMbU;>ge; rJ%VGN1* FƲ7q 蝭Ʌ-@ZI ~:uuQԨN̷20L-vՆ歎̲^Pvm]`:FbkeQſ ha \t(rKk:',FB]Y\fݵT$E]vYظ]foL I(Yba{ppJ .97;@/$+g~'pɩOB\n2s՞nXnW3_|6k~g ;scwČ5wfQƃCvLܛqM:$(s!aMJ3>'a0ִdwReٝ {Vy%~DŽگr$oU'd5apl`%w~NZ~s6=Q-zOAJc':v#P¤b[/XVj[#]n_GR$Rݽ{]roTDD*:V 0JS<ݗ=}Nuls9RjBcqU䕊뤣$-'iԬ/:V6L)ou?{Y#FKC'mʶ",3Ǿ 9ܙ%ArJB+" K$*2,A- 7F Tef =B቙70F4%,!"% {;'f0٥9NB0t&TbkcMB)骮K1TyɲOxfeKLFoXW 0 -A"MA `/b:KbWy-.]Eb#|Nfz-AO69 !0:=тӫ涸mi X| *~|,!W;XI_\R Rfۗlba< W"`ԩ;!UI=]S LpDv=d2l^vĺAB&kĀ6VxIG6,rN-Wو~\$)2@HUuH}ʺ:EwE~W\wfX{a*Pn*CizRNo#Aj)8=J3!& 0J`A^6D,MxH" .۠r * RY`2`#Yںus(E=vpa,MFb5`/XӞс+ y*.{GevfZf#[a꼾6Q' LT@adRɄۺ]=sFK Aj IDK $%hwW8R%U lWe2JP j\|)ѣ)dBx!nbegic, #ʳ}T~%\M*8ǡ 8C Pao/ mu`Xњzɗ# ˥2HE2 GCp=Prs2+/ݑ'$,`hQvhpQ7V үC < л[oy'dz@AdC2+'!IDbmcI?Co .˩a%^z?9ֲPiK+9[\]X@.Cx2 4%LuqCE3:lz.瓳Z90OѓQOͩhv;};mb6X#F"3e2ۏx?#E Dz}D5B'ngŽIdtoyň!mˈhnGIA'`v-C HK?l\B"UHANy _3 جHYsC9303l]DP FϷbE2?C8)P8^2ѵ"h(ctTfI8!{EH2(vP* t0kɆ4:/MŽ\j@_COWu_U{~v7H+bm?WE|mీ\E B"\b8!K LF `+7ʧEz ӊ8^C9"YxwFĮCU8(W NZ?*S咘JȨrH"ѐ9c.|_PQ&Tv5` ɱЄ$z]+v$cQ9)^$(r㿠;O/Sܠ醌̌guTOXi[7mT6BGĩfT=̈tHەʹaozG[TbA(WV'7GcK KP9#^Arbo,-oǒ. &q7gFe*+4NSlB 0jS_@CSEZS?8!P&^ט%ΰWI@o4A"Dɩ *PcAP]JZkMln3Ǝ][9@#ą#H!hZoǃÈ]Ͼ_F"yz_4@ $ 3, hU70|Kca+Bқˇu|ꆭL5MnnD"E}]O[gx:" '&%9]̵{Oך{ D@AEbp݂lPI#'{E0ES1Dd5q;}G0`3jut5q_~f8CH KĒ޺wt[L"4@Z:oWW-bkznnf F= VY彎O6EM_[`-ȁ7 ~_3CD`D%[oLEmC7oqc\{iozh{ځ^EkN4$Gr.ee숆A `,H0(4l 9Ԝ8\V*C,Sƚ1crViH~@W`A N71B{/D1(`b'ajpk  8`p{f-8B r9ޑfҶY!\La5t]yLIU@BjZhA $x[[h,+LK5C.*(f $)B}"9Y(D[F{?S^^_ Qh&,Q!EFąز22$#"6G%~'>R=UJUAd!{k{DXcE"E4Ut  X=zh&(l"0΋Q ^G:X Akl'~,:'8k(>ThmS9K'OinV ; H-_ #*CnDNˌRkSc`΂^H&W<` \V۔A@ v*hdp7L5ZD ڛ}P3E&r GmJA#HK8FΫ!>N=HͨމEb+m|5"~Hj:|y'?TܤɪdJMUK`WwE\ncA z3Jdvk_]l ]Lrz)^abB@& o*i:(79Wnf9M7#ݴB'}Y ꁯB9,- (HCp17kT3a''TIWߴK b†me."tB71 ]:F=:t>xm/24Z8!_) HJ=f=3t*d:g!1^zNks$WaHW=.U` QZ #Iwx,Wt,;K,2$M+8/{.%!$, ']=JW 'P!:2`|)9S4gv4cXa0䥲.Y)0 4y~kkw: yj A'o]|lwωR<̲=^E_BTT4+}]DL!(5F5_L{ y>n^˪4'e>=_@\[ΒҎPzuOs}[>42*[k %Ĺp}=KdluS!sU`ΜVS5Qc.1g"0s`kz_' Z"K%I7v&|A|;-rg#>rs_Q\[sꅖC_| '[2U|C;m:@S/tрX46~2:&nG\U i,>u_.: n\H.|?YFW%O o睺1\<0OoTз=UxHf}2g3+"A>ă:Gp04$a &f|sO &iXkӸw hKzs ?l_~=7>x9Ú.C/OE'b p6wPL*QfWD&t&=Y;^mvǨ~&g`ctLN4* Z\PeR1]jaRPŮ }tl8GvnfOlˢ; #s 3ճߑJnHqeǺQxtHn _4}:1MIsnlVIJ\~dJsw Pσ kI}ʿ@[XV#%\ܟ, ]JW^m8$T{:EWe[n{{3!DW;vMhVFQV6A1u>Ʃ~?d`s{&cB}J(H.#_O?$->D{KގoGA$ef떣 - l?@F͠\[lP1x'RyB5)9Oە!j,i$*6 )~Xܬ[TCN|,|*@X-{Q Oؕ[FWG ~wD1)%Z"ӽܥ9훅M A$ s9 4ojœqބ6"2ł{gp=EΛIA%PA?!4*Fj;d !|)-ҬcۀP$3X:F%Xm:X{~(ϋa<,Kw+:)3땸@7? -9G ? $]ٚ@q9NM_Cuyf%iMBᎄpqs'o9C:M1M?7d;ZIDLb"f>dh0픒"Q O|ubT@IXoii\e-8yb-QIqseқ ೆ4n_by ]-Ivk $ƬS1)L;[(X0=W=r! a Y>᫒w/:N]tYOG=XnbFW_b Vܓ;5okJYO0#{gf=W#N vc^ RjxKЯDƣq|,۴>QHk hS8l/ȋd:cfW CF(NYOɢe`3 oQa#:HF? G1+ܪ$zb f4fRЬG$CoŪM7(7$?5QɲSŀ{ gY)*ڸtYzw? z[I%֏zQ1õ7fL*`$7B ;il-VlF 0">ĺo@D0AhI@z% fך1Afi]g/e8lC,ڧЛVʽJʗMm_naU\~\^0(=E% S;ȻJS9οdy 쪟hC#Ѷ4sMDhI"Ǔ:$GFS:nJI'+;4Q>>eF>GI"÷Hχ[psP~!rʉخQi$O|1=-%=k( ƑqAV@DRHNc"Rաx8_')t`@ Ėu6,'5=K |MBnw)KixA~Х? #L=͂^[˳B ^ڑJGD^A>,_c9^ݣ&/3+6."/7C:7cy|"X&K,AѐqU+&msTܵ!I\;0'gF_jR#%8v+\FK &c7t#!T<*ybe"rC̩Gxw ƴJ)wy[m)X@l3^̏H&``Xz$o&p#S('tc}W/>z^┇Sщ&l{ugŲq?myzwHCezף*pi" #aɵqWb"j4[rt-`XҨJd,I!2\{Si] L|&|ÔkG{Z gH-8)Z٬f撴f{$Op=# n˲h > BK[sgߚ˙o5TM[r"2 Рbv-oN?HW)6n"-M< -SF,O =h&[`9v̹_K6Nb^T#k mUh0Jᔀg2~7RT2h%Ng`L;Ȫ%G{݂hXS X)G, ,I_dtb(qy!-9FCe2$Gm`yޚ??`6ZZonYSҐLfRolr?qɥio>+nS`Xz^HQ0^/8"WИk_F ~26?dǫv#ZX ݷHqv/(!$3>r:1Kr:?\{J?+]T^~(r O`}84 *YH2qyLHplfkaxmӸ-&lnшO\C"IBb m?7d w3L!(ݱVR9* f'S &:]joz<vs";CŃ &uHQz"چ \&oA}C!L3Sȭ83V -3C_ {~4oWb#B95i2߷ >wf@|Hܳqu6D䝫x;$>rJkhcFtu?괨*I#`תaFrIqc+OK,jk&эOD)~)]i-9uьӜc*#`zkڂʼJ3@`]@ٱJB^)7-7% ))kFY 0YZʒ~y ?^S hC A_zx"QJnAI˭Mg#F6pT[sk Dr+Irgш۱lOÆPiX_PwƊsEb|ȑ.$ HPHEylN1(-K12|s= q5܁ nW^h:hL,GL!ZO!CF  affH41s w E{HM .ǪeyMt\,TN|xLElGYcxxgOBKO qpN˦q 8<|J+̑kVX ~'K\Ǡ9wj ' }j4!YB`5#*n=*G/ZRTWs,P2b2Aˀ2EJ^ĄNȥ\qgfnNr5}]V$'h/)7pn)NhQ3@P;yK"# *d2#a ¯;W]{1WDQIM j((\AW|B&x#čs#f!rV/(j1 'X~2דb0\/-.K_^7G Ve$ZbP@-F㐢Vބ?_-8Oʣ` ѺZ o$kϢuV53'Z"  C#娾9`U ڔu R/\5z?tO~SO|q&љrVZlڃ>PFWtpđKȲU/_4SDd۾cAu&y28UM.RP0pHp'u@ҵ++L}Z3x'K!,[ضĚwd7l6ΨPWP1L=:vBHH7FFwKm^߂C00ѡ 5c ]FV!7Z=XCx?7-"iF{6DdR-u{=Rq#U%bF$-kZ:r&fʻL3(O؀^"(FMZ [gTTq|X8 k ,+)=&V$u6ހឞkf- "+:zjú*k)faRI!pZ @~]4\qN$[ al(B>0I)76Bw!+5ȿQ.urON9'IF!= b9T{X b1am)?G+ǒ-t=lZpI$!s QY?WdR uߺOu@ ϣ[M*lH=;?esNWv^Q>I vQe|݄*h;+"Mv VQBNYL>X#&-0ys,FQJ=#3,x!ѭ~ iD^㥢*IӢxK݆h6U<` 񪃠jޭa},-ZM p 4g4ðy'x/B4.P#mXNԶ_QN 8m $•Q3e\%rE3S,%1*f4>CV4ȏ+5*Gs:Ns;lqoW^ .,?j!jV_8joOq,q>fXw!Y=>A{Q bVOMn%-Z@8a#G%V>Y}dD1Wѽ=.;ӈ&4u,a)zfmFpaBz &uy_wϩRld/ۿXhDn0wbwQ mDŽG=`x@Mq۶IO ?#FEsa5P@դZ(-a,WfWwcKBG<QQ~Qj~ poE^b"SXGVl6h38#Q2΃+ ݡbR1 sC-@48AD"c ]Kh|F s:w5 K7AO MK QjxzߛF$94ka u-Vω0yHo7Eq#JW-4Nic[& Y/j */ʘ /\ZwR4S4zPUYeَ'=PEvǧtxěYyڳ?@Oz6p=QTRMYV0 @D3?Cu]=-pLs@`9aY+#Ɔע dc?-2CxmNHI SE.yimW JVDuKoܗ;)bE;R.PN>eFýfvJ"P>i7M'&!%T 4.w Wx7ʽ ~R\^*q?jZ~A[]9! ;O[}%#ue=SAP&\zO{6x@%XT"i%VAkcX@|Vڞ$^(JeNacUh@ 7F8Qų]`1쌨rᧄÊf2j T/aewl`.ϸvt';VT}+,ەbTtoUQ~̮ z!A)1V P!qz|EҌu$U6j dkyХ{Tvꭑ.,ٙ¯"yr3egj:sQ\t} 0)3{wQ<Wz.c封pP]q׏߱v zuŕ 7(0KȾ lE#L\"$rh(}h"lFE,cIBwR8GCBIglW#a(r eP(sml!=5Sf;3x zVi0 ^TXjn!)8eDjGqS2_$9Hj^Fy"*L1rYWG[]pV~y%|dC52. W6ۏ'uo9MHW]XP/Kcַ}-abCc_ax8Y'ܜٺ}3(rwqH]t;M'sZ ?A߁52 YVx%NaQ#5R.ɓ\ _㲢Keu링. |q?֬jL.|`␧Tс)鶎_$JoyŨXe kαN8\~aR$AY-C(c&gZx&6..riY9`:J0Iwm)M2'Mu?-yt jy9$,xc\-+pwAvqGZNS3f-U/pFjZ3qٴ=[ WNfh7ik;&4GAsU 8\18/Ph؝Ys*> ۄӷiTzȨ1T#`ˌcHLqs8gQdj Q@M~[CfBXS%eLg@=2E>5N@O~ĐPg\dd=.Oz(h%.;9!ǻTc~vla꼡v>xXs# J9eH>Him5:*CK Bjr+EaG9/1団x B}76G/egwFi+}HD9FsسEχqGLnD7J4ETXZ7T߃4y# >]qKl|GdAͧ`[73=1 jP8]$NX§ D#X+VȞ}J-ښFJPđ v~bI@x^.=q#̪uhU`,rųQB4 zs(Gè}C7<ڭ;W*.z\ kH \#>^\)"$B*1̸ ?t&g_?[B[(]^nbБNNu(A`" 9jnWx>o15`H#؟^gBk(^9y2:I!5L;I'ҋ>Sd$^cjo!'I?8{Ay8Oj5=OzG5|7#O;,iJϝA˓l^{[SQ~{ɋ9V I&pEjh^:m0wD}ȁOM`"W'fX~ʹ0$W w6tXm'T: >QuL|\]-@\o"9y*ي:i'$>98Ht2O#J]-bjU*<_c^]x !_HD`o'DJ6Q߾H\ePqgX>T{hlNFL63K\YϚܸSkNնHw)-"^߱w{ FV6c/\hvakƕah6.EDE{H 0>xX_)(_/}ryy(zj%'y}>t[߅V TOtQ_,#(PZgG5ьѩ*hoOz$5I=j:f}3ʕ8F4f薘xLL K%6vޖLފ m[Jہ"N8-R+)+S6bq\VڗCVɩ z⼄BPN&5q9GO7 (3vlFu\:yu1på*N2obU$5æɴ"BÚV#<Ij^ǂ^1I&4Xqc XŸOZ AUnl~~LIFEj"A^ wT 6f*~K s5 v.RN)msf3 +Z,-KPdFio>heYx]浈l*~p`5C_kֶC~ۿ!1ė<Xe81K9ٹfYk1#_P>򺐑޸Q4*j Q3(FJ<.H/ӎKaRJM@gfjrpi8]ek~oH*P0Uq,y\yP4NaB 1 Z}Wd(}ʅIٶ%v.Ɔ) _;!{x@gT"JyQpUL4>DZ6ZrSi[@*bjr{g{*wjݖk1N|c !$X Bh9Y ^j2s8̩/^dmV,"*JQ$5pEKIƇ/v^g;k: &y|'/_fDL| +ڂGr+_$IԤ5.n@I<|Ѐu~- Ť;y 3=|B[~]􊲂iv!?stY8ʪHNЅS?Ot_Ȱ^$GS}oOR'BmJ^Nbk*u{=+k@)=%ר¼OLATz>;6fa(y?NP&? OhyPRl"EE-#9X*œDV/g(!ͼ{>יr8Xx-fgN^W(f]y^멄 N ltp}h4v ]f`D;&.q{-zpn)4ȱ0Q2w4k~_pZs״^m>~r28SD aaG6<ߣBVKnޝ0vKDLtkbB9WQ{3zIc0di<شmzx?Rsk8Y`DJa-f*z^$Φ)гC +?±կˆ}ĺWt'>jj3'U8e&}5SC{) j:L*nYVRfT02à3J=7SB~$Z{(/Otym g`0?#,ѸqyY-;"oL0)|  ԗ+?ֺOYft8R)0C*it/ 5ϧ s >UvpKn+ޠOSx5S~YvxaJ?׆jvepJL!AK3^{%hIu(2 ao1@ D֤њ3 T@*~ښ9mDvY*f_B4]X)vLQ2v}ea}ӳ[NWx˜`\ bSD`3z<& OOIz`/TlUizg5!SChUE4x0Bx(g.?a$b@ Y]͹9MXU$6𬫌+[dY0ZL7COb%@f7/cviS}(f^F6!.[L8[KtecxKiL;fZ]}9< +A-wmT%BI A+;""OM&ҒT!S9@z"̗4>ۻ5GXyfDsaWL/y7K :՟32ymS]'@s_ԜWgn w")U6&%_ "W %}p%pgh>"کt'E22n?xѱ|]?!@{9m\Wk6s d6Ld4Aё5G11iIoR/dѩDۮ\@&LiļUR+t>Nl*JdAJ>_M҄xk'rғB8z:6Ĺ("JJQ[(k'|}"-}4;5n$@U=8~~0a}ؿxXs.I9dڎΉZQ8j/͑k8~lt2Wp-"I܋$el&0Xp66p$"FGbV)Cv]S'ZpAaH"5 X:s$שJ#;³wAr;9d)Pjm#-1[t] 6_3=A[5o82pYwvN&hj!eҥJRǨvs֎q$y6,z65[7{"\eg4Tޜ$yOhD)PP1so̓4V3on >X(|A߇&nu35m엧#mJoۈ^x)}`>2 v CkdK$%&ר(}ib(þR&E?QkQC:#~.N՘{\Ա(Ǿ*CA_ 1rPi|4` 96!'7ZHFڝD澒1ĸ֓ vsP6QlwiÐGu:l6suo$$PK&g#IZqg״ nE5{j8jx{NHor yI!cLDz IHoiWJϺىY &5Ai ğY &ﻬ?wÌzycNX_;26vcO0$l9.67>FwO)#:.9Zݤ.* @įmx.6#Hc"vvcov|oDXEO3ú Ng0hZITZA+&>- &>`iK*4!{`%tVxj86doczܮUR cֈ.wΕDVHn-X=4){fϦS^'u{Bs]թx٘D9(Xh%4-9=f('P֧Br%i9PUTr:A'7whe7~DC+@n(^Hݭ|LH$Y IXrdT#HxYo]刊SY#KO0#~-ro3[nfp rZo֐m~A*^'zV5Eo2>nJuebxjD5,s})0LLkC1^`0ʅfX7lMͿ6AN+Vg^)X-OC7gvФE07ETϧ|YʮЗ;C|7[ѫId %p1UmDl ߺWf٥ 57^?I2=O`=gppb= #>go/\̳?j'/}>vd˟Lea,A}Wcs'K8쵩^,PgOc\*-=C= ]ګ])X>%(e"HO'qB#Edm*O熪:5t(5M멲\ ](صK'3r1fP3SGv.dFmBQC;nFzRq58JZ.Cv=U3"G)E]_y!_jl4kpPCʼnnK=s =/ Yo6su54wD̓sfK"k:5r9uѩm bWǙWFYQ3t.c%Y3ƑSd|VDͷ_J!:%e5%En>'-;UjE 䇦3TNC[T[ dy'`\KV! 3b_Z&8"FHUtu1VЧuq=ǔFKo) KHww1gD pþ%-iU2\31i|_1!Ln|)>(NgCE\3$DZ//tJP"bfS0zP*i܎8El8+I6>* ק&(Z I+,٤<&#BoKO= + m 9D7M_wT吀Ca$ <˶ x* c7@:vt".2)k,@! k%.ilg{?p).vY P#@e Tk apD>94^f̘׸'*ԟ\T NPvap.e l7{i[bQozXe4Z?éU ^r3=[@QKbju}*Oay_h ʧ:?C\?H /VLLOkRsw^|zs*> g@PN@2lx EkD p" (.Ng5:ap:G|-Wz?1]B/~ !,Iؼ3g)bN"l$&^̀ o>x3m3Cjvent7ׄY޿<8^#P+5i= G$7oV) m 𷀓= Ҫj:žJg͠ Tl& aZlgIioHT*ڇk < @&SXwƼ{*Yc+ ‹EGhý.aX6Z95q'j'OтzFZC}2¸|;V-8 ٫|bj `5`cs10]vJ6CXRI?Mn"\ǀKojkn 0Z|{Ju%}wZ:Clz[qs,$r9SW۶z b*egeSEE&3?2Um^?@_|wi^j.szEq 颬Phu'E>&QYi "J@.r§}'+ 32{}0E# sII:).?m ET&#܏(/sB j7Ǎds:,[ьk?Rvet=6S94=,J Y=r.,?ihԶi9K܅Fc%䵶:[kI/[1'!Ru=: .7;!li\ֆX1LEre7 ٌh{ߪ&Tq~^4^ *^V$io&2HՅBגUG6f$֧W86ffc7mGC]B3xi*ڄ v)pTly,OfVuL frE4I}߮t+j-nZr1_4t;mу re̅`jޤ0j9!l uaZ_T@Kk/$#ao FVD]$Z! $u"dolggVdeJJ!W,laf 4gA:P /yd@{рK"Lh.,!URUR ΟWqŧri$Uc1cB h2E*(C5O壜*?=9vr8-[n8'ɟ[j Ưu.&1?蒣*Y+R'7o/Xq)/(ӛ~>lѬ{c+j]F6`nqHs룁{w.:MlC ag Qt ,D_ Q#hĒmށRPZ]h)*tu?e ny1sOuyMRr2ɏj˰Mc/atsEP}_sl٧〄ۯrkU~Q_H-_l>YR8VP:!ݿ}"v5k! qB떔N@>,dWeH^05e4)If*I߅NrBɹ^Y2X^T"QxG(¤Ƀ?ҳɕ j\K Ȥk=*+&YyEwW(<[i=yG/ۜ 8Nx 4Y6¦tJU5X`6a~K̸gtqa/ZM{:)9h56]$vBsbI0ݞ0 Z'Vы?Ծ6_C dkUeiX$Tk^a凍 ^*_lTn{`ss"q2aF]`efZ{ XyTmנ_eyuc*k &oZf#!mٗn$̧3 p[DxRkCVL1ՋZRA\Lp"+DԞW($m&; V'f '5c_Clv-\JS 遏;6t>wO%q)O0kO`NHEZM{oy;GO%vxxX+qž.\FQUqRFq`cmj$Ք=mĥ'Y~ri ɵ ~f-k޼@CG83c =)KB&8^ $ 2AOwєpeN.ش@ p񒻆¬rs -9G y=2'_A|B_DK޶rcIybkKC: -7eWn(iz^'=@ߞ\`SOukCy{w݉sDQ RԹ`.o6 90FqiZ_./ 둯3{ဓ2נMr;~]z ǏCK4'&_2q`ti ݔx  x=;AdY)>VX@nf>,hWK薋qa{ڔ p_8M380h&ղaCG#K?[OI.{"꡸Us?Q^`a!ĝEQd}gw#էpֽ KP@g̨mT.WZojaWz*6}eC8nޫи^ˇe{`&k1w&t25C^ G/Kۥpm![h?X~q'OB;# @Q#?"XʟU lj#7d1l,=gX]O㐀1,\ AʷNIo\IK9Z8_Mq˷v>2ި'q^KXL#p 8mW̔+/Oبھ<_\Xuh?N_%h#GBaJ}_Oԁ%] =!$Y'mz2t |@B˺2Eq ^Թ1ngnGYtG,_~-2[",$|6jKNtV/.}Zhj3eh89 5QYh9Tv$Jmoe ZVU +(#r80g?AEq檏fG.vP@)\g?W?yKvؗ[-gM怎ƏmT~N& DAyb(^C{ R\&G{UxX}Zz.n;PL:Jy@dS/_YG[ J^d-9a> ,gڦ@;) 6&<j4){(/lӈo1Uӗײ7{iiE% {bƎJg'%/Gc>:F]U aY[ V5ۯ>A6g޴U/fFy}vaUw(hI:9L#SPTfQ,BQŨQcÞ@a ٳmImz eǒ%M(.& NUl^-Ft0xf~^< _k>hY:@IC>Pb&-2GXLc x{aE\z6F'jͪ#-O_NPPW_TemѻwacH-3[EzI?Q uzo¬oG͐daf.#HLhp !ܦľ`껳b 1pд7pw6%K^Sj25 @k7á(}{If>Cv8sB4CǕ7~JBg(:c6ͩj/ZrС&p[ڜ>C-q#y}rˏڴSqhZ={ ՞'()*P*&:%hl^%x異S5K(r)JQ_.$]sv}s3[GA")XgF3 9us5>çcg- li](ut wۢbU/pZgk' *}w)SIq5^B,[]^ 2k1 +sgfe9IlKV*,x`jZPQ_TM,DM;b/!`y϶eO?A&qzAuF ;#ua AIW-wpp;1Y? [":I"̔{ V$Q;1II8 RLEdd BTP(%e([=m{JW2,c7.2`[ڻ.MOB 'Zp;>VGfyZgr$lX=J;[LwN٦ nU&^F) eAE $^!w:Z5cś xB90A6iO!Qi;*$ͳT ʈz1M&AHDbpw"<s)PIe<ICzMJmOh`ZDŹ֜'x9 1 hc%051,`BeCB~G DB \Յ-Ծ*f5%_GJ>.r^ Bjfdsuuک3ln1}9wN4rq/1XF[z2׍çNlGi._H-㕙Y˭>6ftw1PH7uN)(&=:gVbTY3ua Hkypk8:6WJ("m#a6 #ER8K 08=pfٳ?4򑔕^GdVߕu oLs@!Ɏ=:;5$ MXnߋ _yd3l2ƟK3=T_[b`.3UҪ G#Sٜ#%IA/֭ͳq\U !dBR7/^.ټCmIn(W"ĢxJ~2b'K84S VӚ׃Pt?(gy%.O/ ؿGZDsu34-W +f'EQQ+di-%3]klj Fb@sHgSdVұ6&U(^U:}Oŝji!ڛwRdp2B *(Jf,xHy9$ ٦cQ '6:L|XrϯqN@'F+xrS:Xdu0+B[hSd6MBw: rZCZ>RhzI߂qY,O, #- nIdeց}~}[3"UQhw |Xsr>~3YD=s ].!{!(+iKLJ?TZ@B:Y_i[ G8M(Dfӱk~, Wq4w6+yźuTTy`f9pcj #39s[cr;دimvAEqF;v!yyM#6&u&=uCPHzxbN.a(=B# 9?°Ti]0=w#y0I/O x&ԶqlBy1;zju8L<ὶ35hE7hV{+5o#,=| mVm^wR?Ӣ6ò8YˋHgYtYGPZ% Pw.ַe={L!۪ӫDZbaϲ>4`J_-FG0" 9ذcPwBњ}އ[#y0 -`@b3q2"D6'T!3jYV<Q oCWR q DBb@-bj^VRzlRm=dY')*xgHXx*0 NۗwVRpf~'Ggee@d+`bOop@Q D!p*Ōɾѣ8m*HXW@%wC{0 󹊜-LSa0MPzGV7+D\FsBr nEE[ᶂYhoYJ5cqN ?ä `j$/u7Jc'eȠf'q t͙* R 8Bv(M)3A`ĭ_m[. wΝ 3t(̼2 ކx^9|we8`Tn),:3M/vF*5b," EAp9Q /s-)x)bȈ髟ts`2[g@F٫V$>cP$>1T׺uc B wҀ l'@|eo!g?)Jz%nyAJ)1#ATqG+UiHDm=O>DvjI1DހsKpM$dFphfSIog{3#Wg$db#["!Wjק; B]s Hu{<_\zc[yKUr7/ $$w;GE 3b}p҃ŤuǵzQftA eb?<6o7VhW4.wcb6"1%~Ig܋,0#}6b>6[MXlȷS!AݿԱl|ُU@p&)o wm;yb 8P˙Ur|$֩K$U=!*]N m9d)cTY r|8.X3Z TixRWT:Ifo;uPGq81(Fu1 uАG䳙svߏлC+8]:wgUƿ `cX;\ܮ$,=KKVśCDjIb^P?0U.Qca vؿ)7Xᗴ ԏ qrcHڱRqeڮ3^_oxyc%ZAu|:Y\g5Z&SS0zӉՏ>[ڙU|Rfê[ eփ~~xΑB{U^2KR 2VJ 9lPI;=lk{^WŬ2gFv`—d>+,0s2#mWv :\?)l:;\Vn`)?[]Xdڐ2F]f|ywCՂtgt[w5ECšF N4y?1TLF`iHD/:ތh [n~/v@@,J斄D f=p3WI#F%nX錎ؿ]H<:M[=]}JKI`ZŤÇmݻ,JnO 0k`1nhU^4ῌnb»P2hZoHI Ӊ s4mi mNiR9|u*{r]BGh&2& }k g8o݈^CI*j$7M'1|(i*]sWܮ.:?"m.5ҐIgkΏwVy:"AJ(/-ٸs (F̴Z%kwT[w917)+*~^7z0awpڼ>;ۖ-ǗZO#^y^Spc(+Ǵ6.S̢KR_LcJfǏEAF^ڏ r{C m*7bqQGx#bꗪȦq:w’= 8UzWƃP)J&oüE:[[gt&|D6BW!7A0H.v?l1L,,C.!@8@}}ڒ ~+xl8  rbN-[!d)(_+/:EF{߇6eǕ_:Q)9$\og;{r(>d褻] L3!T*u:ȕο#B95E)Ū=·wjiZjH,13X)>bjR^`.+U6>!H֔ȭu* b&!NC_XNbDCdPcKTFUa9z$5^p~Y:qj}*,2A$dv\@` 9o!|٭dYK%C?I5;(sD0uQVLZcO9.P$hhِ1%|&8y([HB@jx/;s!3glx)ֲa ©NYJfCgVҿ }@y39-4\nqtrQxo[+60VB7ޝY/ O&Du[Oxr~əaݧgq|~[8}XKGiJ3aS״\u'vLx藖Z_;o d=h-M,ӥߑ7_-Z75ٰdz@34 +KOF6@e&l^2wXjbPb+ ְ~ i" _s0%toUa36xɍ4 (vQ^"}'dV]rG([{0$ʜLyW1]k;qlFF?5CG"M q=Z7iW-iӜy]h<^qpo%)}Me*@c 4x9lkaBMf H*X ؗ9^6  O̼yAWN(0{B( 0;$_rS㪃ABm̧MH "e&D2) kwuQ5<Ųzsf%h`?q7XJ"յɜ+ ߺܰ&%Y,W̵^BjCl,݋r-* m$Am|Vܥ@{Ia? He Ȭ1Bzv "zlF&FGcŠ}k]=79t"X*`'ǔa@ yzۡcx\۶`Z S,r0 {`~SL?ٶxVXZt:n8MJ|ugC ʇAp W .[1DVHDN*nV/=ufpB~ڣ8ek ZIS+/2wD4x鵘Jef)p3/IY.rq)_L܍&ޢ PuOJ W$_KW 0l6[hܴiNh|Xj.Go9eb[ gSPQ^E\øX*nWk1E=%ތb'+1Ѵ^v)']A )z/N=YzٹTh|,?kF4ϧ._pjnt 6ϼXdҾ@Ȏz>tN"'1d+59crꇼ}تE9g 8EѨoiAm2eU.m 4|}c*vUxg?h7FdXZIr61ަ#Ly?E=G]8!3NHbAy{|L4~WѤ*\Kt9O֘^o`Z ]ucS5եD0}l0R?4 K?<B|8ޱOϥ}3T˾ڿ3,tz>9Ee{W|apׁ:=ەq h+(: t~돤uktc2Ӣ؃SO -rC_ڹ0`%][r‚+ y"\;ApQy̔^s\zVB1i̕6SI] ~%v>SdF':33^?tB:]7u[9!8V ! -??59$5{\jw֐U]P1*˴FxýFQCwֶCz3l ߵgege@N7 >NN/`[D %FpLrxjڱkmEp4 agL(_@i{&\}Vk0.Y3#|_W.-MiɆO}eBǫ ײjpeT. =vG6CAUjSrjlÉ4Pڳ (!h y1t wT!O q olK׍CX1llƟU+@JRi'en0pߩ钁"u?h(/Գ 0 +\7=z|gX |e+)yf d[Q$}y ʦ;S~ѓFZˀxR+VjM [l'.\_ҘSV wLs AC 1tDb(jYrb4nG>.>83O]Ӟ~ [_O,MC}JO+[zWI> 13e\1W3muoM-{w&#;mt]]CW^cW"A#~עB޲Gz'M:08nNX $h9vM!oҮv O}|\jz1!k(gb[v! 3M ] l dDD|F JQLOY#)Q:Clb#$YulJ6g~p֔- MCCISNs. ) A֖, $&w,.EǗd ~818KkZZ8KwŸC36M%݈iO8_>'EAӀQNj^q]i,)ш/Yiފ/:zJ:. .צޗf|U RA=u&6+xV`htP'j,?XǼh؜J~[3Ghh!¡ r^ DM)kD8m;oZfޤp/&oYpXK~ Z19Nn>kJ$Y?V ˪hW;^,Q+~^-&ޜ4B5+=N^Oɣ8xlGi^7{AK09{DE$}rHx[.hmЁܯ{/܀ZoH>xOL+< .xuL0^m"Y"AB"ؤ!%ڄԹaF9tɶaHcjT4iރH+Pt3%4?fz/(Ci|aZzmr0{Y}P@ N3;lz[ւZ8aU RԐ.'0@3T_-諸ʤ5 X< oe7lW WIrmq-t|IƙB38Q H#kTaT;<H1mmI MH\x&ʋR[b kd[N?w|D)FlxvqʻW>YOEpcr$*bٕLeZZVz,7a)F2P\ ܏ }'*qϤenSUxaQO(P9\U'+B$: TlR[A=jkJCOO՘?m[cښ;mKINة[v Gݫ0#L'6fڎ[ U{0kdV0}Y}]^:qs0|6Z4>&v H pLtۮĚ`]K%33o*ۭDD/y(~:מ.KCqβ.@֜Db\qr'D?^#|Ǡ' se=&&Gp%lۏ+MBAH]ߞeoO6&:>XMpu DDXó#5fDcܡi%C(K@P!CIVx b&pO= I/ƾ?ʕ_Ƨ0R;)(i< Z႕\f Km6dgm`{$ןg cz y vo9['~?a5 /me:$v;>\l/ _$\ }FoHѸɥπwo@p08TP$4, [æFaoM *]Q(cfX8!O,Tքzz:9ʒZJ&YR\hޭQWX'X=ZAi.t;/>-B *HuMhŞr/02'@KGj Yk# ~0?Bh_:sY\Er;ƫMk {bm*͓}GdgEuݩ+&8E!?5Ζ]`0mXL;~c\{1T4^Q_DD7=zO{VcNgUcTCRԯùSK^:㦰v{k^9tHj%&>P\SQQqUrv;-2Wgh䡏zYhj i~Wk6@v ϓe{RLPVXC7/B`:YfntVӹZ:w]沯>\~ӽ5JBHnAe)_ͿHEn2 ea::3gt\Mϗy ތ>c ntL yՐL7NY.%pZ%BFa㻈Q껤տ9wjȰ,H>^M#`OOSd> X\&(exlv@0hZ-壏s>a@U2X0uS9pӎ/l*AcL'j' 2X}5 TJ*WpzA:cpeqXL蚝S@8zZ-Fd]֓غKEkϠ2Te ͆ZM4ʼ+tHkyP~¼ڀ%{haq7o]eFnN=yUD=G(\;SU9X GwWںnho*+,?9v77]Pݖ%¥`)t6 5~=Sh`W8dBmPׂ%i &s'"[a' "Pzw KMS|JTX[z=y ֎uXnIπuWT4hSWRi&0' /Tܫツ]w CkTjb3Z;8㱵QV[ݾJrmy~D(BO|DqBF ZJׯNZ5+ \v<#{Ce98f?~ j+ =ObEn>MFHvEѾ]k bWH WGfF _M˲m {,$8]\L_*_K'@l_"6K9t^Uv 2 v#$P[_!P_YygS(bh#66'=l  wdS'T!J1HR/+ڞ4h ݱ fE|uT2]0I?u+I` G[$CbF3$$=ZY/v9" ,ЕbLǪs]S>[EG9J OjԖŠsk, -K$GGޠ˯Ș}z<7X5)jg +Nwucչr+lNhyck}9X~h 1ˬbE i&O S:]@;cOs(!{+Mƿ},E xcD˻f13є{41oU2bBH2WhHӇ-Ta ˝l&.V7drʦuIXtBhUq5l{Od³罞 ngh!вj 6#p@U|y}0Kx'5[ ?gIR '+A KPq)5nm̅$UQ1'6 k<τ;Kِc@"ADfWzɉVjlQۗHNr2nk*3Y益J~9VS%ZƋYCbuH./?]YF.Nrs2 O:6¡( ouI@f9N3 l[x&EYIx*0܍0L [إiδ6,uHPN=[=/w[2jUѳˉ;jgxّ?H 3hQ1VU]?rvKg/ްRpG=r-WKc5Fhաd*ܖeQRdD7RYQ}|$zyU76Ǜ~Pߦ+(R0u`sl}\1߸s%\c$;Y#?cr{X=T,vc㡀l7쏬ݘ5Ll[~![a->eU+}A j/*' f͘}<-.nN0cⵔɗ* FQVT~Sxj u4~{eN_--`;_03f>R {!]`d6Q~ R~iX*W0()UkpvJx2͖,"034NiVHw`b5<Y: Ϭ4)+7t3>ԍ6~9Ã|yNP|ub%c2bDثnEʨ?㉟EwGXV-F= Q tʰ],+x#rQm55Wʨ# +XL cfBr`b zϛ ki*7ol thĞ$fآ|PZ<=oI60Vu7 W{D>])>ְ?R?A.LaU((J=C ۺܥC~8JfAFu '!+OmBwQ4|t_@yǜu e?C-W#r0*J*{>d[@,Urմ:ؘ>}3{c/@t,T) :> t䙚 [ 1GKGrVMa *3s ][Զ$f-WƖoPJ>%Ct=Bn`-wBb i?RKe\\TBmƒk:(XQ[T j4֔ X̹O- amnU>%;J"<2jQњFY8 Yܮlr9ԅq /9v zxe3RmGӠąUʻm6Y.=ݳ&)p)t#>XЗ)k)-aeW<TIVX$q+e~_ciҔ~nޮh&Fj׀A,߮{) * O.mC^л뀗ed }KWLx%-V=FhЬ(YϾN gw%)SJH  Xr Ř0E Q* cBst~kbbrh\"Iy` E5(E*4RtC%ގ/wjG*LhwT@7Lp+ԃҠqB7aD*eHֶ-OS\S8+%d~PA r VP-6e3ZF%(17('C)h Axթi#N.@ K~Em}w~,X9fċs`[&t&\0soҴ4RBfd3T (lM!65`ȋ[ƿ{4ˮAJ0=/aMT܉hP{lQƹܡ RՔq\U|;Fҵi@mp޻2k{aLK$&W IyB1Qֈ+w1sX%zJ~6VvIC pW3ҝ[HGr[ObU tC^GFB,cPD2T(N7~ڛZOUFޚ%C*M"!e~/' ͽZt2J*8c{OtC -ex(9* fI3 f#A~vKRlMnBKKiTU6 l@QO 攠Z_r7aef P d]&E,UkJn}j/nE$&ɔ_n7wtadoSf$B7X.n9J3:[vbwI'-BXx'[5a&ho ;ņo񣩬(ˑw$$/Fs)(x:ѽڱOpxTÎ hH&"}+>,y'}E#ُ6AZ0mB18'57W7ސ3fn/PI31A>p "DŽlG1NkCjU˩ϲG7S0HIN"![FK~ %ڤAWppTB{໎.fͲ&{aY|m@*=r)AЪo[ c nqָ АJrs-(uP]oGCp[#1A^Ki(òQmDq#jd\dDb.o:u+B48눝=nFQ?־hǷ[x{H}!{ɕxra1ӬU!]()ϾC?ב_Qv.2Āvݻ (;VA*jG;edJG'<z]&DmF0 HK']!Y74/5!!dYhP aP$2:qtgP :EeV[Դfi]C3D}wtnHٟOewuI]Z~6NMd[h@"ZzW*2ve\pz&5Kxo; "Els@K S#0fS3PJHNMoj@_~$p"ZCb6t߰ F#*>0fY[57Ee059`BOOLdi«f&)v~z] MGJ*0&HI~8v oG\M e!dZJle5j' Tx>y6 0(Gsbzsf]SVF(U\2Xa^!~>JU6{2VLҋm$(cU+2`SE_vYX&l^X-24mR 9>c- B+Y$m lכgGly*# L6pMnwWs;)ddAW ͛6_ơ['t~]xG UGXD߾y?Zt+J?1.[+1!n Y)怤#o ~Θ!#, WP-ǎ қ 63IQ4JPULHxe$_hoGj6|,bɪ:H={1;>{72k 1 . z*csQidnj{}Vbm$G>9NYlAczp׶ݦ-zG\Eȷ&.[VBxp(A3vpO+2ƍRL9to@wA@6h^e?AqwHe\ `9}s NպgvDֿkfI  % emK(Vߺ)s| i/LDd4>̭s//u s(i씲/>Iq &DȂv/&(X RѬ<8[JŽpLmQ9_'>Ndn=8A0r TW8˳.w!.bγ~"ShYy2VKx>υk(S O9D%es"9C ׿S/\=#cY*C;9Ӳ<-|qބn*.#~:n 5AOVq!R;H!m_c3T vz8`ߎH'TjjQo8.k^`@K?zdCMU6g"EB>g=0t1txY )(wOP 9Qw֞8Ӄ^Q{?oOu@t9Mĕu>l4u~VtٽM*R:pLL:BаP;CrE4$ë|F]6BO<I믾aF0'A(\{{c;1VsO3~)[%$/t'B.JK:h`2Գ#-5Ե/T&մO`ݥrQ*cX _M~ѫsD`S\;Kۑص5kr}l`|h 3Lgw{1_ "}Xc R[,-?s3EHku{EP,E,\9DʷwC9ɐTj-AIAYu8'R'B8Nc (Ċu7ek.Ѿj[P}Eر|{aj~ʋعnZqH xF NqOz>{wF9ԐقijZ9\6;E=Z혱- "d3&f:x2+2gBa$;$ UTDQ4-`R%U "y2(071٫nZRɵ;nQNϲz_ Azs]6fk/}%UhlMm*>*wZ.V9ӱ"cc'<~Щ/&D&ॵj_֖빪pm3g0~0FBpTCiCG`-izbf|h|%-Ői)r+-΂j{5)f _KrZ7FĊ9ʑIyZsUrqZfq S<0]%,uufZ$-,flXdysnO~!u7a]⁃؄U3!-gmD)}Nu|:.yX=VI|a^jx(!-r'FGxsg" U&ɟݠ*֔'jB_z-𓞅0Mo(OQW=΄Kޝ^Gx.H' {GtLE'NgU 0Ǎ/:U ip,F%U{(+܈g5j>F]5M.̫Sh6eZY Y%o2zNkY#+.Otg}tR45GW{РEQHLS/%*MΌ݉,kp#aüL*/eK4>rެ~ +;';v;0\Oi Y`z)D%h<<*S,s\P*2Rkd4Y| 5ʵԡjHF̊~eU]t[mijt<\҇RCwؓCngO0ƣiCIBb%A*PB-u&o/>0 Zm[4ˈ#|Ԏ g-a.drVej?yo}Eɿx4n>v~Fw;G%ϫwtxXf,L~a݋<]1#4+F4A]KC ]rQE""5p\ R[*6}}l hy(]M`٥Zt\^7<{= 37?qӥi3|c5]&:8jtLxzűFh' FOw=U0Y:ZUUCTC@C]{^y?p$"<|,Ws{^Lzl@oL߾Y8ʗ- s$(stc/ ^|Wyn?_\4C''o-j?MF8(G/3ܘKlGU^qoQ䊶f5YU8y b&wH=]@ 1c1 ;h{/<QgQR3DF4kjF\:HtyAj/ꍙL; /q:-VI<Wi %"u̱ZXj.A')Ɗm\(;p6KY2)2MR:7m[*_POdIIצkp~nLq.f)5ڡ!%i 2HIG.Og jz &!>SXJ9a.#PPLuFE3Gd31LKzb85}qb_\!2C:#B@t2#Q{x8dDp/s\d] ABa屦uP ZE޵6_q14 Ra.?HZaKYk!F.$;aDzN[$[D [jsYHɮ ˕.1s86ok^|\X; ޓpt5=B+"JRNsI ;k=:n{SDTm/ dT7Ԋp&d8 hc!yߊ SV}z *qћ>e|mxݙQ4㘽Y@gc:aw;\'M{81|_KIaVhrtl8-^0}eGLt&ЯD͸L- )9H`Ts~nD}A*=KQke7cybC}/l#eEFvCe?ŒZ^S"޴jP@Q\i1Se_Pn/On8x`ʠC)E6` %sHE\Ju9 t%N)}:cXIg [W+UVnH+ww]1`0{g*2Qn=KHܣ W j?SƟ]ߖ(V/ EH_<2ǠkOaFߩmGh#™:D"mYsL&*)c.j=O4,뇘g5 r63ەUՙB#gpy48)B߂9LH(Hu$m'VlALSm%p9~5%_v9Jl%Tv#L"k8<;&6{BR Ʉ[DATh0acT2ڹ;sc߬J] MwP|K-I-zMw2!nYi蓏t@߫}B@[Ӹ䠸\Z*hOT[,yLzÖSIr%C %=hkOmf8gLR*ߦBq#omΝW > .nZ\߭W՟'ӂSEZ[ ^J, q`PLZIG'[EY w? ҁan.b%\jZ% = 1b?4eYn/[KA!sVEIX2;aǖWcAPXcه\3~GoIk@2o ]S&mt^[BUb!4鎝Dsل=LUEZ\>c۲X),K9{Xs=y7! ќ#jؒ,8 }f:d7%>lpDl`,)jC9 G*YwBgF1ٗ ](5al F*QMqV-Gh DaCI|_ Nxh@M]faE Ǖ:MJUnM~̶+XJ{PH0ݽgxQ+A~ˑ:S4l{pka ߰s Fc.Fv28-ev sEJ΁w/ Q((T^~.V (ʴÞ\ʗ%3RfkW0Ǜ%)su⺆fNѯq'lKY=pc]QO-a1;7'ё *ؾƜP07\{![hAWmue\g~޳! B jz!_:{ *ݰ T-Ynu-ThoZçHu7yԎmAǷv]9_՝<2*H>5 s Eta2D2vU쮏9wq^pyKlQYr^ħG^^Q峙+Lj$OYO'` W 櫩nOd(`xI&.2!c_{ 2&N.KG;O3<ʘ3Hxfה5jSGbG- [к! %G\=>L˿"E_:Օddəo `4 p;;xUr#Bh iGfSIݜkOy[̜ <3"ͩ.34ÀGv&g$a\`9 L کbqO Q) oZ.#kbfUGW?hWJZvoGgJA?Yh$&KAΦ$BS!_WO-Dяm){s_Cs@\1 I&CB02.[v ȼ&{0^c2 '8]cJ4Fj:@Hv+%kTxsTFˀ򏸷 N ]`WQ-zk9_95Eu;uN4 S@iBc^bbF)c"CBX\p~ )FʍB$+hHO(L;@ 9f1Oh<[.|E&Sޅ(eѭ 1,g+cn%g9$ydT͛/ND}?Clê3_=#*.ztVƲ1֘FSۨw˜t G @Wrq]# wJ}v_%zG̵bɃչJi@(wg;vHhj4j6 w;a6 >KI :~I]cTòzTGiZf_%Ǔ'\S jX Ym0!Ջ%oAW'@0˄.|}RőA֊4 lnI{5%#i(Ӎ;`r^L!h#;D=i!bHUJMBn8Tά"/[^~A/ph}N-" sqX<WkdD}DxZZ&C x|$oKMRHek ǣyim8Y#~gYܼQhE?߁+pfv\\dZ{n 0Hy))0]rx]@GAgem=4%O^"ʔb8 'PX';7ķX`+sst2c1PPkU0&ָ\5 O⽅f,MȄ6s{ BОVVeؾ+jW5[61OX`VYs: ǂ RL,s;0%eMJD}H-|s~u8|).W9Z&pqk,v<ץa5=Rg!Ztq!ѿ6ۜ穐  n ƻEbT Z0l##xTKL#gqHVv8?ye7X in*$n6^X OG?woٗ%ziJϸrcioourBdt:1vMTm셣jZ`k &P Jz$Bm{TcM}ݠ-h__ck ;:KPCE  M[K;*DŽ ?Mp 79v? IϰON er)&U eBvRKd_(] $SGˠ1`e0iܗ}(@fe=Yn--Y뗔*u3lh}QE*%t-i{t2^ؔ 1dұ$pb/?2GbQ)Rv%&cgA,O3tusz^5:+fT'yil/_<%H}V^\DE"?<[uR[Ʉ5hLDX ov cEڍCh~х;o ?jvJ%K{&lF4GIjl)K~Rð&fUʀM]Y/7x65nlmh:O<* 2莾@,?XC?fO"T+289ɏ(TWLd%kQ^̂R.u_% SqC\YpԬn^U L?vɷ%2R`&*:N+%KΚYY؇凉v8sY1{9T, ( }O ~e+igzMaǂ 6[I.牐yai."\VH,kMm*>('$68Zʏt5Z6p|,<;m>9H3хһNx=^.+ÎB@t5`u­KG$(0OK+鉁CVZBٱqm_ htz⤣^%y΀=oy`cȇn_~f?fmGtWØ)Z`0I> RIOzm٘cWr4$\${~F'G(뜔BSق ȣLd>-@[;֪@/\5 gXk=o+xcpoBi="]KU8k->Vk..(Mw h66ק:YDS(:Y|,hc,Z!bO}d/>2{2. K4w27EV3VX{H$ʨ #OFIֳ~F} 6x3$΂(F G4 S A܁ưVM]fYnQsZNH!WRzu˃Pn'}2?LRK,iDДr~nlA@-ǹ C3<0M,HMbJD".:1:gGtfXEd(==<ZFjPg}TE {t0mmsV>X3R$=o<6"VHz3#ҦG0iz٬%A&b}5f3xF c,k%uI: (h |_H \`׻pG .Fa+-S(MPd$aiR>4q 2c!hF? 8M# KPխhE5Ή4-5W(` 2eS4tWzQaf,Y߾9F}qcaodab Ia@_t l1FguARs4_:LNl^\$7iysHY*P5"޲^'0, !^HZWyOeqpÜ~oLR'K BIg;ݛ0=59mCN %o͇<ܵc;!%<XֶT26&/&>*Fw2 -(S.-/CH?@bmmO;=oޙ֩֫Aܑץsx_CKާ?zm*8%g=NYh-0PXǧ]6}E(Q JD?î8n{+ٗB9C)DIU_,ѐImcfXDse3jA5IXdw)b0> ~m|7:Do[{A~JsH%XfTy.R"I3>Ju ltЛhOG@ol }B^BnO\{ %U-T;:5sKi״W+q}ܱ:S$IC z^؅cT!C#UM}y 1贅HF9xSelfr2o'a"0,c ?"3rڇٟ2lexʤhw#C/N^gFyS8wjXcDl,G("$ϡgWc Q&GL]ޕfLgL_>^  fņ$ (38GG'g`xGa^{䬿I.BI.7U fEO#ZX.Kg|\z`A3]CM^$$S0~$*Of6hH1s@Z/ W^Px7XZ³W,Ɓq t6'F0_Asq da'h#@.$@L?+W _]j?Nwr˖TϗdnL+(Wg*rdHDIV,s)14ʸNjw1|Qo~d?В{Dԧ{|(շ'Y{a8_wmxNH@.AT W (m[ek S# x]N*4`_KH&Uq-T{'e |܇X l- s`f3lv ZYqV4PS " 8'u"a,a_ŲȒssaf۝:}JȨc.+qηm4U7ցB&,G!ԧ#N9~>p1HWA0\v]rǨA$63hm-!=jZ3-뺐ŀ,|H]xwʡ BoAycѩ^H(xTxm.exu+9dRBM/W/}? AG%b/l*&t2 >4Qԭg(bN[P,1Rzk$b'sU_ ,owS$CjC#AfAUA+ĴXK{7&3L8Uǯ|vT QN!Y06[N N;,# Hr >>tФ}k@ 4\fX(AP:*tt'`fOn*OUPV)4t{X$fI|qk2ARAs0ݩK9< Yqxsv0\ORVA~rV~l2@y@o=)12)ű~֘E %zr 2,&K-r >^agGa^ad*Z)X, ß0[k ?I/F ٍ"Uc Yj{Tl# )nAixjȭaC߫DH"( zÇXPĮ~Xg"K8=u\" F觮֮SrװorPq=RoQ5-/&80|~^5ŷȢW uBDR7\ Hq8]F]bڍy}Ϟc`4VXcI@[";iLF2 "^y"v~Vհ Z?VK4+(%rE^"AiJ'L=de @k7]Sl,yh`49JQ a mg#}u?IVo9g{mKk~j @^[LwxRPoQmW'#0:.nAt̋Y[@ܣkB&/7C)B2qEڣ oJCB )hUOJnY˘.{5⦊Qb!{0ODovTȅcqD! H䴿Cʎ4td~{ˍ5^ [q,a>G:m\e刹f7hSW68[䢈W Ƒh+%MxE)ƝG/ PcoAhN (U[/Q=\+ߺ|>-ƹ=C=m3 njV+J!YP [ klWm!^2@#wJj3+N:IMtw/y= 0|.JCX~BioFMge*Ki%Xi#-Pӥa7*@^ʊE&> $QT'D"R/.֚̿7*(fftj@$1~<7lyOWDx*;zҶ l2b=DLDQ ܜܪ ~dr:l%H/g Kage pRXneіO'v >iCÝo|惫đ{CU| j]lWHK=w!XKrwÜ SDKϫԛlEV -z2+s3o}3hQ)~A }טKE&J{G]}jCw!i4'D7̤Cx7H[' %RڀbőzAB@Bӛt-SP*rje6g)ϦRbk#dcR n恖Z ]&錖yF!0]m9w$Znͳ,S{oDLෲ'ڔ%H6^2g0.bL2|){l.5pTQ&CEHL\ݫەUUULL/9g40o06#:vMާr渟L?>۵ß8b`e\c꥖b78U ёDŅ-oda&^}>d<"veN )}|+.1a9We@n1vm(jI-w8A/d`Ok$Y|@i[`4 *z$! 5tرe@Q?AX;LaxK#mg&ۢeХ KDa.N]@2E!;c'Hs@ih#|hIhdԑ.Ѓ)o%7* <'.ѿ IPܝӓurq4Yo5/av:}x]t1 gvC wWUkTW !Nlݚ@~Gk P򐟊Vw~&A~{с VGuD@U^?Zpn\Yvk5dd=<HCpsMe{"b1_1GN6 ;4b0֒z.kYo0pvw`O>Bo݌~M9Q㺽_o(7@@~7(zG ۟pOֺ,>ӯY:|ϖ &O=fSSƠ{YrwaNF-K+&+׽vj!%@hےL%)I: ɂ;xD%q9iL-ӧc fCQxꈜ!"3)χW:M2Qp,4གྷ$wv[[ ҞB2@hͽ?-4$PLs“a4"KC8!MUU_!38N!I.Za<kOrf汈\DK7<}dZCI?'Qb}{L(<-3,-R&gXz\V*}g )c^:rVQզ6y$P .  { ĮuReZ%1tcD[\^|:;A\qy4o$ED.'1~YM+J"1ŐK%A~ L8bίWX4P*Yu=I\aXNh%[skۏCq֊vn?nLքr$;]Gx]RCz#+nRHO8fe t62Xxr˨!EgW5ko"^d )-Phf銆0̆P-)pAOOaaĖBF(5I ˟*Y;^⃼ BeA_+G%Ǯ+0X;l| a'QGJd=xoDǃO>k2ü;,Jm=!ɘ8f oBweA ŸB!72uNj!ԒF90 b(jow/ :? OA"T-M)rPcfguҡz!0**uMbA開w f*$klϥHT&)dF9ML628ւ[?FU!KFOX/ 8ot86pzUmR\vka0sW.t /ԩnУKQPFհ}1҄EAr X'Aeb2plڱ{XzL:yjeO='Wjlɠb׌TC|T~8G6F88wrBq*LLM_z3p&`t|QWnW%Tu#?e?cm*V#͓ewSCQPՠ± w$sũ_{Sc8:y 'R!e*Z*f #Ǔֺ HX r`# B“ 'Q졿϶Xq(Z!urϓvdw7Nn(",M|܋T־6ROx:U䏠m'(U?+א󜀲aU1 &#[.ፐ|i\mːM4~$L]J|ːzL!;*Y(% mlL Hl69$EڵՉDŽN:FgIٚ%v.Qךpe!$A`qѐi={f60 d2~U|^/Ck&[=C8`'[T71vm5ŵ DT ,3p\PvX.y6 3fNH-9gVZqM |D[CTYPFj0<1r/F0d߈[|5n6bA/kb^BX#- @fͪ:sԡ]fyH(Uy q9+=h- Kx͟U-219Ͷ-0w.l6uJx%A wUyEV<\{Ր^լ-I=55hiҵq:Cc24R 8CqdR&@:> +6@<wz;<5H!%?A1r,۝i4|dk!IlTTj =[vaq1`SΖV]Bg hρQa0:+ bK!9x܉;KS{2S+wv2 Hq5[).; >9oA*1U:ZN`m^kk_=U=P5k" b'/=t;SM} eQE1:^yι {Dےp[Ȩ%CrT>Co)O#!VbcM?gB\X~wY+' 'XF=YOtIR=wa} d&t̹wګ3ߋ͂ }+U)J%#]4̔lD;U-ˡRB!ύ֖qKڔgbjs=zVr,{+&.; W#yvw O:WE~4dM8 BKyy aT耰LOz,Ɉf]A lQYy_%60wEĬ/fg#5 9酪u ˜ &_=2 ±01ܔdu1q") {zgsLRl6Rjj^ЮX糳 chs!$8h2ngnMd v>cI|#t'U#:*KN[Lf`-0?0eԋrc٢3=` j"v@=u2ę4\JX֠}F%ց"܎Ox d5YçAH0fH:a{:`п`6S;.(zl_'>su=Kx%Yw/^3FG;^N ;֋WXf;BD n[ї(??j=X=vڇ0XafЫmĺixلZqhZ }fԳ*xaШ""*䄛n$d7Mai%Dl:Ȃ+U*8v_`d(5R=g1Il-qyhZN3a+V0RF!2,]2r3ňZ]GT@*WM=/92f@J{ r=tPtum8eٔ &wN҆giyr JO-PErEm9'6N)HЯ}^KɝdWz{m]=Q Q}`x]Njw<_qpH^ >uj&. 1GubQivh:{;.@Vr: ֶJ$`lV096yO ݁ &u-t t p !/=f&3ЈlL#QZayVFea%a!I>Wunf+e QB2Ų6C!v +3]&H@a'u{m8091jz@jvh6p `,tϐCn#7"te"c`D c1@@-\'?PC+_P բUX03c/)Օ:JFVx@†D9 G խQP}nI}1¹.<Ѥ׊$Sږ2`\==J(dfY٪))F Q73a M,pThC8Zj=nW$+% dݰ\{*R?/6"ZW :+u;ӰxTU=(\A6ײj?p!fҸ}qf[{IX۱0&<U'ޅ6?rf,N. yo<~'P 5h 0vINd@1M;cT rU`fqUE8b.bYR82(ֺ"Y' b O?>HH֏>9h{<_o_n0hf{$ChȽp=v$<躤LX nYT6: g!b"~ƤB YO<=ry Z9Wi2:̛ ԯ_TY㧾7 ^$ b^wŧTeǬ^fN^)ɞjhfmia1?-EEwB]Kz"GR$IiS.d"\a|H¶y_ Q?'eW9+=K[5-}>u@:Lm/ xyfN5ZG , :Nkj8nީD1>/SiKe+<);'};u:ňp f"`@1eUCVDқjT_6~Ѯ`Ħʙ'.@曪G:,E6)E/;L*ۀ\XW`j?m呱dȺ4ťj6pz6Z6E}DboiF\^8mjJ17QJOI!h8թ{ ΋;;BCB4 DQpB(xð9*3)$>/K}\*ʉϼp+6B ëeP^|tj k4g jIDq0FO4T,'܎O!2cb.(ڒ\N2M8՟@;*Ry^[\\gc$5:TsϺnxѡLY,%JBj]׃N{Vp\,S]>T|gi;T Z\"m(U`##QC'.Vr;sAҤ\K>t񝴦@xTj@Y*9ى{;KK-W+ <ܺlzh%h&f%_wǙn]dߴ~9w|ȯ}5+B@B XԺV|{D=;lϑ}ۉ\N#$ bk:**FcY~wm-~+v"h9'_&4I^zK^~cC{yPD?&IH bgP y҇Jyp p>whZ:"rnt?#, g Lڿ*R7Dm(RU#Z`zves8 i~i2yn}X qӾԎύ|U`y,޸SXj\?OrB$7a(rwmR.a<9B_BZ a=j9b%^;xs3 { N`7bnunPvu3^m&N`ĊDn-#fƚu- |6pn>w (ǀ7iBp{ %E}JI5ŊvH'G}v!߁`XDEbμ"^y_LEtnH05AF"f6/,Gäg8!/4c54D1B3qB`dxz17^J J"Lሮ*@A}H 8ǂc ӕ~]Mrf"s]w9y:9.ks FS_I^a\H[yՃz\F_YY_!_/Oд*|Uh^ڒ?gIq]; d-bh6sˉ1ЪA,k'-n \cfώEy%I]W|.;\?8yoE'n\J_P\w>sÜT"]oϴ}B30_S/[rPyMB~«5Sj[?: \s]C8S XW4=f&.~qprl8ꟊOs0Yk?Y'mBKz:`?-3(0,WS=x1ːEq­%wpj KL.m>Sem:U.hӭWQq3>OSܳ_]Nֱ~!nd9ZpCnp=Sݧ.X c}$W)kcbXjzYwm(=Q: ɑZw1Y )`򱴐;`%MO{l#e[c&8Y/،"oz;!𓸝},$L2G+ #SN\ְwG!.q mf Cx{mŢ]C3.l9)*k)Pϛ 7ъc_k߼J͕4 KT I"jG7'46VӬNR`݃JLq[Q`/|U>RҧY|ОZj"]}Uj֔@$m%2i #Ǻ6I ϑ.Ov\A^l0yĂҿ=9lrc)o.er ͧv^.2gB)[ͮɔ52˜^. [x?5 > ƢZ$aƓk@~i 'YH<iB Aکf Ǵ o6.kC-%]KO 6ā@V7)WͭŐzMe7b1.఍5my7 פTɎ-r?3t;,u*H0Zf\Eeb]<#&bƽ!Fqʦii5c=- 7?ElǪy/p )(X)AO .o`n^ߟ=|h@Y Q6_%t! s^%ѱB/h=,@lCX m`%R=>^vg[y Un- P_G*gpѡ ͰŐAYYyWk09LsAz#V fi#t9& W^^mg1V8o^7!ә؏CAX@GgEع^ƣUoc/*4yH?TOh*-b#W+}Qi9P,y&&.=׵?MwiD^t-lxj4j].,)K:{}!1*Xun-ɱ > ~GƐ}Xa!I`a[)=r-FB ^( yX(SRY Saj*0wh~8V@BP>p]p/#C:_·/8@nOͩ]mv+tv"#ng_^NO'x OOV'(Eaӹ``DT0!$-Z]4Dq~ Og; GkF;W gT=B>ɡ(` F=0 #&CWOh>죆6szVS9&A2oi%w#]Ɩ5ӿ05ӂډF <*d*>^KbRRP]r~;H/$Cl@5ꆸXLW;l@&t[2F!hupQY'̪qN{bh<| #OtJVbkg.o|H$Kڹ-J#D'zp]Κ #k'\b9HVhp| 8e4rCp8Xt}2!Wgzep m,m"vaEBjoblvDݼ)BSϯ)65.,CEj*f?v*CU՗msd`,q3)SCpsAI^'+{Hz2~*XYflW48]Fg?G|y®ZxE#4jVbs=y8ؕe2P+6!Sč<9O3=IVrC4C!@FeOs<&e}-(%%*(Vd %}Hۨ\sIS'wz'n4@{&nz*xICyr&簦>B,s. tR`L To+.%`U=RP==ke \2n;Hv^sΆM t?1TBͯ58-U"o'sy}s{UnEU X]f̩ղrz"wfS=VZڌ*sjJbƻ,$e- aF~bvM*,oTEod: _C$QYs 8 o{AۜQ┕+abUm?ѩA!ЅSFEY|.e_lH+E_%:Kbٌa"tB,QpFE~(i YYEϙ/ v:j\s>oO316@;'I ˾낯( &UK\R)ĹsUE>-Uk\e"XAa@XIΩK/|[?F:t,;m[B `,fqJ&:V-VTs<^X7 S}.ϊJ SRҶD2tb0?УBPi஘OCBO$RXi-}RRZڗEQZb_7+8S|UA74/Y P-q`i`$>rɱ>d=&uvDžiE0{?ϤP ^-`+aJ6f)o ./TCDФa:uķHOYW%*( ,)J ӂ̡!oqVfe&ʯcS]G}a>B&߿)尫72<׌DvUtۊ+3R;l`ToKDLw!ɴ{f-:U~=L^X w?~' !k|}2+Z6>I1FW̃+h>4-LJ?.Q/ym7C[pJ6*RInlaBbVG/fcʻ>3t3x} \ ֹ]yզL#;z' N0I6Nsݞ~E [i6l{W8ynx>[.tuDͺ-Ҟnc :A_? DVԃ4npsuӶaʾAZod])&xѾ1|Wo0r Ln*X3;ǔ9u䗳b7Hԍh蚓5ӇzZŃh9DJC &LcF0ce!/<4ٕ`Qdmr}.*լl7 avZF QR `IF#je#Y`uѸ*-^j﷔suO3bw=(N:(^VέOaVcfW<&S})Qx(IF } L{'UM*}pˠK UlzH}&\}g8g̃yN]^0So†!E~,IKäNv!YZw%>m`eW/񈼀|\kҼ)<҉%mTa_8&ǖZHh0j S|`,(yyntx;H/gO<][@ĒXRޠtx;zZj7hNSI-!a+΄!ռ{h ,'{ Nt/ YL"f)ݡ&̋-!4җIAq 'nXyYa&&;1$pl 9xA`FC_; X Kg;@%Dh2w)czJdnO*=&OkM'5t% )8I6ۧAbg(3ðab۹%n!~!3N8!F䬆 :!A/jBik53":f0ۏֈzUzѬiS W2 n/ƥTW:@I H~Q=yÆoi4 *Cy;ݟ7T٪@7C!]b17F-Y ۣ:%_"zmBტk_gȣ/\x@לEۂtwq/7>(fg2AXy޲*!SEǫ#۷6Wv/OΦІ'6+1܈;r;8Q.X E޶wi$v#wi84c &>1.Q.nj|.괛[nr5yggi 6IQcJ0duudg.U6Eسr#֎g@`WeW*J Te2Y'YPؚz.ІOX׭!y *%Ҏ@wݴ0s8+UjvT@3qF|׮*<T9aZZ*L)_.vq 6Z@#)LD ϴ7Pǧ q\f{pr$ \H:n۾ޟzI\3?!,֓gγ2WRWYR]ýx:H7+Fl81{/AIgvinP`q";^.'JBWqAijS5C>Bi%R|9lyү;vbd]J|:(:!rJp:Q\Qŕ!Nh!0Y^ ܃"~L?,ShC8CaRsf̓E^]- ́"+" ql C$)婦gu05RV#L78J'*J)Аq:7&k5cxb 0L_e_\ja 8~/,Xջ@%/V@h5 ֑Y5Va^kJD~d]UYIM?:吝ZڸXsbprk#(K﵍qt373Kpe{@`c% ȁEՌñOtL"?zMħXPF;üQ4I8V6ze_!K+xF]8RۢEumw:KJ#@~31ٳ`BoVzE]L-=ywXpٗ쬅:83xZ^G#̉.ϢQ_IZK6E2vԺnz{MnqN5{UCԪw΁:Y[=ʹ}LjYz# ~(1@$*l )5T, B3.H i+HM{8d=dPi}o65 #QFc_0e•ޠ,zRt2Hhm]?2?=Zuʉs=Ub`O[WI CkD勖9eG$Z;0mR-KYH㲹m;\)@yh:,b-@%| yF}TD'-ql旇gmv)ʞ )UWŏHmdSm~;|P^X  /:EXјhcdMm8V6Y)<$6t aHѲv i2h޸q|ROoL!aqs} +y1) ^6 dvׁһF이yJai8~:e&+N8(T lΝ/+h4Hajo&a3bP#W\'Ah^wT ϒD$DaL׉UR<^Zm(<.RM=Kֿ;֛8>qժZbǧ /!T(hI`y]s%H\dBs'nx0 q67wErvGaে'F; `@gd c_k ''wºz=wpذNЁ>׋>ʐ gG<ٕJSَC_>AԶ}'j}4[沒PR4PqƄ쵗]$ew(]bBMBP"8g [g0 6*qC,O *~~y]@]I=UNͤ;&1_~FTɒ!:P dծ`TYZ]?ܼ9=yxW7_SvubVn{ULnpD6*y#,(sޫ2FZdsN0Rt3j 4kKS 3Bh\{rBp/f`iy~\+})P)xqU_k*?gl!f.N;iw+EnLYٵO>H 8j꧋fJʕ{H st#\,@2;]_1 X5rN}WpwSpzh"c%xzpf3!Uhl ]y}i'j kPVuHEiqsRw2N!ȟ@-K#-w~ ۇ.,t̓n}Kd ?T)Y^l5Y&̅Z=_ArJq{`,./!HO_Ep[a8[)?P. -+ JxJ>ofGdܒjrC_La逃=>ipByZ(4 Oܫ.J΄DByy;m|st"O)ǪgF(j9ZT jMNj'Ō #~D sc2GUog bUi5F;\Mx-uF].TdNЖ#jz!PC!gХ}IN(>=tܳuh|cfv_TeRDv;4ڞl[?jxF_+<фNG$2_CW SgzM%ZڵT9Qt.!(R(|c3 g¹1s{LX,)|'&k@iөrB좽:FQe #gOXR1,dU[a0. btoy ;_e׈%ޑ!h7r⚶9`?ɒHu N; ͢2)`}05pp-<¼&GIqع W'nDy"m/3xvg 뛠-ҩxi5 #i{vu8A6IbH Q?$\#NDsZ@ >FqŗA$mgaz*gx~('g"]~L YzI4D)yv^Pv1К4O_b,!ofq%[OV&}"%&;C#ߊd0<_>I^/k {8E=tLMNOEbG "q )d׵A\l"WDXeIg*ֵ{u%۷M4%fT-ۃ7.&vyZ JKxr5W(-aVۓ۱o[|׀72\#9f}}J4ٳf*F|߫Д;QEpgTvw7{؜3 K 2TG=^bF ;Fz6H}_+аg2;7J*ǒRQͪGvixVL5 y?dZk) <>6v&rTTBm54-|Z:%T cU9՛Tj;`k臨!#ksi2KPc[T}T]|78udYhCJٵ\mϋ$vy"FGq@"$t܀e ԡYS h=ӜuYG= yC:A*V":]7'VI&Y)+ͼeRRQ* :G6VB^}eq`yDWMjN*-,~rU-6ZNz.PZ_AIwo] xDIՋ< M4~x ոB=Ȫ.YFԼPU|NH~e8%]n͒Պ!uBS!$Vouh,E1Q)5ʜQdhhT#ć VJIN`kz_@9WJIV_Tyky|4pcĔ ˆbp}a0גRdvDGϘ Yݫοb_ΒȮٰ1碌Q s0tyViH)j/o.kOXyç0lpġfv cV D!^6n߆0yAƨUQ+ )R2N'Obw:UI\&h֣=Zc`SUhfp4yr3ؙbTB0Z0biЎ5IHNݥAE_]綸"xmHP%ys*~5lyk͞nmͩMhfG2rϫI t(M]ƫT $+K{d3ѳ@ ¯[YKJ\wS*CKĘfZ|iWSwewP3E9Սq5Onؔb)ڸFHG{ A3iMM-oRov_wHK`9/6}I¨4ɲ7t5%7脡+a zV}JshPb2,W MM91!РAh_9 w{ , 'ťWPӀ>W[If&URn" ;&v@wm Ng{?\/O]@<-=Jf$%L-}!,sbU)Pl2E>A0 8N)>K8Dt.ZEbaA1DphNF5-UE%S\xٗ&.ɝwCf w= B<ONЁK+M FsECĐU^V]﯇,hXoR'^2;,)%JEcê^;kCbbbBl՝l|HCBJuhBėNÛ8{ gASLwJ|Jg.׉H2^ʽ/@`.u=\LС })p\9I&lwNT&iӕwΌZl] SL%ZY޷ l-yu;UDI q9d bgLq5)?msDth:ss7w|ч)=AIh]uzޅ䚲  >o$rzs[V łwG@Gr*АF)P2\K83].ѹ ߔkB lp+ITM\}aʪ-N;ZS%ku|O:n1~_c2]WՄw6 KJ=,f},]K[(97CR L8̽|GI.j[o=rwrUY(NaVwe1q ֛&:S8Ƕn(4,"V?f#2͢=IS‰(ċP2?oCWuBycK& RP}C %`y:lA/u@IW!!پq" >},a@̆k2ܭ9 a1jD [OvRQS0i֦uWvV\NYgAԺḗ k{J{oK]TTʀqgq#@Gz }vНHg Q<]+Z9gծ슃%A5>'`0S!ELT#3lTQ5],Ҁx*r%RzGVyG 399FTG3|~7s!~> MO_U3Ig¯[#E[K AFzMW4O"){50t <]MdZ8pC h0Z=9tJZ! 8N4b%]!QnXcqk̗E?f<sT *\|%濒i(4zļ:w # %#cm|Odᯃm^yS) WPW",@~}D)&Kz\>LxTR(`#m/㷷EmWFvp^űռ`5ax6seL߰[+Ϗ_/Z*(P7^)prCث1tk U\d^}w@o/q:KAr@/wJn5ZvM \J>HGLjSt-ű[,?+T{FI(M5756 t/"dH V,}aLGׂ>Jtl@ܯLk`HY^ɫXa q*Y~D`,\r5=h-Z-e~DXWA0hIصIX7g&@UA$߰A"^ 4xdڵYDf~v6aogό,=D16Z,.e,f&\~aaJ.{$"Sé9"eӶR2 I֙ך*NnvS'WF̉?P3%gc2v+hRA_xV|^?yq" SRXNKy *)شI`:5&S2qŞLF&A 3r;[X.h}DgIy.8^Jke3|#5q1q# Is'Y]^,rѼ|0n,q*%kDKn+2,HgYy`7t es/x=sk437oJ@Y2S㦼%QA@jDW@D:M~V@iA 7j+d͍xƍh_f!u:Z#9޶1ZyD^V ~OTE wƺ|XIs׵ jQ6Ɂ>Z]ru$](8_xQ'1M1q-mV^1zpwm5+jFwVȡbAX('jy&e,0P <!+w:C_75*Xۢ=ˑyT;f2Nv|G0&1"Oc0νaV;Y.puDhXuvվ# i7S,rI^޺THF_rܥ,+/6@B%vo ^vFPi<{*y$&CZ P?3fE*ӟR\&=@hch [w2>[EwB 5=߳ӫpm}+͇)f>8i*~-ՅLj鴬[O}̍d1!yA~|5lHt5dRpa[;N?5ph!&8b0Qg a9,RscGGpġ=J0} o6"0}'b {M $u~Υ|?R"{%H*#<}ْldiJRG:Pn7?v@:0>H\jPӾ?dɌ5~K 6]}Ʃ莇J /F?O+0P_pV>~HdL?6z+ꚃ#b9;JN,ih?=y|Wt ˥K\=TRq[c ̢J(K'~Ўou}aZ˴4;D5+[?d (?8hU\m,~̑x:MKLpaP힗t0oฃkz:=)h&ƪ z$gSI$VBit,^#ӘrxHt,%k~\=Dh)^-Yӎx`ɴd2]i_{&G2CT5zwprn](S"_qɻ-4Q-C*WZwr!xq-[mBRbvm:*[QPp=eBc&V@7 '0?a&%e'dXJq,`YfMc9gRPA.hJJ eH#G^c:ڑ49Sԏ_|_GXZQq+JXwZ)"L{3\k*ݰ4r&fht _I) J0^"sOߢ-&8m#*6ũK.Q5 r? 1@ JWv0\eĆ , \%xBdoNS@6fZ(=|1(\PGri}G ֶXBߖ /-w.Z,b<ή/?.m" B&\`kaQfΞHet*Jxg؆=R_Vvv}YBj5^6`wcla1bwX|bӯq{}ag^ b$"2_xsGUVTC|Vs1Gj0Ò A"XgpIt@ y!v誢StbMzLhnϦJSX\*ÌxBVY+ݥ Ů=n(ˮ˵*,cb37 u Tܠ>,2& iRna)|C#=]YsOݸz:*X_]QhTl{{ĺS2 ҿ3(U܈թ[?cXM-lb?Il1 }E_yAٞ@RH^rt1SiDCԣpWт|8%]:ߥ\a*L_}os6U8:z>GG9a6ZRՃ컯J"$+\k}̌=bx]<61;\@Tת#'owaqύuD$}F0g=lo21AI?I]6zGy?fGEy2Udn99n6S7Fm$G9nA߃s'uMW" [w .o@(fRmMPf͵@JۇG @#^2o~ )H74ŹvZQ=I^ ca@`-M Ӎmhg{QP2kxjE=I߶-鳛m :tR'ԛc=*-K/dpM@ڽxwQ6Ey#I~Kk #!,) J_Ŀ퍔IvlH&Qo 2}r1W!A -kBN4Q)lAވ%nO=$*477[b`$#~EdFH9\;Z.-8p>3R#?N1MZSppZȈ]Az Z%c#۠ [HEe|qp5=Ԑj[M,Pzc+Q A&@eJ0NZ|T` " 0HlLȋID&ӃQcƧ+,^Q2} )ˑU-vImqʜ( W j:pii)ia᧌oѬd` $Maވ̧gq\ؼ$UKIJͤW:/JڮR GK'5`l^"py%_cm؃K%6!ٟ[x3Jˉ fy\Hz+Y|!5$YBexty\e?0r+3Ul9U|dͬ^xxY"M9eֶ7cSq_<sމ#[t`]@Lxg7Q{5%nKރ=sC[MRI`U Oh$0U_:eÿ@ԧ3FwNQ%O+_ f^su0̀at:~ⲤX^[aZhO"笩$Ȍz&G=`Oi3Bq`EayS h&s~,"ߵSL'nc!Q9}GcsQs ;ժ[ VN'u%yJ, R([em@ԔrKEӌq#t-zw`T ágZjlax 1"{;xn4:`{EÁsH';}%$܌Ş6'?54vP&N_IyvczDϲg[gyW꧇0#-*rboc'hN6i#B*&ErDF䕘^s3o܇SW^ZT Bȵ?嶭>:y6Vۢ cyIY%hح!U (L;gg 1/̡aKH3c$hJ{A:  4EEv%!240{7L(r>/cO9ֱ,`>xJ`&J,eV  {@7ӼEJ +;0g1}Wm` +cEAAٵyofУu}}A~ Jq}{ .Lr35u$ȯOo-CҭNu2Y(;iDrK{9@|JY0VS,X>Ns$:tvK_@ D¦%H)pfyo nՅd=">6ܣ$lO?>ر9763veSՉݻ>y,w' jLvm'/+0,JnVox}@$vRt Há1#ơ$GhUQXb۳8G.LY_nJBkK-#W +w[oXDuGsIƒ D(٧f@w]QempmʟO;K5V*\2-QTŃ.}D"n.phf莉sԝ]Ab5X|D| B agi+H@9/#xG{q1E0.-i ~3 *M 'g0oW ߻Pl8zXߝi2vOQ.Q07ŵl'{CiP0kY{ET:ƴIϩROcW5ԋLaQ *ʽvdoC7`SFƤ0 )EbKNpy5Pn˂)m+ΞDj~T -M:#Sb{97ٝ40hyB/*8gjh y7LvVd)3ԩH?NjED_(p@P8kgw~j |` 3Fi+N>zvVJ2^B`R]}ap ඀=ڱdFݖ -#O+#O$HY1R* iF#ԘU&Rj@Kƙ?)M]C UaX{]`ȺzQVeAJyq–oVPɼ-m "Ȃ 1UN4$S3Gg XgoG;L$M|qHVŏQbs*CH@!ZVeZ[)auq rGW:M{>nGNNm$o(拞)UZdv%6_öQ-ɱ׶xԽdmWPW"4 0eS RJƧQ-_ޡm6Z4KMj Tt iji+ i=#'_ }CŢuG|gtT1ZB)I`[*O/{Ui{/uFeZzzoKU7Bz-wyCa\z.H6mU&_ &( , ^\/=xKGB"G7tK߲%JSɵbiq&S@LeC9ㆆC5udzp.Wq*?o30ryrB ?K=O+bݡpļH#E;wSǛ-uܣҶ_YJHQT6Pb ~*bZ^/=ڻ|JgsrdI 5RBy(8wJ O s5!/m4uz |jW5u[<Ԓ0u3 䬓/]lUm:J,?>VfHL92Qˍ%4r7˨lF Jے[/!h"wfU iPdl#Va]] o3?QNY< נwX2F՞s>N32-$d4<%jj3lwI %ڵt)c\00r̢YpQCy)16| =QNR-ϒIۜ컕'xvV(4$G4~_3tP '1[i2*Di+Ŕ20қ-^jxI8KCrp~ nx3!'Ûi^b#zKSBuϟը̨g*&g) ж6-iߋ һ*6YL{Kg;ּM=1{BBH0To*!%$ J 9D⥟; k䶫1`8L@o%_mc]߲`2%c sGP!zVG_3@JO;9^l /F$TzAoX دKhۨjO.x'iɆBPI-LH02ϣ4>viDrş]wW rln?ɦhQfט_:PrଖEҹ;FuPj/ߞjHCKsvddnorT%i\xF7X`\r]259up#J[?ϮLX:}ia~="5H-dgnn-ؒC/( jOBHU}H"^B1>a_B6i6Qoq_Q3ޅBXv+HwPGɰ7'筤[JMf%+BĽ_b~U1I% P;(P];C8 OޕS|=4JfQ }/g p7v:@Z,p $7nJds<# k6yGL)N@>e靝 1r AHb$ nIu)IaNJB}%cM;×@i2toЎn+I(SɛEC JNZzG.NKmX tz+'L*FnȗmP[2W8mAU[Q֫u&:ugs;X>-#vc }ud1b9zR6wGİOj|ɦDg;UYDS/p?zRj6CCm~nj!֚0<N5C"5kի/jh Zz\yұ1\/)O͐SVF[g堏.j 7Mr"fhPHeᢃS.vm$ZK^6l=Xh@D7xzgp3SF>k)3ߤߔ܆K@REyK|EHhКsױ'.‘ oq=[׸{qs̊~0eJa:1OR eXµU)QE!5[{ü IxыB_VDN`8N"{oMM0QkXgU0d"z_6h)}0?p*5!Ɇf$XĊ7T c.ԄHz' &t-H?ֈCQ ڥ_mq":酞ԡ 婪kcӓs~QI>!l$I_^N`ٯ(yt~S*C\r5TgRP, d1jW`Iu'(R +- Y$'Bn:?YF; >L+Nq3׍w_Wb4}!`;7QBŦk@r"!}w2J] *V(%|0sH]وOtSx`<nlA jj!t3Il,iM0f l(󀚈\nϚ%_8ؕ5r{s2+ _]QG[{$5Is~$:n҆+P6e3k?7zw$Z%Rˉ@4a^53uC%tLU Iav#\SXnm+ղPg o;Y"*ئZE4ls'u9^,! ۑ0vRSSUKc(_9F0\d5TZ//6[;jeoC;cUPڥ; wtcrugAOJtv u v}Jux*)<{>ک)W^֞0Ƞ᪯_gFQ|6!/vcp $ILY/K-[dnsxН*r wsXRtW?ʓ5u`~ljfU(=RP:^y@CdDncNgVrס3FQ_v!JԦ˼&L#kԳr\[mqV3BPAhM i1113 ݹ{Nk ZA$V"!q;:Ph-0a)Qi1HVCi2I7}tE}S\,ޠ{"=3As =|"Uq fݰ~16J#, M{aVz8H>EFR wdy;p4`D9XƱ4f%S *smr.*PhW/J] BW7aӘ׬, ?F$"kցNh8tIj^K>ƬG:Yw/3J53"a|*IݬU'~Eaߴ'.U~A4o\l|kPVgnGdžIay8xCɢ/w1Ķ R"C(ξlWCmǭ'̠R_t)x*fax~}kձP辤3-qJ 5AП5s+Y!C=|2@aNOCMCG Ǖ-#nEĻ{Q̾Go21ϑSXT"NMjkퟹMF2v{164__VZa-#Q)ИPg"|Q|a<C:>晁I̺C.V&ks`:m<׀ ;x7O{M^OdpGq;(ZEwR`5FSWN݋LAfuO6e|Ɏ> V2iZSdҵrwl"uHE P2БYpx$hk+^LL{'뢋]ۦE5a{wbi:׭VG%4! 1w+#geRaCe_Dnݏ&\] *5|:%"j =LF{I1N>CrdC#9L.v7kONCE|Mj!SC[ݛ跻d_kԒk/CPݘ]xH$y|[oS9/wHWs >4n F֥š/>0R|ԝ&# \2$ciE/+,9I$9'k8ҪۤSa7=դKu+?e&af!Xv<A0~Ud&>XF\vJ̣fkeƌXٴuSxvLTEr"-ݺO/'.Aɗ_1lm t:C$maMZtA :}奍kER֍$06 AFp(>:3/jgS+O'%v>lToDE"[_VPaK痦YW@xA_Xs)OӉG[sk-`"eѦW/ްf_=.hN}:;/TWM} ާL&6TYD awj[ު;ģ Mؽ^D՚4HF$mnӬ4ЫmaEQj^Yzܳ{"N?>ޗ$ ~9ߞ/ gi̝Ϸ(NH[r=pɛqt1B =>vp89JK{1CEK1g!b$gI2tf37NE|!"X#敫 {⁗DrLpi2SWȲ>Ģ6FJ>B h1=Tw'Bǖ;TEzR?[}ede ~>t.m׳RXyIGH} gYt4]!DC}꭪K㦲Wtr5M!}Æs+zܬss]gPiFȘJLJkS 7҉hЙ]E:E 7FE*j-)drPGFN3E| }j L͗=dU*a#…+M}.6TCpf)'bxD=gLVeW\D.ZkطVh¦Q'|wB# ,@x6g-4Z-oM eO` G$ƑDϿ q(EˉZ=<`6!wY[_G-biI$~ m 2ZD9ANlفT?1 ,1{6Na]G=byܫ"O| { g@4Df$ělm o^ Gںf&fg R٢c2T|4rS Z 9s=? PBj9b w$9Rg-ŒFߜB)4+rDC۔j'x&N6Kf,s#|>KL` HQ?SMM.n{(m؄:=x@m>sVeP+14'oxJ_1@ ߚ_ӗvpICt~xY8DgA yP*CtݿǤOn40 XBW;3Kز:M-4`J95)i}L߾^*t'M0OUU9׽-{eHlEQ u(fu_պ1Q]KB(:YMri\$W@$@ tEH20uSR 1-aLFf`@ިႮ0:=0%ȃMb3VpV Q+/yy\%Cn1L8)Vh:Rw|%Z-p87x”20ʡ'Vw%u7]0 thySWNSY@ sX9afuNR3ex%6Ťn_TF<뗖|:9 |U MiԪ/ϖduT:hdR&lj.j mq |aTN3a'scz,g VLZ4aἵ^>oV_SgT =#2D"B+ĆqBAQ9lg&N؉5荺{,H*,PI [VxToX_ASfH }n|-nRFYiژ"|R2dQQ.m5ö/氧ȯOG+i ]XRnͥn0)*&/8}A) B|^ ?Jdcy1V@ z`~;/#Lyzr}/D|LX)Ie m9 TrCraΜtIY?rU2Ǝȩf`êrz~)" b͍ -ۖ ak?(螺oYA ~œTTEbgښr\ C_(OPLOKRf&3'un,geMIG9 #5/*K O) šQM =r|s IMvskx3]x(?HAEǙ8%Wv{{*ijk?L^/^Q i׼-;\ۯʧi@OX%?aȆJt$k,ex hSG,[5pA6'W:8"{tua讑Ȏؖiǹ0Ny\P`Ŗ@*@1Yn19gfM 8J9ƒ;й~.K$Ӟ UҖB^i8:#QD3aSRYt!k-M@|įa}ys=8 E2pG{Ow.Cҡ/}:xG!;0VMbE3' -U}cKF={]hLgԻcyqr?*2.1ʖn˴F~. 5]dUg%_ZIuZW7/Reàa)qF[$8BC؆<썋]XCC{V6.1RD7m.]lKv}Fc\RA9%Rc ]9 b:g'j32wLuB^orӃk]UdՔ8'P RU=k0OԒ/JJ Q70pzS۪*р*< -E߇54S/kN;7ѣV4못μhQ3ۯ@l:vXq C'qGCi~\E*d >K6Ofgʝqζ+G(ED2a{*4Ԏ]cGw!:N_A!1*`[UXU}{mA.'~A C)Oѩ5#(`-@vXQL۟3r]ghd+# *kbWllV-Mب#Ʃ܌UKxآ`G1eG%#B|F3fڌ$2BGFt2!7PS{B]sK:Y.v5G](1h,#_IRTǐF"ٛR~%ZiF1)ZF~ =gɒpĶ%x D?FP*y3/!&c'a^֯RJm6IXۆh[:Bt0Ԅ4={h;xԔ_z ߑ5nI:n\AAk eC|l T꣣K;dU傮V*MuwR1 zh_&q ?mcFSȗepޒjVpDRFa >UB^ DTOYklL%}}?9tq|ZF|AIA'"Z, 5A[[)" sr6^}^aXBo뇗-Ky:zB5FeFh:Og4O$ţ180C|ꜜ#Pfwr{Ԙ3Y/` B6t d) LNd%P%`pW\1 ˾ϭ C`7.k({ًL4Jq=rXJecmljI`-u~s[cE]7Jo:}~,tJ${õ*.,gTiXԾ5awC@^:L O=4tdg9M?Һm{p,\j1<'LD">MiCud>˃_'fDi .L`eat+cȿtp ˬeÈPq7t4f@5ʅ O/[zsɱZpNu>ػBQ%%i|-$թhk#]Yn`E[?s ~t9~rĶO:Inr FJ k(Yl?: ^7 q ewaf(5%Ӱ$t*3+~f.8pr2cA檈(8#=Lt+fOua@=[V0rCU&QW*>Z#%LMW~vH@ Bj~mφp5TJ~StTZ3PeyԹAQ(Y/gv쁽O >"uV,f@CS_Oc͊/9 [. j-PE=tP1پ 8S{"˝b@i?EPwgÊ0'`vϯ- 75B)b[PO! \rzr޿Hnt ve03RV˒ۛʁ4 &qz )Ǻ%$#,3/-5O.]DSWY=e+]R.W6T]7F!ޕ5%%g5gd/ V< ^yu.: B~qQQ2 c9b 楻2#EpƑ&OQ]04jŚ0ןyo(Lu`@q7*ĺq AF|cϸ:?MR w)-pdMLuQ x=p4Kc}#|j&%{a,pD{K17 q3 #gn$;[Wb{y:~{jKOf,\!"2clؔe&JJNꢈu;AknռJ&?ةR+!W#\F^k dO7J." 94S= kE *wiXla'vˀF" I% 4fF)i׉y@0.ꂸ3l$bZ+yD# GN|E|]~0NiRd{2;^KW7yrDr`Cg PI襧w8lÅhP?JS'j_{d $=PHB*" ?5 Z@Ue"^PGf{= CQc9\10~_/ݓJ$G()EZːe"LI.=cH/*叩SavqG[؜n5u T_mPz#0Uq?{rH[(QQDZ?,2QLv<Ӏѫ3B_QLeo-v1Q ;}7ғZeU)ʭJlHoqR_9@,\ͨ[S0+| ]mdY8۽(e4-%j@6CPJFhJsU{J/>' )*;8o;%Ȍ U؎ bj1Bż2yiyo-[1d,xc!+MSlj'P\zb%&!\A [ u҉ʤ(fl;r7UZMBY}57ϜWnr% B^ H#E1j 2_zLMDq(k ;^_WLtdG`׀#ֶ{dwS`=B`)〖N|lBkl=bE/1XBYd_U@"dAntvgʪDZRD!Fxtm+LLDFe=XT?AtT=+h  XEC4>:?n"| R煎:(n] ٫ݰ;fb<#eRCG_p{R;F:W*!Yk+3v#w_msH3~|v-ʱK/0&X#4`@FEaDkC["\kz}I&k9FƽJʼno?^` EyuqNZNk I8jq+UlLuQebF~EY HŸk%n̲-2[In6H`rM"8Z0\j$,dÇݛ?\a!}{^mVmmqb=@yz-Ix# oBT<\›U%7u8r?:%@_dgD81yZ8-]d6M0@obzFCrP äJ/1Prd`\|ZyyFܕJìiz|o853}:Out XAočU\8d‹H\xej]ДOgDq. M=)qbJNbYt/Ghh!28KS%LY$jǟgɠ7c;%l|ό;; O|z>CNvҧnbavzjk‰ WtmoqM3tP~:~AT;U7|3Rs!a}|gU6#*qAģq>-u.律jJM̅to|k !Nď*,@4j'~ GBV掶M/|=#"ȧϤ &܂/)ě2 5!s+7D -΃YfGqH%s[r2+0DIBrZ-^ IR?^A׋]tZ(,u.ko>aE ?)B onK3/ E Kuw꣐BUu#Ljk4՝"M|Z/WILN ?*@{|k=ܹO$_LBY#Mce3jEן<[uFjO^i]d<0Hyj$#QTdT.O!&tZ BD&Iy!fG0]Ч%nY[N3pƒ{P}''-EOeOMػRnVN2}8O \Ko_V j3t쓉|<4z**HٗMA}?@5zܐmLm$fL4d嘥PJau1lOQʚd0;^:%'>"v^-;t^Y22@mأ=v6(Q)CZL]Em(kyK}5"|qX^WAI$baV 2÷zJ -(GɢaX>\/ y#p2n%؆|%CEq $9hq -v@k?88vSWbk\`'gV^w u7 GHR)Ib[֓Z; 9TF-l9.>Anۄ>H5(L\ נ۱5tЬbAAl2;&!pro.l EaD0.t훸r2,8ģLܥE1P4լ|{`@rcFqۼڂUKS6=j \ădrf"*E($E+NsD"<8ҵeo(>{*K g.<=5 6bp=Y*̔?)'el@Q-UG79ǫq}n :(LGLգ3K"z>TRݪ2+ES2tMhnfJqZڗr,4:킃r6H(U#>PV?V +6gIYB3: SCǮx+Rp/Wf&r2Q!aڮtfMQ5:7` },m~P/Uْ}a-*}N/w͒=2r[p# Fm+>X:ѫ+fXiWZe:g!Y)Hݔ,^(UߛoԍwS2O^ndW+)'TԸԗӂt{$.a` 0֙NVJhCN}`ՈX(;Aw~/.AnĜG G>RFOՄq(;+Y{20.hYfW@%63[ֺ1 `;](@`T&XF%2Ey;';0ClngSz(9ohVojHjfrw)vFK HLpT ,n}bPBPtrY֬aTrSa]xJ$; %e`q% U-+94hB51;75L s2e(y-jeG *% P\B[)/Fu@-Ʋݔp":,1r@}M3G%f^!. {^A|+O^j[ gV๠ |U/!)]i쾰 E<";NVJ1(ueE;oUzkp¨5X~3aI}1)b̀C TD-ZpJbJL<ʷhqǏeq\'$ҪezϸuQkVWtpݛ߶g?9"c_vtC)  8ەSP@ON$+M^رe)g+ +B\643sH9vlpR9-EgiJ EC%`6[TC@~˰ԼÄ.|8_ S7T?p^,b0+[=FD26݋(r_N~*w F~NO8Ҽ,*;@P" ;ܯr9uADs$f ƱQ#nz&C[Xւl>x˝ji`ߔ'=8ZfGzÃ] !)wjufv1S6~sxX,'1-Ieigl}wV;! %U*#qQ s l&398IæibZY5Sa^B`; Is7R fŴA4Jc2-fQ,ܓp/m1?8ax'&?Y'`k+6Yhgiیi)2"w8W\ g3QB)"]R5c(u(8'lUi9p} sa0h6ZNO8E^y#Hpv2*\A#w D \sRf0"vp!WĚ, zYQ.g("9țɳTx|8^vƔX1s]c5S\qaUJq5IPͿ'2TyʒRC- f ֔ -/0U)u.h0_f*}43~D/=c$SRBjhm(d\RyItgVl,aUۆCn/TN.TCfpZsC:6w%;jEDF3LBh猱l8n}x]wl̆ +G;Qs]j>ݹnD#fq.[O~bE`,>jRsjQSN,_Dz]/ixZ?)@.r=>na&I47Sbw3flweAbd+rYxG`,b@4M[Qi@tA(g'5-HK[Xj5ZP=z:s5"{qh;'Fw\iO}@%g< 3R;&`Fh=E)K5Z|!ȥM6)jMe7$V-ӭC?B;o*4}sÿ.+2A]QW>=)PxC f,aOb{*y#U$}7%rStdLJMP rNETp3tx_sAK)q XR]C&,a}JKȫԞ' CZϩo5neyA@ny ߍ#CG]&N vy;;jlr\q4]ڕyB{3$ҎaFQS4QxfVqǜUނZZW?ԘE16*{FRLt\4+Eja 5~}#*ɮO]K*Т ǀesC: [Çr)MOK$S5%GYKj%i+bC"&Fm/8Z͉BtEKb_d^I<JLX\zߙ>Rz%RC'tB~;=Xk]uJG6\ׄv1Y{ x U3׋@VD\8;3}O>@-)hݼ()'fDt=A?.Xw!B?z V/RbbpKf/[BYwK `& ;PR=G嶚|B'Z#Hڿx"L(7'8;bRj4 7S; Wm;EL9Mh$ SCg~v-6}%MB{hMIh_ΪrB{BOn$EkbvB$D7T h9Hjqc#A0ѷ8ېȖj%\D\ I ''؅1Ϛ}hZwWS4 cZl*e=-Z%QdoݻG8LclOL} .JoȥE>@ʿSWBF{%H%4B.n$ǯ"PaAb cUۙ3*Jm ߗkPLCqM6˂-8t״x0t .~܂E T '!|ZK/1o '~"xv}Lp )Dz#0P_eϋ&0Ouf7A{=yO68]u܋b􎲭NOWOwV=ro|!X&|c0J'F=ED͉ղ%U(湗6@"}!d2iS/T;H~yk@s 72&3fcXflB rUj{t?\^zE[9=0B=~tl`d}S{S]g7xgMwym W4k+njBJv5V ^`t HzcQg2DZ!G.'Yգ2P c^.CI̒>ۛ1,25(cg2e58(f6rq\ {5ր)R;}aR& |**A{z E@g㜾[2RĹyM`{{FXL֠ ]L(tH7 TB\4@W:PӁXo tjd$GPR!l;8A.XYY:a$b B`x(݁b)1w<y~O R=1PVNS1jXrqzdQdњ\QmHYn}?dh@{SZE%5{c7nd0!^9Nܰa:fs'JJ>!WH'o6C{}N.π6& vDbž o->dlTRxQټ+HTăUVIvKEFʧ@#˙ȧXQuhKO>4_D nN3]Jͱ&}[!t`"oqC{vdb;V[oI!FSsq@"|?g}}nI{ZZ4n^=\a!2h[y(xm')W].&SuV B9&S!(U~+ ὐf/NnM@Y"kV/U΄5Kf5!I@k! e?XVئFll{Mſ߱d*2t sE0|]9{`Ɂm|Ҝ=X#$vsDF/"ZhܥTq4bKQl0XKYIRVHj| ~DmC^iFGl`Tӈ`Xvbu.Cl?a6Vr>CnjK Ju4w`B"lٿ8*KM_' sUUxڤHj{ֲx{ݟ|$xAҘN?r!P R]+.3WEEMzN& h^^Y2)T?F ?jk51htKU LyFP/U 1ZO؟J55beK$m,1 4eQYs b"2=HnŁ{dY{ y5'6(;W]$-DIG{f#8*v=4A*Z^V%T6Ʋ~g}zvOo ܻc{a|qzoMAo9'F:1@ wK!R,b1*"B:`;l@df Xa &Ğ]?Sb!u!VнA. $02;3εZ%Nx Q1 p=Y9~}ZGaGs(|#[w!ȃϗ6{ XZ.M32+HS~VKqd!UG"+$ Unko@3tC|٢6tD wW}NC'I&NHƉ{]9W 䭽ҨXAu=A*McDWZ!99|"cKŜ06㞳2~ɄmwЍI] G4B)_Z1<-L /B<[YC:&{<a!TP?uUiH:*,r8c Z(ie|- -k8ї|CFd'Һ1Ұ.vGd4Wea7#rCgo1g\9_[+SX #)吋lHF(`#ZrcW,aS-nL5As9B<96=e>pOS(LC"C8ں$Uǎq +yuBPHqy&OE$ڠfB*8^a!9<3J>wAT{6FU^We)rAyP'"|U. ] zVhm3r" *mj媋 CF8#%C#}-2f,4 ر|wvtxb3MyG-s$C ")q|ً4;1jꟆ;j}.(\vޔJN[lr@;&ܸl;Jl߼:f'4ER U"tÌ$6OG/tDo~f/B/ČB_4;s[(oz(#L+Uj-ݘFHz197ڛI(>lYbrܩYg%p(Ff|.9T<IMy`JO N+1V<328P p{Nl0Ok=kf$/,B9 I2pvٴ{|["ҚZKk!ohpXP]ބНnŜ}-aBvztc վU'.iZ5Od1(LSuI;[>tv1?{Wc2#$2.xH.Lii[),91ԪZU^|2돢Ŷ*Gְ{W ʻbIZDP`"W@Ut}e N:>r:2ҧ+(/K+,p gS| nUM#o.?VV,dN_O)a &O#~'Վm5 w%4,@_J啭LmÓ9"$8 y(TY]pU;FE$85nQvT N`ytޫMV4dW rώ#EtZި}&Ŕ- 8Y%Dn8Tf/K8O7UCW*d ތ0QDi]٪Jd 󗺘sVS?QW0n5T{SU?-ʾ)>OŠ.{f_#9hxn#E t;MX^~XJsh&Q2i?lTG'ϫ\45ڠ:?xPIgRay_#>vy/txyߒDdW?ڏk2Rgۮ%IJ !o2Ɔ@*.sGH? z37Ĥߏ)P zl[f1Y/6͞;71}Iz]ڢJ8_Io@WbAxgIǼjd.Ao_3[' Lm+~*sub8reaȑ>yAK"mjj.Rtft }s@t:LN4^/踫TU^ /<>Mr'UCszwqK^;EO6LկrdǺ0*Qp髖=/~Ы-*~XQ=1жF2ɰŽapty]9p G]Ȇ8TM yX^E5Bn(sȭDZ7`m05P+!iB V>(&6&z»GÕ;㽥l*7L H-*^G:yMN+a>W-( ZK@$bq%=wat?[Vpo(vr% 탻/7TDRQ$4ꖛL@x=TIG"YIQn#@ MꆎG iJ!`aޥ9F#Nd< Ef$|XkşVESZ4dB;̚(;[)Mwn!h=VaN]hq:αzt0nOD:cL&엏Y8o 5L7/.4H[}¶}eVYNT Jĉ^|}uC[.`'3OJ>E_R B{+@_HW;Qh(7[W2XlYUJaR:߯xdÿr ?FF.tCB{C)БPd^qb5v䡜 P2?f?SG赘mb ~<ߧ= :8 IZQ/"7| qq폇; wKp]MKU=i2LBDsݏ<>xeNGnvlj[cYVQ݌JB'@rkx .eD#v;gv*T_!~&9] _q& Z4W2:Soov g龌ȴ0$v#20 ?r%ZOF+ msTIUP^GAVMUl MId-r5 jqG\ A gU |a H6.>Y]izOoU 0:\pЙؿ#;OE'mkl횤Nb᫄fi$7ԏӉyD"=ksApat3I+A[*9~I#{Eg;,izHVl yODy7R/'bMZ̀Yt.x ^ 4{aSpw*p"*Ss<iҋhU*n?k6%O;eyX%K/M*}7n <4_L"*ic <,A"Ϛ=5سRB!qEٻ+bd_)x9#}_!7wx'0WTؚٹa6Zd#ǐ:'=˗E& ]_ƑCg4=6x>6\ nN&ϱW&QSEWeJJ5[=^DD8bw zxvĖ8NBHFſl[]1ˇZo4F(-7u&4ȳdw~Tfނ`BdӠsh0 )^?*>ounhzeqUƶ/]Hi%õv֊xS48Q4353vڞȍZ2 {9I@/8m0ٝiGX1ԟ˜}Q[HqZP8 JѲaَrl`EPK32e2+C1q)M})\ (x_!j)_θP8QKVÙ_$1Ic9N"aU9E䠼#]hij(8jK^ΰެ?$P(7lћAshE&F?9ͥӴieK*ezM(A@…R wb$Mciq;v)Ǵݏ~ ^ zc& OaU6$h"e\ۜIt^e鎵20p@cSI,hFz3'VM'}x1SKjK e?i\(mfg |~dm|y;տNAXds"%5$}DfL`?)SdSĤ>n/bPyD vy4߇ة}8;lP+PT5X^--a27O"}_xqQ\~֒n*ƩL6s8Q;>"6 ?!B)az8hT@Y"$ fsBI4XPsƕ#8i LV`*4"Jz!}եpNW̻lT㕠u1>ahs&`s@Z e \A 3}gTE>=IiW7JP.TG-kH*/;6x-p57ծS,;x!=̰n@Tߏu)7T (ƀ `L%3@-EA]!jwOМ}buoˋ-%l|6>pwo1icߓ+]S"2*rhF쀷=.?ybP"r]߫E۷^:9eͯe?}*5HVA Io x> S.Gƞ:@8 |qTU^_+q 9댂k-8N$ogubY=O pJ]ŕ. < d͂Gƣ9~:ʊB h$2K(koInꔛ_KZ_ oNn%FSus[4=^M*nJ:Z…8{/?N.WN(.+[{.aEܷ3S҄NZs Q#?HBM/diϕRf9A׵R+\du2ŽϦ4w,zqeԦ2fjwd|֌HY @'b D.(WNPBPb(iCF@S#. 5"Pc^^,/je '2BKҮ׬f̀ʀj(D^Xbxy5 b'jM%j/_eVF*)W4㣏VO 3R^:ON\pO̰i؏R3ѰGUF_\ Rq$4G׳85|.jDbB?V`I3d ^ωZ)\d[AQym3Y[3ˮoz?:n y}27BTtpZZOJY?> %]``)G=l%x袱~b0JSkf'T\Ѓ嚝@ oBĄ%,FOCMZλ#7 3u³r Cu$f:Tu14O~-qՓ9#HZdQN4 '2"vMqTbj%v?Q#_LEv'VԱ⠷6k,:KZLpm|,\`rsH[勗d)b6)6ӆJ8j:{O$oPF  $) .JDds 3^C@ G8Pk5'!9kOM=4-"%l}㩼CzJ8y{2 Jo sp׹|]buS&#`겦gm䦮 iG)ըwy"*^}# 4)xX0}:Ο|ɓ:e\lDX\;0 |I:S O6YeԞ.?!o&o+BĆ@M\$0$m;ݖ +[Qz8˓x_hvTFT7޲ή@.]u}:]$a}xƷQ0߇">훵;*pLF Y>Y,81lOЈϫpJš|ԣn/z0A='ϘtU E?;׭mlw#q lߒGsBȥhܱeU yIԧiK9O>I.jv>y]vn|A{ۅ˻S@X x^\/SЄa"AX.k[_g@y7?/eIS d`Z-fְ#53?>Prs'CuQTPa<w3a jO#Bt7iǺay 3΃B݃V!A,B nB:)F08.Zfo#7b)Lq@]E^BJZg{]ݩe?Wa?k"+fĂ8 z?jbYuMA펢-nhO& mj|?kߊ4:GJ5c0c%$'PƂ[`~StS٪V3*pLw}( E)_3֚XtO ` |+MQ/Dz$U2Yx -ܢjNqT2 V!|KleUdwx?rj'&H}H|HKFz`S_b,OMkmc'A(:΂]PO^t5v + f5=^6ڄDSv~dNtUyIS,H4;#_ΟbH(jzubH3M3i)Qid6m)n-RoڼRɡ< K.A E B-}[H\x{&gf=KڷO<4ÂEgYQPmמBy$™d7ԩv` 5o!T[>!55*T!*dNu$12sѲwQ$KZI 8^rWT,Hz?H.M|hPMt7AE09tyiDZG$8 5/ywdVלqVW]1KVbI0n7NJ_ӗa^bB==K>nDe=ɏv? hp t&DHCˁ 1[-dJřYB;]R8?Pz̳rTbj^Ds(-9H)%T;lv͖a_HC}46}{X6γT<-hBW"7%"j ԍOb"Y,:=~/\/@bl| `GRL$ssv"qB/ڏey'0r[3ʀ ׺A4m1ÿG i}ym`K# S͕p@m3O'`h%qݥ, oƅ]r*1&v`ohtL23s{kW.ѶBryhyrh~{QYҋ}x8YO}x+Z8S+ߢ[h+IARʲw'qhS7M^j k$^+Cydb,~^Ulmíaڿ c |ʈ}`:4e'?Ty]xS!j7 sl^Vw+0"o5ZUErʡ#5RU~K4PxLCΑ^b@|m"U>ڽ`[R0YqC,46+Zp$흱Rz` 1lbK"p^lڂmTaV5H͔T;4*4!e}2]!sG*fuћd&J ~e/G⹍-]b[4*m)E.%9+tV d3-_.>٪Z4@>@jĿ.=0@)6ĝ DALf M$5Ӵ/BT_8|}Gp^FQ;'Ō]YgL居<7 bp&umε\j?q32܎I>zts P{l20E8Mn+~Q4) i{~y/LDu"(Z~ZB&/\&hfn R͈*%] O+u(-3w8)(.UHG;>%=ӓ!']/>;9XV>}CF j??`ȫ9$d!a&ؼi[ S"I_C@M"#O&-Eikd©q-{;c[6$ҭkșod!io/zpS/ʹ& 剞yֈY]\"nqߔNY7rǰ}]Vo&Vܤ0{]GΧԣt D9r&>s(%xNRDwgIfĩS Vf_{i\^UL"#G+V lX}p<$!\GD6TZM7f r|,:U(`k),|eW_agYSv(&lqsg0kŜӡ[:1c ӭ?t584xWL?ߨ^8P$-]Oiw ;鉢޺*,e#Z S3rviJa,)6r9 FWpڕ#ʜǪ=d2fcܴW|=Dky˞fE55 ޗH4uE9-[U#p^M򲄏VP  c#*2*4 yqXN$YSG6" D=i3^:\.^rXT6獞lݯHY/͗G؇{}YJ;WȺ>(_P@kK 8g{w Zv34Ow J'Q}TK̘0Y?q%<M,upv2md&>]6|[WRWR:oD+O,>(?Ww)"_:"6/-H>6Mu"/|\Bj WN BwJwJTk;mV`ˉ JEv&H ʾ9)# 1'}=U]q 쭩4G.:3fX$ ȱhܜRvI&Gc(s7B\!/_?:jd[l46hy/V=GUU/.>~&j?mԾx`|y_7?͉')ݞzq(u0bŪBȐ vkGiw0e H4M';c9B89ļlJhZ,4q~΄Ί ~J=mUFI7큩^qe?9dI؛[3~]&v,&rQ+S0onCY%ʡQT5l$L,Dm㺿~/N'$XR:]*&V*<\Jʢb^\AIH l6O|)3pB,:զusIPWO}5St VXp) NI'sۭa O'@]{i&6j olh)C~ ^nJ 9ug{nn0uD]nY8+D#iHwUҢݾـ|#N8wCDtׯz (c{ J^TmM?B$s7 E$ZFķ[7qSNT|P 4^Hx뼌i/p&L\b`TERIw)F& r39_W ڹp1`oC׬#:eB}`iR=0MZ[/jQO^lkqM.a:0@lV04 s?hH0GJܿ 7i[4T!gNNֽYCMB|21B1O#|Y%u2Ϙ4Q}ڏ zXdU}i$(@0;$+55-Ϳa)j2{\\znTh<~@z,k\w_%q]d`#UsFi,KFQf+כDFas,ۄMTw_ >}XWϧ7X DcDzJV1N{ S|z%n TG,FN_R!@~:r8 | 䠄EԼr:uO;N`<;hȟ幜tG p7~w/s(ƾ=+t0hdJiiuX] Ӧ$k0DAyw w8* Jmv L9f@Q~k9NT>jo>BZޙNCgNEft)e6yU|hjx`-Edž3 7GaO`OȭLofsjQ=hx$cbg|CiϹpÆ׍{ mGOsWՌ.q}ŐtX2߾$K GpԾp~kF{2m!bjIzU`A#,8bs҈-amCl4(}G(P[56q3G:Ԧ!SV jY${p$2\W6^$<}3HR剙{7WZt%gB6Pű8ݯxS* [.mA7 ~JSѥu6L-=[=i^qcXO=L1ͲCƊY,˽po;Gh&1+B ?'p/Qʐ5Yn[䢢25ppB\ ڳ Y] O NwJYgAP;`T?KL82h`7zPM?%jbU>$W  :!s NnS}ҍSu'O43KE%nCرQ.1Prb01\⏣>IL ؕG@؂Jl<߇Z/V vz@; =y 3arj,7Uis0:)ϵYfx,-ߔ Ѧ!A-LI!ܨk3@OTC(gi-HiϤNqe/lTzZAt_5$;aMe}ð+Sat~m-Œ3Oy9E.ac-&(FITƬ`0 (X[VH5j5Qћ%?|!G˴VԆY|C uJv~ 3TA++'U}=}]92H5f0Wn]vV""/(f+p7v&=]QdV8ύ ~͠hw#:J,1; W!%v:1%.O׿9KfE>NMYaQg&Jzj?1fR~bS/Iӳ R<|}~S+.}CHEYh71uv1k#~ζ3xO>XnAPcU{ֈ0ΨFKVT\j HYx{Ih3ƂFDo3Zx2ɝKI#mlEN 7n0ڰfB- [}r+^;x{T\͓all[bx Ե.RX^LL1|jǡC͸%K&P?HETdOh"aAgE7mYkUwEyP]Y\zJ"<"Wwxn8Hɦ 0*xi P * nMo)E=ɯg#ΡW}۷`~ j(57UNƋy9$Nap.ICx7$Bk 7Lk_Am.#1Ec*j.eG;Eu4"p{ :4@|s3 S޻2O%J$"qo XmS/QJ7g30ޖJ^,] KNG-jF@bM~g!mnXNWζr !K<ʪ( {$nb#pKPè̇+k2Yr`0r2!@"ϰ&1؋! s٭?ŨsKqI{)LI oۍr"]ȩrqoj,#/K,ƚ(uNctޏ|S|v L3[Eu0GA\7h] O&tz0Z=m wUgp?!FA UőG.(DĠ cYe7Sg8IjQfy7+@Z "L_V?) )Zhh l9yH>f(2xZWcv&m/ ^B*йҙ$jԗY_&pm@ ovc|EA?WWuRf؉}3l)Budd^ }t6T &I_Ī2D2|)>wp1ޟ #G^(fv_*N!>T0i%DބTÁ[j/#yHHBᏭS*7?G$ Md2T BW#a\Y Ku!0< ExP{| [X9 P.8w$OrΕCExʭ#h"62#_;#eV>Mk-ٯvTS:wOz^8LR>K~MdD] Ą8#M@|7<gBo7> ͦ[} :zL)RRXG$˝"̽ݾt@xqc W1TٯNyc@e֞HBsؓ,Pp!NN߀>s%Ϝ1..I*`B6(1L R0#Gup<%K%IO'V2U2|1bw+8 kPl `$uVݠ(gE9d9elji]oǮ9K ^_NES(0X}+Us 'iM"ؖEQ$Ҹѯ+-S2Mо2k#Le(Ir.GƨE7Ed#2?A;zL.(bƍG;վU8:u׆Q` #FF$3+hPg׀V7L8$B۬[<,6EՑlPM_Drn+mT?Dm{~{0 |<'dV0e 16G0aMLXGg-SꏷEj DE1ts "{| P$o<0ざ9C<8eS0CW'z3A亾bRC<S`)aZҏLx[9,sZ 7[-߿,U_,iވv2X7LŘ^(hT\ң dQGYMܔ taԪ!ڎF؟? _ܪ4drgUz1G\[Cc2C4Jyؒ\ZSXr=)'`ZɃAhPbt1$‹L`Krt?!-L[4 { pl[hhU3H" ߚY8.h9#4xMФ* ^y}RޝBwJ||yhho`IH2zyv YOt.2"l!4F1׷C/l#ti~tB=FG0c=F2Q&/%^lRLg Z݊vkbWOlBwb܎ ~{3| Ynh?Ҍ8H3+T%njr5J۸`]a߆Vt`QpRs, D:3?|tݺOwjEln <Rsx[V8M@6a>W+2<L=`4%dZQs]PNt}Lb0t6HVFyo5# Qh\ܷ/Dra7/{ܾe-1A#9P%7̅# PӤ3ozP?+ܷVs.8U@J^U5vW;myF|L*.P,hI4 ѭ+e;`&F:Ȧ/mW2#plZr\=aTN#ԪI@f[+O$%4q[TsNATzᒭͦTagyV}&W_#Rpi3gqp*lɥF TϷ$ʏW]П`Kr/F ]J9-lV*(nDvTSZ[cT`m~3tKL+"6 ñw&q ^[t:֑S"U/ûKc`hQi |X_k;͡R ۳3c W4Yܺ*aD',CF]-]&q F!dJ+?} "6&i42O>~Ch`;^87g2~vtTnmDxij"Ψ/da1''Adőgk8GoMƄW#Sћ]ʡFr38dy@$?ԙVzOTLNag -:r>^w<_ꄷCL3W |ZDvі sQ} C@D;A*&j0>NUkKnr;"C }*k*pi5액a0<+.0sdt8%ɶaCʕ(&#4MKfG7*e mEh1]L]Xe~ RΫi#0ntr=7Xx#N:/0g&bxD*8Bq3 Ygr ||1.;Pz1FGݵUF_ypCvhMUX+t۾sCb %):sg b'&]!`OA6|Z8dzvX`xB^agѳ{HŰy^6,+wha1mJPJNE*3kp9ΣM_ЈO$15R!/tsOJ#5ʠ׺i"gdx o{쾈]' 5d[Fm~}<8Q-Ǣh{{_vKpPhqv2 pQu*_HĀiPKx1~+bݲm߈5WL^Ol)кH@=)e?I+o#)'y9|4w8B]vR\QuO_oYk DW]+lFdp=~7;?'R) ^c.=ڇhrRMގ.d/ZAkͷd;T`٨^􍶙,iU#}?ߙYF×ȝEj{*_W (+ 醧#-;z8Ӆ7szwYGIq8E]/_J73Q>R0cMPgzVί(f'6+)0zq dҍ5qHB3g *83{4r=r'/q+t{;>oėzJFKrz2$>-ME+kЖwʄ,@Tasũu+S SZ%VOziٰS SkEMm&r>1/Y#(젤SZx]NTKg'vRd(āFW$Om4. z3&;t|GT8 n )DS:6I ]ﻭMٷm>yδLJ0:ntf!?o?gĴ$o66iO>H[$v./=si9X  $΋R\q\ 0sV1WUDuLbК^,2%a=~GT9Sg԰; Tqۙq,'f},S~kuQk+ $'$EbfZLʦ@lMQM*[[PbeKA0Z79NQ(|! NRٸobAlW dQχb*JYt[iw+Gn~Z T̴_Dau'[-R^zoJoK)W&IT ‚ߘn:`̴;Fd#2wY] 3{ ,S%GacuSt,|?J*QHzζUx+;F3?^3 K<(R‡1 ?FҘ&gODpמk 5RUkGo'L$DzBgn%KQhhNJN$Yݹ-X?v'zD)T[<8[wR_ -nxBkH=i}ǘ,\a-+ҠxΩ8Hu^؛ئ!D_ׂ=Z|" V̩N3%"XOr -6!*5HDMd*up|=[$4N53eFSxI^=|m> dRg.Şӳ=ޣn~XsLh9]@ %q+ӊ_G"۝D@SKkF ;ihIΝ˒5"jD`?s6 ;:-xn^ `=um3V?DW=wb ۷?:" :@ؿL "PAL&z*0X̂uVqr~!?{3B[5wA^ܻr\1Й=L- )OXV,5s8S҃vv-?> \S!*dՑ5eR=Yq@RRcūo֮Z4ƭĦ;yZ6;EG>wƒ6Dۅ5/Gp8,ARYyJ$@_fV<5^p&+6(8 Pߡ1/V AW]IxMUdh"ϥ9Lw)zF-5\iM M.۹oFuj ̑톯ff% ,vCӮ]diPw 8O3yc џ$QigۺKR1㔒|.~@y@$d̕Ti3]&Hij$dby202ihvS}1^h*!\i ^xN~L@!ȃy`KVi~)tq/>|nOqϼF 8{̋Z.5Ã&/hu,9S}D`;!m]m<=*\CǏ w >0A>jA+3A~䗳vNB! 9qk!͡9&1C}l^^lc;]] SIfr|/gӿ|#i)ѡ0H%|e,4-sCNEb)L'B⽮(<6}f,+wm9q£$WULOJWIc~ w;{=gxVf8:)!o28#rY7-[ddwH<3 ]U˶$Rf ݟAf|# ]92^ΫT6hý0YieghPM|f KE|ٽ 51 ©qxԵr-/Y{HgJ)C뷀%Z3z\8xGʝ=4D qHibt48ð.'w`9o.5J#픰Uܺ" (́(,±!9qڒr._惆cjG4btjhIR$Lq^M ^ůjac}? ;?1?h~LG\}vvC(_b l"ֆ}U,'֥O:g :1zf! ,\L3e4-t~(zt4p? .0^LnvI1R| )< okxOfNEυY ܠ}wvK4Rv`1#,T\&,G%s VS;+ 0SDDC9#s'c?ЅE_/@\9E޽~a҄4c8w:}?j!zO *^rOW:}Mnc.W~ᰖM0bmHieXlmڧ[;X-Ӊ|4%x ƾ,NN!l#~ͳܻ[&N \A|2I3vjT'~g th͵M. P ,ɕxWzn Bk̳S%3& FebǸsZP~(=NRsCtwňK׷.fn&|=X1mu|͓淾Dw3 <Bū@.{[7*|b?Oerﶟx#KjHH#J@SE#7 h0L؝ Ƒ-^εHTtt_D^B2ʠwDo.>mNp+R7d2:kk 4$g{uK%θS_/fw.}@NܖP{l#`</QSD;=FU_^}'Zg’m2זO+ x(J4މd2GK Bg=F9:e+Z*F;LPH})̉ F =֌ )HplyԨD a»<69TjhK1VB$5ڠ\ %2XZh>g?dbvEȾ(cYξwWcȣtoxJ=:M|m#t2M962%B0~n|.eir|@T7#qE%B ˌpk An;NaC#|m*˖̻Ȩcn69v\rq\ä>vi|?im[!jCp\N|0K2C] e'dxXY!{BjZl)M+fASˮOvۉmh.5݅& Zk:*+lmFDK]YN6`e*OC5Kl>կ/v˪Nԇo~h SJ̺yd.˷'5mbHdqlu5Ȃ*s0ɘU++8 靡5`mt^YLˈg̖m,BYp|] uoU{Jwv(yU>E<P[> wH6,@n،jjQz mVTe7'.>`q4`;wbnox`jDj+f"-/}mq$ߝ]2nMWCvVozcWNYr-'jD|]! $S)b$H;Ww3\&VsRE>k):KC=_Z:eLh{K̲x KT+ xи4[Z2 &x; O8H% cW ݁6ٽJ{QnH?GFnPrO9g3+zɵ+qȯZ2 qm]x TAI@sZ26Q؉=m_cn$ F:[:tz:!9q94!VTk ʱz/#^u4"`dÚPP#);/iƵLsT=>eP; (7~3ƤuƤx}+/K-QUD|.rR7H6> l{ ?x-V%!1Ӛ(DZ =KRV@ #]E{MXO\wF+o^9=WLaغ 1hpPgq-'c-XL" LdsFaXt!Cpm=JQWү=YHn5g1|s">mƕN@/vS\6aM6}c5`&X y;N-w;(|𔲈2nBFPi(q83pǿ㠿K fGk" J_R<"ū=cumS嚨A@lA7uÆ>iEu2/X}X ?bG7 *] w3}YBd]JNUh@k̗k?`L_j?iDA/}X ׏i&$V ZJ"uc/y^|oR"DQ` ) .u~\O'gvM>lKy+fzzu |OٍRG vebk zx#H!\ zۧ{x9DUʷ| UgVVӻ)1H9XA|I˳-F mL8SMEƃn`*kμm EOU*g/[p17/x)3!pUiE,z gor0!*=!O1=W_?xxBWe.O4ݖ%8SVd]~IPH iL>/z8"҆@K΁y,b儖߲!;}TdqutDYQ%z'=F>mKtwdv*R+7Ex+e+xP+YQ\ یIrryE 6&vD^07X#| [fKgkr`)D_:\=9[Xzl8oRJ1粹j[m ow`l4J`ZWl>;Pu˜h`9̝k8EecqT1K0J>IbySTmZ lkՂPX؂aUi/md oэƶX7c/ q.ZN9 eU?IxGKP(3CE>A)`NFqPHYF 63_20HC8T;  t?o[qjJdOwg #mCd~wy,(9-X'y21%D }g)=T~PPKl,)VE4UOk yþ׍R:2t(.qUT^ π?}q|EP4WM"%:m=e/'h[`=NE񭣌K$~]xu MMbBEmV@hul| `#NP‡Y 4)wn0\yIlZڪi^n)¡QnjlƜk_};@'䦡VJI>nHdlm~=f6ۘGϾ-W'dkqŜA7~軯7x6B;IG3 ({%Ln /]Ts]Bx *ncnATR`A^X 1/I-tSq b6 xp4d' dA): UzZ~2ר=oN>vD3ŕe  vh^HUS:m`$N:b2ډ/N tk2a]A+T3yY |%e=e8,;)Ԓ[h95MCaqxY&pStBCȃڔ%I߽0vIϱa G>77s8b #&/f{a="3@'$>s;A­7ަ!UQρYda?g.}N<})ׇ(p >*&"WձL҈~ƴ8}r:Yx/O l<Ų:с3P$#eAHඦ1]@O+✰A ^Xb%F MO9e$؛~#8ڈWg}㒈uhl5&W_)h9M1y{;ԝqmuuJp{ty 6΁v{N4oW|`ќTOA.BF)!2t[f@)||N" ʞ1X{yz2TېsIprL^AW.,TcTFq!bJhg KFaru͕/?KY ҔC4*(LUeitM*:r}7"0BXKjA= [oPhFx}k((6SP|h~a8gcodhZ>:TXP9,J IFU3GcC0KcsHȷ|9-P 2 4Fν았fCypr^I9\[F]vHŢW_YeB>@P$\[/AQ2nLfr/"l輜DجߢBʲ; )B/; ,Vx<|h>RL41B+zCϷ?Ux] 'Ȱ/#og )ط}l(4o#0=WeT#X'l XBٔ\F獮2X8yNWtYلZ#s;E/>GnmAޖK=h>-K-^-k.߬YDR?{F*"ܮ-jS/VnQ9i8jGEGPtm:]|+%$A$5q_#E^;,]Y>M 0z*ԉPq{&^Abn_s3bޓkR5, <ϲX=I5*L''w(r_ 1àsi 0P'joߖ% ͲH|DP<}dMN{]Z}f`qwO4)\फ*p]0qco߄*u~ Q`F$[ kI-'ЎA=G|DkI W$ J CqR_-bJ,D]YqOws{=ж )>_Rt3`F|#%l>T#(w$tm_!I ?8Nsc;mɱ |` t&H%ΚxU -Q^W%Jjmho^3z=񷟖K.<$_Rt0hl.{T#;@CG-@`8ܞ9"yܪMK{BR͕Ԍ,S9fJN^vOX. >?2b,JeIٔ: EX "_0ɱDy=Q&ﯢ6)r~fu+ ?h#oP&STM.pI-F!gdjl9sW^{|k|< }m^vXZKju*Hx:y'%8 cr)䬐wc4N981ST1ȚY[0Ku6pY!]joNI(Z{D_|"٭#R Rl#Ws$yA@& z(-D/crJ"xҭTџt|?Tnej>GׯT%3E#|;ߥ{uc+ {.,Z|5䫨BdJpJ_u%jq9y FoM-X!Z w9X#3gR)y[|oO4{V,˅Ƶ܈D#?^.X0@~u]gZ4du'ɇu\¦b*z|^5dW!Ukc}[An]p9 qr2/Aș qr @WiH\FMp4e '=W_796/Dowb.E01.쭖%Ggf*ɝYhlFW ބ Q<$,7e#7[$߅T X7m=7% :V$l,SO6YuE `Fbdg#7>QO/iUWG+:瘪P.T8fGA .3{kj³V7 Ab R|Ԑ[r D -xlLX֒zt#T8|Q0O=g 4%7K:8q`18ZޡN&m,i eu^n}sz2jkp"&DUD#a'蚎{`s Sy0NAgx$P- /«S 8&.bcL_XUb[[1C wO2 %cVH3ڋ s(}Cddl&NN8=mt;g$ተՁm9YWJpcqܬo]O Ƌ|l CcG)dx0-gr7#M#`PnFJbtXF=0!m ѝl2L4f)-O.)5PիlQ 6ـ#579& &3oOqUO6N vx#nͬѫl#Om[݄DԺ&=AUQ|9 wsLo^+^X)h՚o4/RvƗqb*DR*$Y ꑒד2E␛ Bp| 5a?}O[G:FuĎ#t>G'5%1Z#^P[@Ot:>LƬ+xk}kp :xq>GC9n`vvZuZPy`SV"P|m4jvSO)JDN=Y>Al\6Jע# e\ ϺW3F$n%47 n, cӒ l)%6K馳ޣ]ĆB:!gT>X-Q\ŰK.1,'@V65p̣Q !J@!$̣4Wg"*G> 6P,;}p XG(ill3!] @ux5"Wq9P/rG|y+!6ݞ j ޖrFs$uJ;Dtѫ6,HqsO2L `8GAc.e6~~wJAcؽMhf7TA!9}ʍR^8#iZ%tb:b]5Ә٪>{r.&ByTmEQpHnfj>ո&\krB@e,jZh  f2]>~oElvi(G+q4XFEHmdrć?0(ǞzQ'[Q@76BeTgDKQV6t שK ;edŨnB Ak i(Vp!z=2e CD%wyb{N]I'}Qv@f2vˋ^qv XHC-C TvCMFG)̒%Ǜ\GRBެsnܯ u[dh)x} ٗSF歘R0.w-IJ?\ Z2`W$xL˧"!|1Ž"48P?` Ựj\KEb,WߋCtm,{II=K~j3&iR7:{Ζ6YҦ;\D}N>/x`S֥)} }j5ų; "u[a?r!1}ɱ١Ԅ3&T #4~`w*l#5 3>gH$%QĚ%|~`P>%Ty7J-M ~ zon$t5F}q38n}AWRn|@Z\kCM8P4)%k)6y} "6SOh0Q#d 'J<'=ܞ`| ?o`K0YX 9@R-ь]_]'jktoULTC))ޤR^6VJX2x.tߧ^flTU}Y#1dM48FĊ54KƠR?"Z:f vnoa$&htX[r|z/=gEy? %d {E%GwCJO3\1vz1r! ق1K+VxGYQͧGiUzLd@Mq4/oݲѠ?Ӈ6:VϪ;PO31ɖ-g1g>c%)<;QBIlh}}f7Xn;)%z&i9R|! Uh 4] 4[q3-u4fC2kz;ZzsDqlMe6T6mj70ۢ`6uuE0YSYlGw -i]]T[Aa_&k]{{'AX pweja t,W(Kǁ欋pdWw}D^-.GA6o!q1<0_ D yVI;| N=$ ;S,+.i%-mEf /_D )\,P}l"\`d5Jr6HƷE1=b""܋Z@(s}4C ~fgqVvAdj(BpY?5h15kt% I\#klz%I]ϼ5 \e,!&{)G?Od>C@T&E 2f~Ȱė@GbQ?Q'1/q^kjD@yɋJΚǗ5 q`bMagl47㬊7쨂|./F#XEg-:cWu?:CT@غ*FaN*9GA7zim SKK.i4a&Fs)s/#"wj\|(V]Cgfl4cKH'_R c,;];\&#VI\g&RЬ˅'uL*})_,<35P7o5yU B!\Ex?H2C1`&F=;:۶l@"@$@ծH v_>]E4wAhlQD4'\^ o*Yv+yYݵRQEgL9.x=;^vL.Qshyem5y[?:ؽ䢛>q.Xqeӝ`qFcBw\#CM-(M1+jt?M]҃s0 >,:&p eY[E(r%|1p} ].L,^v4[~z%SD*y^9xY/*ZK3`ፒER!gH'n{T5 辢^Fޔs#Ww%'z[7#0w7 >/o[$ڇ`?rB\LcxϏRuu'Qe4ApNˡ8%  ƞ|VAaXv{ B) PyqȜ^[ݏB:4XRn Xu9nW9!q5eoCz|< hL+W8F1nTvo6K7kQGWofJIq*>!<]̓O\Q1zmmOn}iDkֵt\0񱨣Hs9N78йўzc9DrEAVI$Ts+x#lm&Z4Ig:ys:Kٹ$$. pޮ!6 ɬy!aX#RXWyz˪ź{޽|dz?hi#@״S EcsP b; ۭ`>o߫ {%V..i(\V~۾=\'@WQ%9wB D5gUY?G%$Ȗ Vq;?VsOpm{.=ˈr4TaÆGOs@6oP[-)/![@7l'Di u(X"I p'>;G`Y)jrks I9-aɉn6E,$%<_7v4WɃ'A?Ixܐz!\3 1EXk 7+a+hOI5)89*o'0ࠉs7ej >3}쁯\4!O;uLcUMغƧDNKr-B$f (XݚJ+k%n-e+ iUTIۨ8c +Ɔݲ A}˹_|'0KAeS rr˯}SȒ Ե{zy]٬5 9#urեCMFNѥ˒Rȅ\`.u<|0V9 t _ey/peM6閲I^O/\SXTSO/<ȟop}4n}[lm]][UZNи\yL2vG=G'I {,祇%[T%uUPȶ@ߖBHGx'4;%Plk BI l{K4"S-\Jf~8u%qO\XKA{l :4.Rϛ8G ejQ{~i1'ވ=] HOPZ$#pl(}"!dё:iB ^rq:Ə\6q/a̭QZ6H:3ߪz+_?]^Eh ~gFk 4$҅?4T4<8:{Eg3$LƗ"7&+p7׭;O {|udĉV6XmDR菇Iiry_6.KF͑#_1cYvŎPC ߯8'Z%9 h鮋5,@b?GsA[oA> vL`cm3I.G1o`iVWWby#, 3/Z\@$'nFٝBE ˯ĠS}`C^=d h$ᘶw>#pϿuN1!] y26,0~yƹ͊q$ czASjM:!s+PNZJ%uNLi̽R۾-?$k~\Zu+_-BC-2 * d'@ 0(̍&m$i% \]у ^q_B%B~}?8s%+)6V|`+@M8SXp'n^nID1Qc9T|2ɹvcZsbwoVp{o;w}L/c^ZA35#Z =UI8 +ō "@5vmEG2e&l}.`=__'+}ψ{5$- @M%BCl,?莢 fy sU:+Wc! J}OrQ m ZBo;%[._YI>/PL+MeBCZyɡ%/0B xbvBȱҠrGNx>-8X?Ea^H-̄zn&Ɵi"'$DJkRmnif0`$4;8g.)IP_ࡼe'&U9vy>4oKC9,eŰrU _WKh)ׅmL]Z`k9~.N|>uݹ.~ϔ^uH!"cXVsox>7z&zOuåX[G)DI"n*n9D(b\ñv]iG~Kvbh1}van?uJ퐠=&_=P7V  BD\8c{S֪JaWprNBXέ9:~yS΀%PMlgp)x47 2ANVmF6 % ByWGOuNEl.|sUI ^qF6$YZ |_H2rz]eU br)Mlb}n4߾=[w cXaf VL Qn~Yp=g!n6"j:>zd$R[P(Ez9 \Qg %>bYjU}úp>.ˌ⹾}/ʝM$ AytOG;Y=KݚS%\Vȵyo2i8ȱx,wU TJn9U-|CQ/b܋ ito\)Hcsb\g+x3f1 NX6s&hv;z߃Ŝ3.X fú;8MGf9؆@{=P׳0Yi% FWkV6, qY6P(Vew ]bⴉ/n<{)srZ"C)]M`Fb(QPzi`1#Bܥ>Zn;!m ,{ Dra^J#%&6d^MkD>; KQb DXn"qNg \ ӏځPaP!v Q?,#i% P=p$dž=4O}an7X9jo|93JXǗYY 2M8 pR mN.S໵;j3,Ib/xpk;Tr9FPkT+\BYPX|/>(&L,oq!ͅp?oZM!XUTb7:ʤbFlbT@ f oըAQžjܴ eC! ,'`4OvZlJX6LX נ1BFzbl8W^@ =~)P[Ņ$Mz' +d{\s40hҎa.-a-=k᪾!RdfAHIAu . 1I2R0hiZF'<U''hᖢ db.rR@JI< |x8qvFc4 ^`怉gDU MJI]VKlI{K$\/`5?-C ך@ߎnO~#iћouEs#hE LIEyYs{7[s{a"lQcmoWlDNμ/7K x^ ؘõ SO78O|.jݟt@N_"Mi*7@<O/{@-}&q2n&UsL%M bo_)jDYҒyf15)ް"BۜMCb.koid06|Ir-tsJ:!O6Myʊ˧2j.Q?u,3h,k5逛)ErK;؈Q{W9O,VFLSDD-vqQEi̡Lrwӱ{p=J,D2~tCحŠ+?.ݙԘ \^F _KaxkIw>.DU&I7Im?]ɫ>HeT AQg0 uMiGF ,{,'H#wB+瞳GSb͛v`cX_^V }I,rW@` IV}ȸ)qHL&L2TeVV@]{ͪyn}LQ/Э`iK hwR I0CAx]53SG?B9gYhveLKEzEq״!rFOSɗuM{._#DHʆ3Xm<. X NZthĴ&ؙPR}Դ[~\M3 cZlx#TvO>4榼:+`oX/{IDj@{mۏ=2 4OSjNP˽;?z 5 4`1UG_ko$v={ HaqyàJOz3J9]{~oߍ{/{UWB"gxGt"lÖeNm=jEB(U"EDOpo՟̓!-"t?BwfMSПg+U,JR 'qeK :>Y7`6 ={zK %Ciի]D$<̤o( iGB XRIG"3>|`,#o$*X_2ݭTƱPFbuSjHK.3 -Z\<8 ۱V(H})umsQuPͨ: †qmyKW@b v#Ԓ<%վc92 2J$-v/$r-Tf%.Vp/Bfhh9 ?2DiHA$l +#R8+h!@m9]ՋAGKUq>&e?3;w,o_ h͌-cmi'PXc*(-xqOyi7-DM L~0.3Hs`J _l mHUu__# Q$R#0h!11&B, Uڡ}4"1C8EdRDsF91 / PwQrHHWh J_ӨvĈQK6UL+/rC .^m[I|kޝN?qۗbj1CnU"xݫ oG",.p@'7c"GFGV;d6oCտʮC5flv0#6-o[kdՌ|/e8 ^Lwǀ}áYVLE'ۮj3erߝVrs^R-?U_.k0*RjMQo2x3ld>a72LeNfnı4Ejqhs0i ~bh$8[S] *b8K#E 08" ˼pܿ-l:!@q0qEG7E􃑞rJWXJR)A%_6QlZXU#Lh7rN:yQ{{- 9zRljՖ|bCV@Fg9&Y !<1kq3}I*\u\B4.]@I7}eӕ"J ~ۍ`l^KuE *sx $챻Lg󶴰:fAZCYt>r7S "z120_H?S#=wX䐭pqRXs=1ns,Sz>.mI$13x)N~1}|Kwȗ*B'ءdz5cF)z9FdxQܭ6.(D RXPfceA F,_M*2 *nC+Ǭ 2mί煡;Cӳy\lQ;z{SLdѱE:]fF#oRG %;zsvK(5 %xE=w|ap8!Gf'u_1FvڅE Єuz}ѝhLKwVEiHBL;Cl+L3]oYŤK&fJNd/ L  0U*s)cqaUPGfݱ|<|#ҔĂr,#T.#l3BoB!xD;:x*E<0J˜-l1k?U!OI's+Y5͑pV8~K6 6+m{KJГ sS݃:*Dh$޿džzPJ 5,, vÒrwwco|B֞fŢ9gElǭ5 gho FpDW܌z\sFRg[ļ>WѓQM