gvim-9.0.2103-150000.5.57.1<>, 0e_p9|1u!gqU K,F T%"&X,`ܤIB)@$~" 8&06QJs&B2NJLQ`( [9O!k1ҭWkHUOk(rU$Eچzeߝ6DIv5C)0w m1 Y%RH?d  +8<LPi V4 r  ,   |  . T  * |*R*(89x:>k@sB{FGH,IXY,Z[\]^|bEcddeifllnuvwxhy0zCgvim9.0.2103150000.5.57.1A GUI for ViPackage gvim contains the largest set of features of vim, which is graphical windows and language interpreter, like python, ruby, or perl. You need package vim for the help and other documentation too. If you want less features, you might want to install vim instead.e_ibs-power9-13^zSUSE Linux Enterprise 15SUSE LLC Vimhttps://www.suse.com/Productivity/Text/Editorshttps://www.vim.org/linuxppc64le/usr/sbin/update-alternatives \ --install /usr/bin/vim vim /usr/bin/gvim 30 \ --slave /usr/bin/vi vi /usr/bin/gvimif [ ! -e /usr/bin/gvim ] ; then /usr/sbin/update-alternatives --remove vim /usr/bin/gvim fi\ 8r)U C.&F,A큤e_e_e_e_e_e_e_e_e_e_e_e_e_e_e_e_e_e_e_ePae_e_e_e_e_e_e_e_e_e_e_47e1672c7e42bec846face3597d0c3a02d4a3a1e3c7b8e3fd34f5eb83bb3f485761bba80e57d7bb566bd56c4369c6777d92b54f9b77ef8a1edc3ecc4c397feeb9214a5266181ac8e4bb41475f3e1c4c9d66359d7faedf8c2a15f0cbe591a820196946503aad0bab7ef3fa89e74f9fd44294c1ad24aa6ff7c1ee428fc43b8bad96eec36bce6a7817e62c4b15940ab1b42af19292b7ed37d42e268d2c9131b2db708795d7de0debd3ce4d8d7012d3a468d0008a470abeb5b87a46f01ffb7e3ea0b0685688fa3eabffad030fb2450faff870a4db4fb3179b4bf87b1853cb625b001d203547ea1a77a3202cceda1b017a54628250e2f0443e8d947146387145eaa09051e24f1bdf0a66bc7c3d3bb811c5229dbe789119d4dde535a1b92872090cb8f7f1c006a109948927f594b3915999ed80293e0b592a7706efafedb212411be3ca7620817e07ddab0ae17a5cb7bddeda01a42119c9863aacb48f37f1784b17f225bbc8b1988690ddf5be1c0cd1847d3128da54cfd66787308238e7825ee36988cb498011da6e6641951421a79de2e1c6ed4977d08a82afc14538e957c806d7544a8fc3d48d94761e5e255c76c7ddee31b7ef5c0cde8c919cf92a3a0c08ec58390946dce274e5051e4853cb1bf3483966bb349cd2a9e575af7e773c1ffdcaff749gvimgvimgvimgvimgvimgvimgvimgvimgvimgvim/etc/alternatives/vi/etc/alternatives/vim@@Irootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootvim-9.0.2103-150000.5.57.1.src.rpmapplication()application(gvim.desktop)config(gvim)gvimgvim(ppc-64)gvim-basegvim-enhancedgvim_clientmimehandler(application/x-shellscript)mimehandler(text/english)mimehandler(text/plain)mimehandler(text/x-c)mimehandler(text/x-c++)mimehandler(text/x-c++hdr)mimehandler(text/x-c++src)mimehandler(text/x-chdr)mimehandler(text/x-csrc)mimehandler(text/x-java)mimehandler(text/x-makefile)mimehandler(text/x-moc)mimehandler(text/x-pascal)mimehandler(text/x-tcl)mimehandler(text/x-tex)vivim_client@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@    /bin/sh/bin/shconfig(gvim)gvim_clientlibICE.so.6()(64bit)libSM.so.6()(64bit)libX11.so.6()(64bit)libXt.so.6()(64bit)libacl.so.1()(64bit)libacl.so.1(ACL_1.0)(64bit)libattr.so.1()(64bit)libattr.so.1(ATTR_1.0)(64bit)libc.so.6()(64bit)libc.so.6(GLIBC_2.17)(64bit)libcairo.so.2()(64bit)libdl.so.2()(64bit)libdl.so.2(GLIBC_2.17)(64bit)libgdk-3.so.0()(64bit)libgdk_pixbuf-2.0.so.0()(64bit)libgio-2.0.so.0()(64bit)libglib-2.0.so.0()(64bit)libgobject-2.0.so.0()(64bit)libgpm.so.2()(64bit)libgtk-3.so.0()(64bit)libm.so.6()(64bit)libm.so.6(GLIBC_2.17)(64bit)libpango-1.0.so.0()(64bit)libpangocairo-1.0.so.0()(64bit)libperl.so()(64bit)libpthread.so.0()(64bit)libpthread.so.0(GLIBC_2.17)(64bit)librt.so.1()(64bit)librt.so.1(GLIBC_2.17)(64bit)libtinfo.so.6()(64bit)libtinfo.so.6(NCURSES6_TINFO_5.0.19991023)(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)update-alternativesupdate-alternativesvim-data9.0.2103-150000.5.57.13.0.4-14.6.0-14.0-15.2-19.0.2103-150000.5.57.1gvim8.24.14.1e]@e dܺ@dx@dldZ5dJcd'@ccR@c~ @cM@bb@`4@`.V^)@^@^2\@Zľ@ZlZ@Z%Z1@Z@V͛@V͛@VIV@V@VVŲ@V@V@VT@VV@V@V^VVuFVm]Vd#@VQ@VO @VCV VUU6@U@U@UnU@UUUx&U_@U>$U+UUQTT!TD@TfTr@T T TT|TTxcTk4T[bTBV@zbalogh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comjehan.singh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comlnussel@suse.delnussel@suse.delnussel@suse.deidonmez@suse.comlnussel@suse.deidonmez@suse.comstefan.bruens@rwth-aachen.dekukuk@suse.delnussel@suse.deidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comtchvatal@suse.comidonmez@suse.comnormand@linux.vnet.ibm.comsuse-beta@cboltz.deidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.commpluskal@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comwerner@suse.deidonmez@suse.comidonmez@suse.comidonmez@suse.comtchvatal@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comkukuk@suse.desuse-beta@cboltz.dekukuk@suse.deidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comdimstar@opensuse.orgidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comcrrodriguez@opensuse.orgidonmez@suse.comidonmez@suse.comidonmez@suse.comsuse-beta@cboltz.deidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comopensuse@cboltz.deidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comlars@linux-schulserver.deidonmez@suse.comidonmez@suse.comidonmez@suse.comopensuse@cboltz.de- Updated to version 9.0 with patch level 2103, fixes the following security problems * Fixing bsc#1215940 (CVE-2023-5344) - VUL-0: CVE-2023-5344: vim: Heap-based Buffer Overflow in vim prior to 9.0.1969. * Fixing bsc#1216001 (CVE-2023-5441) - VUL-0: CVE-2023-5441: vim: segfault in exmode when redrawing * Fixing bsc#1216167 (CVE-2023-5535) - VUL-0: CVE-2023-5535: vim: use-after-free from buf_contents_changed() * Fixing bsc#1216696 (CVE-2023-46246) - VUL-0: CVE-2023-46246: vim: Integer Overflow in :history command - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.1894...v9.0.2103- Updated to version 9.0 with patch level 1894, fixes the following security problems * Fixing bsc#1214922 (CVE-2023-4738) - VUL-0: CVE-2023-4738: vim: heap-buffer-overflow in vim_regsub_both * Fixing bsc#1214924 (CVE-2023-4735) - VUL-0: CVE-2023-4735: vim: OOB Write ops.c * Fixing bsc#1214925 (CVE-2023-4734) - VUL-0: CVE-2023-4734: vim: segmentation fault in function f_fullcommand * Fixing bsc#1215004 (CVE-2023-4733) - VUL-0: CVE-2023-4733: vim: use-after-free in function buflist_altfpos * Fixing bsc#1215006 (CVE-2023-4752) - VUL-0: CVE-2023-4752: vim: Heap Use After Free in function ins_compl_get_exp * Fixing bsc#1215033 (CVE-2023-4781) - VUL-0: CVE-2023-4781: vim: heap-buffer-overflow in function vim_regsub_both - drop patches: disable-unreliable-tests.patch ignore-flaky-test-failure.patch vim-8.1.0297-dump3.patch - dropped %check - most of tests didn't work correctly in OBS and maintenance burden of this was getting too big - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.1632...v9.0.1894- Use app icon generated from vimlogo.eps in source tarball; add higher res icons of sizes 128, 256, and 512px as png sources. Our current icons deviate from upstream flatpaks for example. - Updated to version 9.0 with patch level 1632 - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.1443...v9.0.1632- Updated to version 9.0 with patch level 1572, fixes the following security problems * Fixing bsc#1210996 (CVE-2023-2426) - VUL-0: CVE-2023-2426: vim: Use of Out-of-range Pointer Offset in GitHub repository vim/vim prior to 9.0.1499. * Fixing bsc#1211256 (CVE-2023-2609) - VUL-1: CVE-2023-2609: vim: NULL Pointer Dereference prior to 9.0.1531 * Fixing bsc#1211257 (CVE-2023-2610) - VUL-1: CVE-2023-2610: vim: Integer Overflow or Wraparound prior to 9.0.1532 - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.1443...v9.0.1572- Fixing bsc#1211461 - L3: vim "eats" first character from prompt in xterm * Add: reorder-exit-raw-mode.patch * Swaps out_str_t_TE() and cursor_on() during exit to prevent missing characters in xterm prompt on exit.- Fixing bsc#1211144 - [Build 96.1] openQA test fails in zypper_migration - conflict between xxd and vim * Revert the creation standalone xxd packages- Updated to version 9.0 with patch level 1443, fixes the following security problems * Fixing bsc#1209042 (CVE-2023-1264) - VUL-0: CVE-2023-1264: vim: NULL Pointer Dereference vim prior to 9.0.1392 * Fixing bsc#1209187 (CVE-2023-1355) - VUL-0: CVE-2023-1355: vim: NULL Pointer Dereference prior to 9.0.1402. * Fixing bsc#1208828 (CVE-2023-1127) - VUL-1: CVE-2023-1127: vim: divide by zero in scrolldown() - drop vim-8.0-ttytype-test.patch as it changes test_options.vim which we remove during %prep anyway. And this breaks quilt setup. - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.1386...v9.0.1443- Updated to version 9.0 with patch level 1386, fixes the following security problems * Fixing bsc#1207780 - (CVE-2023-0512) VUL-0: CVE-2023-0512: vim: Divide By Zero in GitHub repository vim/vim prior to 9.0.1247 * Fixing bsc#1208957 - (CVE-2023-1175) VUL-0: CVE-2023-1175: vim: Incorrect Calculation of Buffer Size * Fixing bsc#1208959 - (CVE-2023-1170) VUL-0: CVE-2023-1170: vim: Heap-based Buffer Overflow in vim prior to 9.0.1376 * Fixing bsc#1208828 - (CVE-2023-1127) VUL-1: CVE-2023-1127: vim: divide by zero in scrolldown() - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.1234...v9.0.1386- Updated to version 9.0 with patch level 1234, fixes the following security problems * Fixing bsc#1207396 VUL-0: CVE-2023-0433: vim: Heap-based Buffer Overflow in vim prior to 9.0.1225 * Fixing bsc#1207162 VUL-1: CVE-2023-0288: vim: Heap-based Buffer Overflow in GitHub repository vim/vim prior to 9.0.1189. * Fixing bsc#1206868 VUL-1: CVE-2023-0054: vim: Out-of-bounds Write in GitHub repository vim/vim prior to 9.0.1145. * Fixing bsc#1206867 VUL-1: CVE-2023-0051: vim: Heap-based Buffer Overflow in GitHub repository vim/vim prior to 9.0.1144. * Fixing bsc#1206866 VUL-1: CVE-2023-0049: vim: Out-of-bounds Read in GitHub repository vim/vim prior to 9.0.1143. - refreshed vim-7.4-highlight_fstab.patch - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.1040...v9.0.1234- Updated to version 9.0 with patch level 1040, fixes the following security problems * Fixing bsc#1206028 VUL-0: CVE-2022-3491: vim: Heap-based Buffer Overflow prior to 9.0.0742 * Fixing bsc#1206071 VUL-0: CVE-2022-3520: vim: Heap-based Buffer Overflow * Fixing bsc#1206072 VUL-0: CVE-2022-3591: vim: Use After Free * Fixing bsc#1206075 VUL-0: CVE-2022-4292: vim: Use After Free in GitHub repository vim/vim prior to 9.0.0882. * Fixing bsc#1206077 VUL-0: CVE-2022-4293: vim: Floating Point Comparison with Incorrect Operator in GitHub repository vim/vim prior to 9.0.0804. * Fixing bsc#1205797 VUL-0: CVE-2022-4141: vim: heap-buffer-overflow in alloc.c 246:11 * Fixing bsc#1204779 VUL-0: CVE-2022-3705: vim: use after free in function qf_update_buffer of the file quickfix.c - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.814...v9.0.1040- Updated to version 9.0 with patch level 0814, fixes the following problems * Fixing bsc#1192478 VUL-1: CVE-2021-3928: vim: vim is vulnerable to Stack-based Buffer Overflow * Fixing bsc#1203508 VUL-0: CVE-2022-3234: vim: Heap-based Buffer Overflow prior to 9.0.0483. * Fixing bsc#1203509 VUL-1: CVE-2022-3235: vim: Use After Free in GitHub prior to 9.0.0490. * Fixing bsc#1203820 VUL-0: CVE-2022-3324: vim: Stack-based Buffer Overflow in prior to 9.0.0598. * Fixing bsc#1204779 VUL-0: CVE-2022-3705: vim: use after free in function qf_update_buffer of the file quickfix.c * Fixing bsc#1203152 VUL-1: CVE-2022-2982: vim: use after free in qf_fill_buffer() * Fixing bsc#1203796 VUL-1: CVE-2022-3296: vim: stack out of bounds read in ex_finally() in ex_eval.c * Fixing bsc#1203797 VUL-1: CVE-2022-3297: vim: use-after-free in process_next_cpt_value() at insexpand.c * Fixing bsc#1203110 VUL-1: CVE-2022-3099: vim: Use After Free in ex_docmd.c * Fixing bsc#1203194 VUL-1: CVE-2022-3134: vim: use after free in do_tag() * Fixing bsc#1203272 VUL-1: CVE-2022-3153: vim: NULL Pointer Dereference in GitHub repository vim/vim prior to 9.0.0404. * Fixing bsc#1203799 VUL-1: CVE-2022-3278: vim: NULL pointer dereference in eval_next_non_blank() in eval.c * Fixing bsc#1203924 VUL-1: CVE-2022-3352: vim: vim: use after free * Fixing bsc#1203155 VUL-1: CVE-2022-2980: vim: null pointer dereference in do_mouse() * Fixing bsc#1202962 VUL-1: CVE-2022-3037: vim: Use After Free in vim prior to 9.0.0321 - ignore-flaky-test-failure.patch: Ignore failure of flaky tests - disable-unreliable-tests-arch.patch: Removed - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.0313...v9.0.0814- Updated to version 9.0 with patch level 0313, fixes the following problems * Fixing bsc#1200884 Vim: Error on startup * Fixing bsc#1200902 VUL-0: CVE-2022-2183: vim: Out-of-bounds Read through get_lisp_indent() Mon 13:32 * Fixing bsc#1200903 VUL-0: CVE-2022-2182: vim: Heap-based Buffer Overflow through parse_cmd_address() Tue 08:37 * Fixing bsc#1200904 VUL-0: CVE-2022-2175: vim: Buffer Over-read through cmdline_insert_reg() Tue 08:37 * Fixing bsc#1201249 VUL-0: CVE-2022-2304: vim: stack buffer overflow in spell_dump_compl() * Fixing bsc#1201356 VUL-1: CVE-2022-2343: vim: Heap-based Buffer Overflow in GitHub repository vim prior to 9.0.0044 * Fixing bsc#1201359 VUL-1: CVE-2022-2344: vim: Another Heap-based Buffer Overflow vim prior to 9.0.0045 * Fixing bsc#1201363 VUL-1: CVE-2022-2345: vim: Use After Free in GitHub repository vim prior to 9.0.0046. * Fixing bsc#1201620 PUBLIC SUSE Linux Enterprise Server 15 SP4 Basesystem zbalogh@suse.com NEW --- SLE-15-SP4-Full-x86_64-GM-Media1 and vim-plugin-tlib-1.27-bp154.2.18.noarch issue * Fixing bsc#1202414 VUL-1: CVE-2022-2819: vim: Heap-based Buffer Overflow in compile_lock_unlock() * Fixing bsc#1202552 VUL-1: CVE-2022-2874: vim: NULL Pointer Dereference in generate_loadvar() * Fixing bsc#1200270 VUL-1: CVE-2022-1968: vim: use after free in utf_ptr2char * Fixing bsc#1200697 VUL-1: CVE-2022-2124: vim: out of bounds read in current_quote() * Fixing bsc#1200698 VUL-1: CVE-2022-2125: vim: out of bounds read in get_lisp_indent() * Fixing bsc#1200700 VUL-1: CVE-2022-2126: vim: out of bounds read in suggest_trie_walk() * Fixing bsc#1200701 VUL-1: CVE-2022-2129: vim: out of bounds write in vim_regsub_both() * Fixing bsc#1200732 VUL-1: CVE-2022-1720: vim: out of bounds read in grab_file_name() * Fixing bsc#1201132 VUL-1: CVE-2022-2264: vim: out of bounds read in inc() * Fixing bsc#1201133 VUL-1: CVE-2022-2284: vim: out of bounds read in utfc_ptr2len() * Fixing bsc#1201134 VUL-1: CVE-2022-2285: vim: negative size passed to memmove() due to integer overflow * Fixing bsc#1201135 VUL-1: CVE-2022-2286: vim: out of bounds read in ins_bytes() * Fixing bsc#1201136 VUL-1: CVE-2022-2287: vim: out of bounds read in suggest_trie_walk() * Fixing bsc#1201150 VUL-1: CVE-2022-2231: vim: null pointer dereference skipwhite() * Fixing bsc#1201151 VUL-1: CVE-2022-2210: vim: out of bounds read in ml_append_int() * Fixing bsc#1201152 VUL-1: CVE-2022-2208: vim: null pointer dereference in diff_check() * Fixing bsc#1201153 VUL-1: CVE-2022-2207: vim: out of bounds read in ins_bs() * Fixing bsc#1201154 VUL-1: CVE-2022-2257: vim: out of bounds read in msg_outtrans_special() * Fixing bsc#1201155 VUL-1: CVE-2022-2206: vim: out of bounds read in msg_outtrans_attr() * Fixing bsc#1201863 VUL-1: CVE-2022-2522: vim: out of bounds read via nested autocommand * Fixing bsc#1202046 VUL-1: CVE-2022-2571: vim: Heap-based Buffer Overflow related to ins_comp_get_next_word_or_line() * Fixing bsc#1202049 VUL-1: CVE-2022-2580: vim: Heap-based Buffer Overflow related to eval_string() * Fixing bsc#1202050 VUL-1: CVE-2022-2581: vim: Out-of-bounds Read related to cstrchr() * Fixing bsc#1202051 VUL-1: CVE-2022-2598: vim: Undefined Behavior for Input to API related to diff_mark_adjust_tp() and ex_diffgetput() * Fixing bsc#1202420 VUL-1: CVE-2022-2817: vim: Use After Free in f_assert_fails() * Fixing bsc#1202421 VUL-1: CVE-2022-2816: vim: Out-of-bounds Read in check_vim9_unlet() * Fixing bsc#1202511 VUL-1: CVE-2022-2862: vim: use-after-free in compile_nested_function() * Fixing bsc#1202512 VUL-1: CVE-2022-2849: vim: Invalid memory access related to mb_ptr2len() * Fixing bsc#1202515 VUL-1: CVE-2022-2845: vim: Buffer Over-read related to display_dollar() * Fixing bsc#1202599 VUL-1: CVE-2022-2889: vim: use-after-free in find_var_also_in_script() in evalvars.c * Fixing bsc#1202687 VUL-1: CVE-2022-2923: vim: NULL Pointer Dereference in GitHub repository vim/vim prior to 9.0.0240 * Fixing bsc#1202689 VUL-1: CVE-2022-2946: vim: use after free in function vim_vsnprintf_typval * Fixing bsc#1202862 VUL-1: CVE-2022-3016: vim: Use After Free in vim prior to 9.0.0285 Mon 12:00- Deleted patches: * restrict-shell-commands.patch * source-check-sandbox.patch * vim-8.0.1568-CVE-2021-3778.patch * vim-8.0.1568-CVE-2021-3796.patch * vim-8.0.1568-CVE-2021-3872.patch * vim-8.0.1568-CVE-2021-3927.patch * vim-8.0.1568-CVE-2021-3928.patch * vim-8.0.1568-CVE-2021-3984.patch * vim-8.0.1568-CVE-2021-4019.patch * vim-8.0.1568-CVE-2021-4193.patch * vim-8.0.1568-CVE-2021-46059.patch * vim-8.0.1568-CVE-2022-0319.patch * vim-8.0.1568-CVE-2022-0351.patch * vim-8.0.1568-CVE-2022-0361.patch * vim-8.0.1568-CVE-2022-0413.patch * vim-8.0.1568-globalvimrc.patch - Added patches: * vim-8.1.0297-dump3.patch * vim-8.2.2411-globalvimrc.patch * disable-unreliable-tests-arch.patch - Updated patches: * disable-unreliable-tests.patch * vim-7.3-filetype_changes.patch * vim-7.3-filetype_ftl.patch * vim-7.3-filetype_spec.patch * vim-7.3-gvimrc_fontset.patch * vim-7.3-help_tags.patch * vim-7.3-mktemp_tutor.patch * vim-7.3-name_vimrc.patch * vim-7.3-sh_is_bash.patch * vim-7.3-use_awk.patch * vim-7.4-disable_lang_no.patch * vim-7.4-filetype_apparmor.patch * vim-7.4-filetype_mine.patch * vim-7.4-highlight_fstab.patch * vim-8.0-ttytype-test.patch * vim-8.0.1568-defaults.patch * vim73-no-static-libpython.patch - Updated to version 8.2 with patch level 5038, fixes the following problems * Fixing bsc#1191770 VUL-0: CVE-2021-3875: vim: heap-based buffer overflow * Fixing bsc#1192167 VUL-0: CVE-2021-3903: vim: heap-based buffer overflow * Fixing bsc#1192902 VUL-0: CVE-2021-3968: vim: vim is vulnerable to Heap-based Buffer Overflow * Fixing bsc#1192903 VUL-0: CVE-2021-3973: vim: vim is vulnerable to Heap-based Buffer Overflow * Fixing bsc#1192904 VUL-0: CVE-2021-3974: vim: vim is vulnerable to Use After Free * Fixing bsc#1193466 VUL-1: CVE-2021-4069: vim: use-after-free in ex_open() in src/ex_docmd.c * Fixing bsc#1193905 VUL-0: CVE-2021-4136: vim: vim is vulnerable to Heap-based Buffer Overflow * Fixing bsc#1194093 VUL-1: CVE-2021-4166: vim: vim is vulnerable to Out-of-bounds Read * Fixing bsc#1194216 VUL-1: CVE-2021-4193: vim: vulnerable to Out-of-bounds Read * Fixing bsc#1194217 VUL-0: CVE-2021-4192: vim: vulnerable to Use After Free * Fixing bsc#1194872 VUL-0: CVE-2022-0261: vim: Heap-based Buffer Overflow in vim prior to 8.2. * Fixing bsc#1194885 VUL-0: CVE-2022-0213: vim: vim is vulnerable to Heap-based Buffer Overflow * Fixing bsc#1195004 VUL-0: CVE-2022-0318: vim: Heap-based Buffer Overflow in vim prior to 8.2. * Fixing bsc#1195203 VUL-0: CVE-2022-0359: vim: heap-based buffer overflow in init_ccline() in ex_getln.c * Fixing bsc#1195354 VUL-0: CVE-2022-0407: vim: Heap-based Buffer Overflow in Conda vim prior to 8.2. * Fixing bsc#1198596 VUL-0: CVE-2022-1381: vim: global heap buffer overflow in skip_range * Fixing bsc#1199331 VUL-0: CVE-2022-1616: vim: Use after free in append_command * Fixing bsc#1199333 VUL-0: CVE-2022-1619: vim: Heap-based Buffer Overflow in function cmdline_erase_chars * Fixing bsc#1199334 VUL-0: CVE-2022-1620: vim: NULL Pointer Dereference in function vim_regexec_string * Fixing bsc#1199747 VUL-0: CVE-2022-1796: vim: Use After in find_pattern_in_path * Fixing bsc#1200010 VUL-0: CVE-2022-1897: vim: Out-of-bounds Write in vim * Fixing bsc#1200011 VUL-0: CVE-2022-1898: vim: Use After Free in vim prior to 8.2 * Fixing bsc#1200012 VUL-0: CVE-2022-1927: vim: Buffer Over-read in vim prior to 8.2 * Fixing bsc#1070955 VUL-1: CVE-2017-17087: vim: Sets the group ownership of a .swp file to the editor's primary group, which allows local users to obtain sensitive information * Fixing bsc#1194388 VUL-1: CVE-2022-0128: vim: vim is vulnerable to Out-of-bounds Read * Fixing bsc#1195332 VUL-1: CVE-2022-0392: vim: Heap-based Buffer Overflow in vim prior to 8.2 * Fixing bsc#1196361 VUL-1: CVE-2022-0696: vim: NULL Pointer Dereference in vim prior to 8.2 * Fixing bsc#1198748 VUL-1: CVE-2022-1420: vim: Out-of-range Pointer Offset * Fixing bsc#1199651 VUL-1: CVE-2022-1735: vim: heap buffer overflow * Fixing bsc#1199655 VUL-1: CVE-2022-1733: vim: Heap-based Buffer Overflow in cindent.c * Fixing bsc#1199693 VUL-1: CVE-2022-1771: vim: stack exhaustion in vim prior to 8.2. * Fixing bsc#1199745 VUL-1: CVE-2022-1785: vim: Out-of-bounds Write * Fixing bsc#1199936 VUL-1: CVE-2022-1851: vim: out of bounds read- Minimal fix for Bug 1195004 - (CVE-2022-0318) VUL-0: CVE-2022-0318: vim: Heap-based Buffer Overflow in vim prior to 8.2. / vim-8.0.1568-CVE-2022-0413.patch - Fixing bsc#1190570 CVE-2021-3796: vim: use-after-free in nv_replace() in normal.c / vim-8.0.1568-CVE-2021-3796.patch - Fixing bsc#1191893 CVE-2021-3872: vim: heap-based buffer overflow in win_redr_status() drawscreen.c / vim-8.0.1568-CVE-2021-3872.patch - Fixing bsc#1192481 CVE-2021-3927: vim: vim is vulnerable to Heap-based Buffer Overflow / vim-8.0.1568-CVE-2021-3927.patch - Fixing bsc#1192478 CVE-2021-3928: vim: vim is vulnerable to Stack-based Buffer Overflow / vim-8.0.1568-CVE-2021-3928.patch - Fixing bsc#1193294 CVE-2021-4019: vim: vim is vulnerable to Heap-based Buffer Overflow / vim-8.0.1568-CVE-2021-4019.patch - Fixing bsc#1193298 CVE-2021-3984: vim: illegal memory access when C-indenting could lead to Heap Buffer Overflow / vim-8.0.1568-CVE-2021-3984.patch - Fixing bsc#1190533 CVE-2021-3778: vim: Heap-based Buffer Overflow in regexp_nfa.c / vim-8.0.1568-CVE-2021-3778.patch - Fixing bsc#1194216 CVE-2021-4193: vim: vulnerable to Out-of-bounds Read / vim-8.0.1568-CVE-2021-4193.patch - Fixing bsc#1194556 CVE-2021-46059: vim: A Pointer Dereference vulnerability exists in Vim 8.2.3883 via the vim_regexec_multi function at regexp.c, which causes a denial of service. / vim-8.0.1568-CVE-2021-46059.patch - Fixing bsc#1195066 CVE-2022-0319: vim: Out-of-bounds Read in vim/vim prior to 8.2. / vim-8.0.1568-CVE-2022-0319.patch - Fixing bsc#1195126 CVE-2022-0351: vim: uncontrolled recursion in eval7() / vim-8.0.1568-CVE-2022-0351.patch - Fixing bsc#1195202 CVE-2022-0361: vim: Heap-based Buffer Overflow in vim prior to 8.2. / vim-8.0.1568-CVE-2022-0361.patch - Fixing bsc#1195356 CVE-2022-0413: vim: use after free in src/ex_cmds.c / vim-8.0.1568-CVE-2022-0413.patch- install suse vimrc in /usr (boo#1182324, vim-8.0.1568-globalvimrc.patch)- source correct suse.vimrc file (boo#1182324)- stop owning /etc/vimrc so the old, distro provided config actually gets removed. Leaving it around leads to a duplicated autocmd for * .spec, leading to spec file template inserted twice. - own some dirs in vim-data-common so installation of vim-small doesn't leave not owned directories (boo#1173256). - Add vi as slave to update-alternatives so that every package has a matching "vi" symlink (bsc#1174564, boo#1176549).- Add restrict-shell-commands.patch to disable using interfaces in restricted mode, fixes bsc#1172225 CVE-2019-20807- introduce vim-small package with reduced requirements for small installations (boo#1166602). - BuildRequire pkg-config(krb5) instead of krb5-mini to be able to build against Tumbleweed repo.- Add source-check-sandbox.patch to fix CVE-2019-12735 boo#1137443- Pre-convert gvim icons, otherwise building vim depends on rsvg-convert -> librsvg -> cargo -> Rust -> LLVM - Cleanup SVG icon, make lines pixel-grid aligned - Correct RPM Group- Use %license instead of %doc [bsc#1082318]- instead of explicitly unsetting mouse, remove it from the defaults in the first place (boo#1079185, vim-8.0.1568-defaults.patch)- Switch to make -j1 clean to see if it fixes random build failures on Leap/SLE 15.- Updated to revision 1568, fixes the following problems * No test using a screen dump yet. * Screen dump test fails on MS-Windows. * Dead code found. * Assert_equalfile() does not close file descriptors. (Coverity) * Dump test fails when using a shadow directory. * Cannot use 24 bit colors in MS-Windows console. * Compiler warnings without termguicolors feature. * Libterm doesn't support requesting fg and bg color. * C syntax test fails when using gvim * C syntax test still fails when using gvim. * Quotestar test is flaky when using the GUI. * Xxd does not skip NUL lines when using ebcdic. * Popupmenu is too far left when completion is long. (Linwei) * No test for the popup menu positioning. * Popup menu positioning fails with longer string. * synpat_T is taking too much memory. * Terminal screen dump does not include cursor position. * With 'termguicolors' Normal color doesn't work correctly. * When using 'termguicolors' SpellBad doesn't show. * Screen dumps not included in distribution. * Using feedkeys() in a terminal window may trigger mappings. (Charles Sheridan) * Undo in the options window makes it empty. * Screen dump test script not included in distribution. * Various small problems in test files. * Various small problems in source files. * On Mac 'maxmemtot' is set to a weird value. * May leak file descriptors when executing job. * Cannot see what digraph is used to insert a character. * Custom plugins loaded with --clean. * Build error for some combination of features. * May not parse the t_RS response correctly, resulting in wrong characters in the input stream. * printf() does not work with only one argument. (Daniel Hahler) * No right-click menu in a terminal. * Build failure without GUI. * Build failure without GUI on MS-Windows. * Crash with rust syntax highligting. (Edd Barrett) * The terminal debugger can't set a breakpoint with the mouse. * Timeout of getwinposx() can be too short. (lilydjwg) * Too many #ifdefs. * Can't build Mac version without GUI. * Too many #ifdefs. * Cannot build Win32 GUI without IME. (John Marriott) * Can't build on older Mac, header file is missing.- Recommend vim-data so that colors can work by default- Updated to revision 1525, fixes the following problems * Compiler complains about uninitialized variable. (Tony Mechelynck) * Missing -D_FILE_OFFSET_BITS=64 may cause problems if a library is compiled with it. * Cannot act on edits in the command line. * Acessing freed memory after window command in auto command. (gy741) * Still too many old style tests. * Segmentation fault when Ruby throws an exception inside :rubyfile command. * Slow redrawing with DirectX. * Endless loop when gui_mch_stop_blink() is called while blink_state is BLINK_OFF. (zdohnal) * It is difficult to set the python home directory properly for Python 2.7 and 3.5 since both use $PYTHONHOME. * Terminal test fails on some systems. (jonathonf) * Terminal test fails on some slow terminals. * When in silent mode too much output is buffered. * If $SHELL contains a space then the default value of 'shell' is incorrect. (Matthew Horan) * Timer test on travis Mac is still flaky. * Clojure now supports a shebang line. * Filetype detection test does not check all scripts. * Cannot handle change of directory. * Missing file in patch. * Missing another file in patch. * Missing yet another file in patch. * Test fails without 'autochdir' option. * Completing directory after :find does not add slash. * Python2 and python3 detection not tested. (Matej Cepl) * Older GTK versions don't have gtk_entry_get_text_length(). * Libvterm doesn't handle illegal byte sequence correctly. * Illegal memory access in del_bytes(). * When package path is a symlink adding it to 'runtimepath' happens at the end. * Integer overflow when using regexp pattern. (geeknik) * On MS-Windows CursorIM highlighting no longer works. * MS-Windows: nsis installer is a bit slow. * MS-Windows: D&D fails between 32 and 64 bit apps. * Visual C 2017 has multiple MSVCVER numbers. * Invalid memory access in read_redo(). (gy741) * Screen isn't always updated right away. * Redraw flicker when moving the mouse outside of terminal window. * Unnecessary condition for "len" being zero. * Insert mode completion state is confusing. * Patch missing change. * Clearing a pointer takes two lines. * Using feedkeys() does not work to test Insert mode completion. (Lifepillar) * Searchpair() might return an invalid value on timeout. * Reduntant conditions. * Weird autocmd may cause arglist to be changed recursively. * Accessing invalid memory with "it". (Dominique Pelle) * Test 14 fails. * Emacs tags no longer work. (zdohnal) * There is no easy way to get the global directory, esp. if some windows have a local directory. * Number of spell regions is spread out through the code. * The minimum width of the popup menu is hard coded. * Memory leak in balloon_split(). * Completion items cannot be annotated. * No autocmd triggered in Insert mode with visible popup menu. * Having 'pumwidth' default to zero has no merit. * Clearing a pointer takes two lines. * Getting the jump list requires parsing the output of :jumps. * Getjumplist() returns duplicate entries. (lacygoill) * Out-of-memory situation not correctly handled. (Coverity) * Possible NULL pointer dereference. (Coverity) * Out-of-memory situation not correctly handled. (Coverity) * In out-of-memory situation character is not restored. (Coverity) * Access memory beyond end of string. (Coverity) * Win32: the screen may be cleared on startup. * Debugger can't break on a condition. (Charles Campbell) * New version of HP NonStop (Tandem) doesn't like the default header for setenv(). * Timer test is a bit flaky. * The :drop command is not always available. * Test for failing drag-n-drop command no longer fails. * Cannot test if a command causes a beep. * Some code for the debugger watch expression is clumsy. * Warning for possibly using NULL pointer. (Coverity) * The jumplist is not always properly cleaned up. * Getting the list of changes is not easy. * BufWinEnter event fired when opening hidden terminal. * Errors for job options are not very specific. * Invalid memory acces with pattern using look-behind match. (Dominique Pelle) * Error messages suppressed after ":silent! try". (Ben Reilly) * Getchangelist() does not use argument as bufname(). * Cursor is in the wrong line when using a WinBar in a Terminal window. * Shift-Tab does not work in a terminal window. * Popup menu is positioned in the wrong place. (Davit Samvelyan, Boris Staletic) * Cannot write and read terminal screendumps. * Compiler warnings for uninitialized variables. (Tony Mechelynck) * Using :wqa exits even if a job runs in a terminal window. (Jason Felice)- Split vim-data into vim-data-common package for low-disk usage scenarios bsc#1078722 bsc#1078554 bsc#1075541 - Make set mouse= default in suse.vimrc bsc#1079185 bsc#1078564 bsc#1067890 bsc#1064068 bsc#1062691- Updated to revision 1442, fixes the following problems * Crash when calling term_start() with empty argument. * Crash when term_start() fails. * MS-Windows: vimtutor fails if %TMP% has special chars. * After ":copen" can't get the window-ID of the quickfix window. (FalacerSelene) * Illegal memory access after undo. (Dominique Pelle) * GTK: :promtfind does not put focus on text input. (Adam Novak) * Memory leak in test_arabic. * Not enough information about what Python version may work. * Pkg-config doesn't work with cross compiling. * Filetype detection test not updated for change. * If cscope fails a search Vim may hang. * Terminal window: some vterm responses are delayed. * Using ":undo 0" leaves undo in wrong state. * Using pointer before it is set.- Make vim require vim-data bsc#1077352 bsc#1075541 bsc#1074790- Sort with spec-cleaner - Add conditional to build with python2 in order to build with py3 only enviroment - Convert dependencies to pkgconfig style- Updated to revision 1428, fixes the following problems * No test for expanding backticks. * Cursor column is not updated after ]s. (Gary Johnson) * Accessing freed memory in vimgrep. * Accessing invalid memory with overlong byte sequence. * No fallback to underline when undercurl is not set. (Ben Jackson) * Error in return not caught by try/catch. * The timer_pause test is flaky on Travis. * execute() does not work in completion of user command. (thinca) * "gf" and don't accept ? and & in URL. (Dmitrii Tcyganok) * The :leftabove modifier doesn't work for :copen. * Compiler warning on 64 bit MS-Windows system.- ignore make check transient errors for PowerPC bypass boo#1072651- Update apparmor.vim (taken from AppArmor 2.12) * add support for the "smc" network keyword- Updated to revision 1417, fixes the following problems * Encoding empty string to JSON sometimes gives "null". * Build fails with --with-features=huge --disable-channel. * Too much highlighting with 'hlsearch' and 'incsearch' set. * Cannot intercept a yank command. * It is not easy to see if a colorscheme is well written. * Memory leak when CTRL-G in search command line fails. * Pattern with \& following nothing gives an error. * :packadd does not load packages from the "start" directory. * Warnings and errors when building tiny version. (Tony Mechelynck) * Color scheme check script shows up as color scheme. * Cannot build with GTK but without XIM. (Guido) * Crash with nasty autocommand. (gy741, Dominique Pelle) * Using freed buffer in grep command. (gy741, Dominique Pelle) * Invalid memory access on exit when autocommands wipe out a buffer. * Duplicated code for getting a typed character. CursorHold is called too often in the GUI. (lilydjwg) * Difficult to track changes to a quickfix list. * GUI: CursorHold may trigger before 'updatetime' when using timers. * Crash in setqflist(). * Buffer overflow in :tags command. * Hang when using count() with an empty string. * Reading invalid memory with CTRL-W :. * Using free memory using setloclist(). (Dominique Pelle) * Accessing freed memory in :cbuffer. * Accessing freed memory in :lfile. * Warning for unused function without timers feature. * Crash when searching for a sentence. * Test doesn't search for a sentence. Still fails when searching for start of sentence. (Dominique Pelle)- Updated to revision 1390, fixes the following problems * Balloon shows when cursor is in WinBar. * terminal test hangs, executing abcde. (Stucki) * Cannot drag status line or vertical separator of new terminal window. (UncleBill) * MS-Windows: drawing underline, curl and strike-throw is slow, mFallbackDC not properly updated. * Channel test for callback is flaky. * Shift-Insert doesn't always work in MS-Windows console. * Profile log may be truncated halfway a character. * No error when settting 'renderoptions' to an invalid value before starting the GUI. * CTRL-A does not work with an empty line. (Alex) * Window size wrong after maximizing with WinBar. (Lifepillar) * Cursor in terminal not always updated. * Cannot call a dict function in autoloaded dict. * Autoload script sources itself when defining function. * Configure check for selinux does not check for header file. * When recovering a file with "vim -r swapfile" the hit-enter prompt is at the top of the window. * ch_readraw() waits for NL if channel mode is NL. * Get "no write since last change" message if a terminal is open. * Local additions in help skips some files. (joshklod) * Not enough quickfix help; confusing winid. * Python 3.5 is getting old. * Cannot select modified buffers with getbufinfo(). * Wordcount test is old style. * Char not overwritten with ambiguous width char, if the ambiguous char is single width but we reserve double-width space. * getqflist() items are missing if not set, that makes it more difficult to handle the values. * DirectX scrolling can be slow, vertical positioning is off.- Updated to revision 1365, fixes the following problems * Libvterm ANSI colors can not always be recognized from the RGB values. The default color is wrong when t_RB is empty. * The Terminal highlighting doesn't work in a terminal. * Some users don't want to diff with hidden buffers. * Terminal window colors wrong when using Terminal highlighting. * Recovering does not work when swap file ends in .stz. * There is no easy way to get the window position. * When one channel test fails others fail as well.- Update to revision 1358 * Too many changes to list - Fixes CVE-2017-1000382 bsc#1065958 - Refresh patches: * disable-unreliable-tests.patch * vim-7.3-filetype_spec.patch * vim-7.4-disable_lang_no.patch * vim-7.4-highlight_fstab.patch * vim-8.0-ttytype-test.patch- Explicitly require python2-devel- Add disable-unreliable-tests.patch to disable unreliable tests bsc#1054723- Bump priorities so we can upgrade from 12.3- Updated to revision 627, fixes the following problems * Call for requesting color and ambiwidth is too early. (Hirohito Higashi) * "1gd" may hang. * Bracketed paste is still enabled when executing a shell command. (Michael Smith) * Can't run make with several jobs, creating directories has a race condition. * The cursor line number becomes negative when using :z^ in an empty buffer. (neovim #6557) * Building the command table requires Perl. * Running parallel make after distclean fails. (Manuel Ortega) * Get only one quickfix list after :caddbuf. * Using freed memory when resetting 'indentexpr' while evaluating it. (Dominique Pelle) * Can't build when configure choses "install-sh". (Daniel Hahler) * Warning for uninitialized variable. (John Marriott) * :simalt on MS-Windows does not work properly. * Duplicate test case for quickfix. * Cannot set the valid flag with setqflist(). * Moving folded text is sometimes not correct. * Illegal memory access with z= command. (Dominique Pelle) * Fold test hangs on MS-Windows. * Memory leak when executing quickfix tests. * Test_options fails when run in the GUI. * No test for mapping timing out. * Configure check for return value of tgetent is skipped. * job_stop() often assumes the channel will be closed, while the job may not actually be stopped. (Martin Gammelsæter) * :simalt still does not work. * Cannot add a context to locations. * Changes to eval functionality not documented. * If a job writes to a buffer and the user is typing a command, the screen isn't updated. When a message is displayed the changed buffer may cause it to be cleared. (Ramel Eshed) * Duplication of code for adding a list or dict return value. * Build failure when windows feature is missing. * Coverity warning for not checking return value of dict_add(). * Crash when complete() is called after complete_add() in 'completefunc'. (Lifepillar) * Off-by-one error in buffer size computation. * Building with gcc 7.1 yields new warnings. * diff mode is insufficiently tested * test_recover fails on some systems. * No test coverage for :spellrepall. * When gF fails to edit the file the cursor still moves to the found line number. * gF test fails on MS-Windows. * gF test fails still on MS-Windows. * The buffer that quickfix caches for performance may become invalid. (Daniel Hahler) * Cannot set the context for a specified quickfix list. * When creating a bufref, then using :bwipe and :new it might get the same memory and bufref_valid() returns true. * Cannot manipulate other than the current quickfix list. * For some people the hint about quitting is not sufficient. * The screen is redrawn when t_BG is set and used to detect the value for 'background'. * When t_u7 is sent a few characters in the second screen line are overwritten and not redrawn later. (Rastislav Barlik) * Package directories are added to 'runtimepath' only after loading non-package plugins. * The conf filetype detection is done before ftdetect scripts from packages that are added later. * float2nr() is not exactly right. * Using % with :hardcopy wrongly escapes spaces. (Alexey Muranov) * When setting the cterm background with ":hi Normal" the value of 'background' may be set wrongly. * Hardcopy test hangs on MS-Windows. * NFA regex engine handles [0-z] incorrectly. * In the GUI, when a timer uses feedkeys(), it still waits for an event. (Raymond Ko) * Since we only support GTK versions that have it, the ckeck for HAVE_GTK_MULTIHEAD is no longer needed. * The ":stag" command does not respect 'switchbuf'. * Using a text object to select quoted text fails when 'selection' is set to "exclusive". (Guraga) * The message "Invalid range" is used for multiple errors. * Warning for unused variable in tiny build. (Tony Mechelynck) * shellescape() always escapes a newline, which does not work with some shells. (Harm te Hennepe) * In the GUI the cursor may flicker. * When 'wrapscan' is off "gn" does not select the whole pattern when it's the last one in the text. (KeyboardFire)- Extend vimrc with mappings for 8-bit controls key escape sequences- Conflict with old vim versions to fix the upgrade from 12.3 boo#1036583- Updated to revision 566, fixes the following problems * :windo allows for ! but it's not supported. * Undefined behavior when using backslash after empty line. * Not enough test coverage for syntax commands. * Crash when getting the window position in tmux. * Cannot detect Bazel BUILD files on some systems. * Using freed memory in :caddbuf after clearing quickfix list. * Setting nocompatible for the tiny version moves the cursor. - Refresh and re-add vim-8.0-ttytype-test.patch- Updated to revision 559, fixes the following problems * Test_edit causes older xfce4-terminal to close. (Dominique Pelle) * Cppcheck warnings. * Edit test may fail on some systems. * Swap file exists briefly when opening the command window. * Extra line break in verbosefile when using ":echomsg". (Ingo Karkat) * Saving the redo buffer only works one time, resulting in the "." command not working well for a function call inside another function call. * No test for the 8g8 command. * Some etags format tags file use 0x01, breaking the parsing. * The typeahead buffer is reallocated too often. * Toupper and tolower don't work properly for Turkish when 'casemap' is empty. (Bjorn Linse) * Toupper/tolower test with Turkish locale fails on Mac. * Toupper and tolower don't work properly for Turkish when 'casemap' contains "keepascii". (Bjorn Linse) * Toupper/tolower test fails on OSX without Darwin. * Getting the window position fails if both the GUI and term code is built in. * GTK: using static gravities is not useful. * The :ownsyntax command is not tested. * Setting ttytype to xxx does not always fail as expected. - Remove vim-8.0-ttytype-test.patch, fixed upstream.- Update the update-alternatives code- Updated to revision 542, fixes the following problems * ml_get errors in silent Ex mode. (Dominique Pelle) * A large count on a normal command causes trouble. (Dominique Pelle) * There is no way to remove quickfix lists (for testing). * Storing a zero byte from a multi-byte character causes fold text to show up wrong. * Character classes are not well tested. They can differ between platforms. * Using a function pointer instead of the actual function, which we know. * GtkForm handling is outdated. * MS-Windows: when 'clipboard' is "unnamed" yyp does not work in a :global command. * dv} deletes part of a multi-byte character. (Urtica Dioica) * Folds are messed up when 'encodin' is "utf-8". * Coverity complains about possible negative value. * RISC OS support was removed long ago, but one file is still included. * When 'wildmenu' is set and 'wildmode' has "longest" then the first file name is highlighted, even though the text shows the longest match. * Line in test commented out. * Buffer overflow when 'columns' is very big. (Nikolai Pavlov) * Test with long directory name fails on non-unix systems. * Test with long directory name fails on Mac. * Abbreviation doesn't work after backspacing newline. (Hkonrk) * Defaults.vim does not work well with tiny features. (crd477) * Memory leak when exiting from within a user function. * Quickfix window not updated when freeing quickfix stack. * Illegal memory access with :z and large count. * No test for falling back to default term value. * Startup test fails on Mac. * Building unit tests fails. * Compiler warning on MS-Windows. * getpos() can return a negative line number. (haya14busa)- Update spec.skeleton with spec-cleaner- Updated to revision 514, fixes the following problems * Insufficient testing for statusline. * 'makeencoding' missing from the options window. * Git and hg see new files after running tests. (Manuel Ortega) * Options test does not always test everything. * Options test fails or hangs on MS-Windows. * 'cinoptions' cannot set indent for extern block. * "make shadow" creates an invalid link. * Quite a few beeps when running tests. * Clang version not correctly detected. * Some functions are not tested. * Running the options test sometimes resizes the terminal. * The packadd test does not create the symlink correctly and does not test the right thing. * The fnamemodify test changes 'shell' in a way later tests may not be able to use system(). * Using ":%argdel" while the argument list is already empty gives an error. (Pavol Juhas) * Not enough test coverage in Insert mode. * Dead code in #ifdef. * Patch shell command uses double quotes around the argument, which allows for $HOME to be expanded. (Etienne) * Terminal width is set to 80 in test3. * Diffpatch fails when the file name has a quote. * Getpgid is not supported on all systems. * The ";" command does not work after characters with a lower byte that is NUL. * Getting font name does not work on X11. * Some macros are in lower case, which can be confusing. * Part of fold patch accidentally included. * v:progpath is not reliably set. * Some macros are in lower case. * Some macros are in lower case. * Adding fold marker creates new comment. * Compiler warnings for comparing unsigned char with 256 always being true. (Manuel Ortega) * The mode test may hang in Test_mode(). (Michael Soyka) * Typo in MinGW test makefile. * Using :move messes up manual folds. * Potential crash if adding list or dict to dict fails. * Old fix for :move messing up folding no longer needed, now that we have a proper solution. * Can't build on HPUX. * Test 45 hangs on MS-Windows. * If an MS-Windows tests succeeds at first and then fails in a way it does not produce a test.out file it looks like the test succeeded. * Resetting 'compatible' in defaults.vim has unexpected side effects. (David Fishburn) * Can't find executable name on Solaris and FreeBSD. * Off-by-one error in using :move with folding. * There are still a few macros that should be all-caps. * Using g< after :for does not show the right output. (Marcin Szamotulski) * After aborting an Ex command g< does not work. (Marcin Szamotulski) * Compiler warnings on MS-Windows. * Not enough testing for help commands. * Exit callback test sometimes fails. * When a test fails and test.log is created, Test_edit_CTRL_I matches it instead of test1.in. * No test covering arg_all(). * The client-server feature is not tested. * Not enough testing for the client-server feature. * Missing change to main.c. * The client-server test may hang when failing. * Tests use assert_true(0) and assert_false(1) to report errors. * remote_peek() is not tested. * The remote_peek() test fails on MS-Windows. * Unnecessary if statement. * The setbufvar() function may mess up the window layout. (Kay Z.) * Illegal memory access when using :all. (Dominique Pelle) * Using :lhelpgrep with an argument that should fail does not produce an error if the previous :helpgrep worked. * Not all windows commands are tested. * Crash and endless loop when closing windows in a SessionLoadPost autocommand. * The autocmd test hangs on MS-Windows. * Running tests leaves an "xxx" file behind. * Clipboard and "* register is not tested. * Splitting a 'winfixwidth' window vertically makes it one column smaller. (Dominique Pelle) * The quotestar test fails when a required feature is missing. * A failing client-server request can make Vim hang. * Crash with cd command with very long argument. * Build failure with older compiler on MS-Windows. * The quotestar test uses a timer instead of a timeout, thus it cannot be rerun like a flaky test. * Insufficient testing for folding. * Arabic support is not fully tested. * Two autocmd tests are skipped on MS-Windows. * taglist() does not prioritize tags for a buffer. * Quotestar test is still a bit flaky. * On MS-Windows ":!start" does not work as expected. * Coverity complains about possible NULL pointer. * Endless loop in updating folds with 32 bit ints. * Looking up an Ex command is a bit slow. * Failed window split for :stag not handled. (Coverity CID 99204) * Can't build with ANSI C. * Client-server tests fail when $DISPLAY is not set. * Coveralls no longer shows per-file coverage. * No link to codecov.io results. * Typo in link to codecov.io results. * Menuage for skipping client-server tests is unclear. * Check for available characters takes too long. * Getting name of cleared highlight group is wrong. (Matt Wozniski) * Script for creating cmdidxs can be improved.- Disable term=xxx test, does not work with any vim version * vim-8.0-ttytype-test.patch- Update apparmor.vim (taken from AppArmor 2.11) * add support for the "kcm" and "qipcrtr" network keywords * update change_profile rule highlighting- Build default vim without X11 support, use update-alternatives to prefer gvim if installed for X11 support.- Updated to revision 425, fixes the following problems * Packadd test does not clean up symlink. * Packadd test uses wrong directory name. * The E11 error message in the command line window is not translated. * The "zero count" error doesn't have a number. (Hirohito Higashi) * Xfontset and guifontwide are not tested. * Illegal memory access after "vapo". (Dominique Pelle) * Restoring help snapshot accesses freed memory. (Dominique Pelle) * GUI test fails on some systems. * Illegal memory access when 'complete' ends in a backslash. * Can't access b:changedtick from a dict reference. * Functions test fails. * Flags of :substitute not sufficiently tested. * Invalid memory access in :recover command. * :recover test fails on MS-Windows. * Illegal memory access with vi' * Not checking return valud of dict_add(). (Coverity) * When using complete() and typing a character undo is saved after the character was inserted. (Shougo) * Double free when compiled with EXITFREE and setting 'ttytype'. * b:changedtick can be unlocked, even though it has no effect. * Unlet command leaks memory. (Nikolai Pavlov) * islocked('d.changedtick') does not work. * Vim relies on limits.h to be included indirectly, but on Solaris 9 it may not be. (Ben Fritz) * When using CTRL-X CTRL-U inside a comment, the use of the comment leader may not work. (Klement) * When building with a shadow directory on macOS lacks the +clipboard feature. * Redrawing errors with GTK 3. * Not enough test coverage for Perl. * No test for concatenating an empty string that results from out of bounds indexing. * The condition for when a typval needs to be cleared is too complicated. * If [RO] in the status line is translated to a longer string, it is trunctted to 4 bytes. * Test to check that setting termcap key fails sometimes. * Using uninitialized memory when 'isfname' is empty. * Leaking memory when setting 'ttytype'. * Crash when setting 'guicursor' to weird value. * Invalid memory access in C-indent code. * 'number' and 'relativenumber' are not properly tested. * Sometimes VimL is used, which is confusing. * GUI initialisation is not sufficiently tested. * Tests fail on MS-Windows. * Travis is too slow to keep up with patches. * ]s does not move cursor with two spell errors in one line. * Might free a dict item that wasn't allocated. * Build fails with tiny features. * If configure defines _LARGE_FILES some include files are included before it is defined. * Not all options are tested with a range of values. * The 'balloondelay', 'ballooneval' and 'balloonexpr' options are not defined without the +balloon_eval feature. Testing that an option value fails does not work for unsupported options. * Invalid memory access when setting wildchar empty. * Leaking memory when setting v:completed_item. * More options are not always defined. * Build fails without +folding. * Invalid memory access when using :sc in Ex mode. (Dominique Pelle) * The "+ register is not tested. * Size computations in spell file reading are not exactly right. * Possible overflow when reading corrupted undo file. CVE-2017-6349 bsc#1027057 * Another possible overflow when reading corrupted undo file. CVE-2017-6350 bsc#1027053 * CTRL-Z and mouse click use CTRL-O unnecessary. * With 'linebreak' set and 'breakat' includes ">" a double-wide character results in "<<" displayed. * Diff mode is not sufficiently tested. * Warning in tiny build for unused variable. (Tony Mechelynck) * Misplaced #ifdef. (Christ van Willigen) * Timer test failed for no apparent reason. * No tests for arabic. * Tiny build has a problem with generating the options test. * compiler warnings * filtering lines through "cat", without changing the line count, changes manual folds. * Test for arabic does not check what is displayed. * When the window scrolls horizontally when the popup menu is displayed part of it may not be cleared. (Neovim issue #6184) * Arabic support is verbose and not well tested. * GUI test fails with Athena and Motif. * When the same tag appears more than once, the order is unpredictable. (Charles Campbell) * Tabs are not aligned when scrolling horizontally and a Tab doesn't fit. (Axel Bender) * Testing the + register fails with Motif. * 'balloonexpr' only works synchronously. * Cannot build with the viminfo feature but without the eval feature. * Illegal memory access with "t". * Crash when using balloon_show() when not supported. (Hirohito Higashi) * Some tests have a one second delay. * Test fails with missing balloon feature. * :map completion does not have . (Dominique Pelle) * GUI tests may fail. * Not enough testing for quickfix. * v:progpath may become invalid after ":cd". * The arabic shaping code is verbose. * Filtering folds with marker method not tested. * Updating folds does not work properly when inserting a file and a few other situations. * set_progpath is defined but not always used * Newer gettext/iconv library has extra dll file. * We can't change the case in menu entries, it breaks translations. * Menu test fails on MS-Windows. * Menu test fails on MS-Windows using gvim. * Balloon eval is not tested. * Balloon test fails on MS-Windows. * Setting v:progpath is not quite right. * Test for the clipboard fails sometimes. * ASAN logs are disabled and don't cause a failure. * Test for v:progpath fails on MS-Windows. * When running :make the output may be in the system encoding, different from 'encoding'. * Diff mode is displayed wrong when adding a line at the end of a buffer. * Python test fails with Python 3.6. * The effect of adding "#" to 'cinoptions' is not always removed. * Compiler warnings on MS-Windows. (Ajit Thakkar) * Build errors when building without folding. - Drop test87-python36.patch, fixed upstream.- Add test87-python36.patch to update test results for Python 3.6- Updated to revision 324, fixes the following problems * When a json message arrives in pieces, the start is dropped and the decoding fails. * Not enough testing for GUI functionality. * getcmdtype(), getcmdpos() and getcmdline() are not tested. * ":help :[range]" does not work. (Tony Mechelynck) * ":help z?" does not work. (Pavol Juhas) * No test for setting 'guifont'. * Small mistake in 7x13 font name. * Insert mode completion does not respect "start" in 'backspace'. * Warning for unused variable with small build. * When using the tiny version trying to load the matchit plugin gives an error. On MS-Windows some default mappings fail. * Possible overflow with spell file where the tree length is corrupted. CVE-2017-5953 bsc#1024724 * When running the command line tests there is a one second wait. * Illegal memory access with "1;y".- Updated to revision 311, fixes the following problems * Double free on exit when using a closure. (James McCoy) * Ex command range with repeated search does not work. (Bruce DeVisser) * When the GUI window is resized Vim does not always take over the new size. (Luchr) * Cannot stop diffing hidden buffers. (Daniel Hahler) * No tests for ":set completion" and various errors of the :set command. * Cannot set terminal key codes with :let. * Bracketed paste does not work in Visual mode. * Assign test fails in the GUI. * Invalid memory access when option has duplicate flag. * mode() not sufficiently tested. * Asan detects a memory error when EXITFREE is defined. (Dominique Pelle) * When using a symbolic link, the package path will not be inserted at the right position in 'runtimepath'. (Dugan Chen, Norio Takagi) * Cannot use an empty key in json. * Not enough testing for GUI functionality. * Linebreak tests are old style.- Updated to revision 296, fixes the following problems * Jumping to a tag that is a static item in the current file fails. (Kazunobu Kuriyama) * The test for :profile is slow and does not work on MS-Windows. * On MS-Windows the system() test skips a few parts. * Some syntax arguments take effect even after "if 0". (Taylor Venable) * Warning for an unused parameter when the libcall feature is disabled. Warning for a function type cast when compiling with -pedantic. * Some syntax arguments are not tested. * When completing a group name for a highlight or syntax command cleared groups are included. * No test for invalid syntax group name. * Order of complication flags is sometimes wrong. * Compiler warns for uninitialized variable. (Tony Mechelynck) * After :undojoin some commands don't work properly, such as :redo. (Matthew Malcomson) * Test coverage for :retab insufficient. * Leaking file descriptor when system() cannot find the buffer. (Coverity) * Internally used commands for CTRL-Z and mouse click end up in history. (Matthew Malcomson) * When using :substitute with the "c" flag and 'cursorbind' is set the cursor is not updated in other windows. * Vim does not support bracketed paste, as implemented by xterm and other terminals. * Build fails if the multi-byte feature is disabled. * The buffer used to store a key name theoreticaly could be too small. (Coverity) * The Netbeans "specialKeys" command does not check if the argument fits in the buffer. (Coverity) * Leaking memory when syntax cluster id is unknown. (Coverity) * When a Cscope line contains CTRL-L a NULL pointer may be used. (Coverity) * When decoding JSON with a JS style object the JSON test may use a NULL pointer. (Coverity) * Build fails without the cscope feature. * No command line completion for :cexpr, :cgetexpr, :caddexpr, etc. * Ubsan reports errors for integer overflow. * Completion for :match does not show "none" and other missing highlight names. * Checking if PROTO is defined inside a function has no effect. * When a multi-byte character ends in a zero byte, putting blockwise text puts it before the character instead of after it. * Coverity gets confused by the flags passed to find_tags() and warnts for an uninitialized variable. * When 'fileformats' is changed in a BufReadPre auto command, it does not take effect in readfile(). (Gary Johnson) * When a block is visually selected and put is used on the end of the selection only one line is changed. * The test for patch 8.0.0224 misses the CR characters and passes even without the fix. (Christian Brabandt) * Crash when 'fileformat' is forced to "dos" and the first line in the file is empty and does not have a CR character. * When pasting test in an xterm on the command line it is surrounded by and . (Johannes Kaltenbach) * When freeing a buffer the local value of the 'formatprg' option is not cleared. * When using bracketed paste line breaks are not respected. * There are no tests for bracketed paste mode. * Pasting in Insert mode does not work when bracketed paste is used and 'esckeys' is off. * The paste test fails if the GUI is being used. * When several lines are visually selected and one of them is short, using put may cause a crash. (Axel Bender) * Memory leak detected when running tests for diff mode. * Gcc complains that a variable may be used uninitialized. Confusion between variable and label name. (John Marriott) * When setting wildoptions=tagfile the completion context is not set correctly. (desjardins) * When using bracketed paste autoindent causes indent to be increased. * The address sanitizer sometimes finds errors, but it needs to be run manually. * The clang build on CI fails with one configuration. * Vim defines a mch_memmove() function but it doesn't work, thus is always unused. * Completion of user defined functions is not covered by tests. * When making a character lower case with tolower() changes the byte cound, it is not made lower case. * When the user sets t_BE empty after startup to disable bracketed paste, this has no direct effect. * The generated zh_CN.cp936.po message file is not encoded properly. * Compiler warnings for int to pointer conversion. * Under some circumstances, one needs to type Ctrl-N or Ctrl-P twice to have a menu entry selected. (Lifepillar) * vim_strcat() cannot handle overlapping arguments. * When two submits happen quick after each other, the tests for the first one may error out. * When virtcol() gets a column that is not the first byte of a multi-byte character the result is unpredictable. (Christian Ludwig) * It is not so easy to write a script that works with both Python 2 and Python 3, even when the Python code works with both. * Characters below 256 that are not one byte are not always recognized as word characters. * When creating a session when winminheight is 2 or larger and loading that session gives an error. * When using an assert function one can either specify a message or get a message about what failed, not both. * When calling setpos() with a buffer argument it often is ignored. (Matthew Malcomson) * Tests fail because some changes were not included. * The keyword test file is not included in the archive. * The keyword test file is not included in the archive. * Tab commands do not handle count correctly. (Ken Hamada) * Build fails with tiny features. * Not enough test coverage for eval functions. * Farsi support is barely tested. * Farsi support is not tested enough. * Memory error reported by ubsan, probably for using the string returned by execute(). * May get ml_get error when :pydo deletes lines or switches to another buffer. (Nikolai Pavlov, issue #1421) * Compiler warning for using uninitialized variable. * A channel test sometimes fails on Mac. * May get ml_get error when :luado deletes lines or switches to another buffer. (Nikolai Pavlov, issue #1421) * May get ml_get error when :perldo deletes lines or switches to another buffer. (Nikolai Pavlov, issue #1421) * May get ml_get error when :rubydo deletes lines or switches to another buffer. (Nikolai Pavlov, issue #1421) * May get ml_get error when :tcldo deletes lines or switches to another buffer. (Nikolai Pavlov, closes #1421) * Crash on exit is not detected when running tests. * Dead code detected by Coverity when not using gnome. * When update_single_line() is called recursively, or another screen update happens while it is busy, errors may occur. * When checking for CTRL-C typed the GUI may detect a screen resize and redraw the screen, causing trouble. * Checking for FEAT_GUI_GNOME inside GTK 3 code is unnecessary. * The GUI test may trigger fontconfig and take a long time. * GUI test fails on MS-Windows. * With MSVC 2015 the dll name is vcruntime140.dll. * On MS-Windows setting an environment variable with multi-byte strings does not work well. * MS-Windows files are still using ARGSUSED while most other files have UNUSED. * When doing a Visual selection and using "I" to go to insert mode, CTRL-O needs to be used twice to go to Normal mode. (Coacher) * The return value of mode() does not indicate that completion is active in Replace and Insert mode. (Zhen-Huan (Kenny) Hu) * The Test_collapse_buffers() test failed once, looks like it is flaky. * Tests fail with tiny build on Unix. * When concealing is active and the screen is resized in the GUI it is not immediately redrawn. * Cannot access the arguments of the current function in debug mode. (Luc Hermitte) * Errors reported while running tests. * No test for "ga" and :ascii. * If a wide character doesn't fit at the end of the screen line, and the line doesn't fit on the screen, then the cursor position may be wrong. (anliting) * Visual block insertion does not insert in all lines. * The stat test is a bit slow. * Some tests have a one or three second wait. * Argument list is not stored correctly in a session file. (lgpasquale) * test_viml hangs. * Bracketed paste can only append, not insert.- Improve summary bsc#1021040- Add missing %changelog to spec.skeleton- Updated to revision 194, fixes the following problems * When compiling with EBCDIC defined the build fails. (Yaroslav Kuzmin) * For completion "locale -a" is executed on MS-Windows, even though it most likely won't work. * Setting language in gvim on MS-Windows does not work when libintl.dll is dynamically linked with msvcrt.dll. * Using :change in between :function and :endfunction fails. * When opening a buffer on a directory and inside a try/catch then the BufEnter event is not triggered. * test_command_count may fail when a previous test interferes, seen on MS-Windows. * 'formatprg' is a global option but the value may depend on the type of buffer. (Sung Pae) * Error E937 is used both for duplicate key in JSON and for trying to delete a buffer that is in use. * When 'cursorbind' and 'cursorcolumn' are both on, the column highlignt in non-current windows is wrong. * When 'cursorbind' and 'cursorline' are set, but 'cursorcolumn' is not, then the cursor line highlighting is not updated. (Hirohito Higashi) * Ubsan warns for using a pointer that is not aligned. * When in Ex mode and an error is caught by try-catch, Vim still exits with a non-zero exit code. * The system() test fails on MS-Windows. * The error message from assert_notequal() is confusing. * Building with a new Ruby version fails. * Using NOT_VALID for redraw_later() to update the cursor line/column highlighting is not efficient. * There are no tests for the :profile command. * Detecting duplicate tags uses a slow linear search. * Some systems do not have ruby_sysinit(), causing the build to fail. * Build fails with tiny features. * Accidentally removed #ifdef. * Profile tests fails if total and self time are equal.- Updated to revision 172, fixes the following problems * When a C preprocessor statement has two line continuations the following line does not have the right indent. (Ken Takata) * ":earlier" and ":later" do not work after startup or reading the undo file. * When the pattern of :filter does not have a separator then completion of the command fails. * To pass buffer content to system() and systemlist() one has to first create a string or list. * Running the channel test creates channellog. * system() test fails on MS-Windows. * system() test fails on OS/X. * When sorting zero elements a NULL pointer is passed to qsort(), which ubsan warns for. * Several float functions are not covered by tests. * No command line completion for ":syntax spell" and ":syntax sync". * On MS-Windows some float functions return a different value when passed unusual values. strtod() doesn't work for "inf" and "nan". * Using a NULL pointer when using feedkeys() to trigger drawing a tabline. * EMSG() is sometimes used for internal errors. * Build fails when using small features. * Build error on Fedora 23 with small features and gnome2. * Ruby 2.4 no longer supports rb_cFixnum. * Outdated and misplaced comments. * Ubsan warns for integer overflow. * JSON with a duplicate key gives an internal error. (Lcd) * str2nr() and str2float() do not always work with negative values. * Still some float functionality is not covered by tests. * For complicated string json_decode() may run out of stack space. * Channel test fails for using freed memory. * JS style JSON does not support single quotes. * The command selected in the command line window is not executed. (Andrey Starodubtsev)- Updated to revision 147, fixes the following problems * Not enough test coverage for syntax commands. * Test fails because of using :finish. * "2;'(" causes ml_get errors in an empty buffer. * Null pointer access reported by UBsan. * An address relative to the current line, ":.,+3y", does not work properly on a closed fold. * When using indent folding and changing indent the wrong fold is opened. * When 'maxfuncdepth' is set above 200 the nesting is limited to 200. * Small build fails. * Warning for unused argument. * Pasting inserted text in Visual mode does not work properly. * Nested function test fails on AppVeyor. * Normal colors are wrong with 'termguicolors'. * Line number of current buffer in getbufinfo() is wrong. * When using MSVC the GvimExt directory is cleaned twice. * Running tests on MS-Windows is a little bit noisy. * When using 'termguicolors' on MS-Windows the RGB definition causes the colors to be wrong. * searchpair() does not work when 'magic' is off.- Updated to revision 130, fixes the following problems * Not enough testing for entering Ex commands. * Display problem with 'foldcolumn' and a wide character. (esiegerman) * Cancelling completion still inserts text when formatting is done for 'textwidth'. (lacygoill) * Display test fails on MS-Windows. * Parallel make still doesn't work. (Lewis Muir) * Configure uses "ushort" while the Vim code doesn't.- Updated to revision 124, fixes the following problems * May not process channel readahead. (skywind) * Value of 'thesaurus' option not checked properly. * When using ch_read() with zero timeout, can't tell the difference between reading an empty line and nothing available. * Cannot use a semicolon in 'backupext'. (Jeff) * When reading channel output in a timer, messages may go missing. (Skywind) * The channel "drop" option is not tested. * Still checking if memcmp() exists while every system should have it now. * Drop command doesn't use existing window. * The :history command is not tested. * Tests 92 and 93 are old style. * When reading English help and using CTRl-] the language from 'helplang' is used. * Parallel make fails. (J. Lewis Muir) * No test for using CTRL-R on the command line. * Setting 'cursorline' changes the curswant column. (Daniel Hahler) * Internal error for assert_inrange(1, 1).- Updated to revision 101, fixes the following problems * When the input or output is not a tty Vim appears to hang. * When a channel callback consumes a lot of time Vim becomes unresponsive. (skywind) * Can't build on MS-Windows. * Popup menu always appears above the cursor when it is in the lower half of the screen. (Matt Gardner) * Options that are a file name may contain non-filename characters. * Some options are not strictly checked. * (after 8.0.0101) cannot set 'dictionary' to a path- Updated to revision 95, fixes the following problems * Problems with GTK 3.22.2 fixed in 3.22.4.- Export "TERM=linux" before running the test suite: vim does quite an extensive test relying on a full fledged terminal inside OBS, stdio is redirected to a serial console (where the build log is being recorded/extracted. Systemd set non-local tty by default to vt220 in upcoming versions (which the vi test suite fails to run on; this should be considered a vim bug).- Updated to revision 92, fixes the following problems * Using NUL instead of NULL. * Crash when using the preview window from an unnamed buffer. (lifepillar) * On Windows job_stop() stops cmd.exe, not the processes it runs. (Linwei) * When a match ends in part of concealed text highlighting, it might mess up concealing by resetting prev_syntax_id. * An exiting job is detected with a large latency. * New code for job_stop() breaks channel test on AppVeyor. * Conceal test passes even without the bug fix. * No test for what 8.0.0047 fixes. * On Windows job_stop() stops cmd.exe, not the processes it runs. (Linwei) * Minor comment and style deficiencies. * When setting 'filetype' there is no check for a valid name. * Tests fail without the 'keymap' features. * Positioning of the popup menu is not good. * Vim does not build on VMS systems. * When using an Ex command for 'keywordprg' it is escaped as with a shell command. (Romain Lafourcade) * Compiler warning for unused variable. * No digraph for HORIZONTAL ELLIPSIS. * Compiler warning for comparing with unsigned. (Zoltan Arpadffy) * Normal test fails on MS-Windows. * Compiler warning for unused function in tiny build. (Tony Mechelynck) * when calling an operator function when 'linebreak' is set, it is internally reset before calling the operator function. * VMS has a problem with infinity. * Checking did_throw after executing autocommands is wrong. (Daniel Hahler) * Compiler warning for self-comparison. * Tests referred in Makefile that no longer exist. * Exit value from a shell command is wrong. (Hexchain Tong) * MS-Windows: Crash with long font name. (Henry Hu) * More comparisons between firstwin and lastwin. * Cannot make Vim fail on an internal error. * Using number for exception type lacks type checking. * Channel log has double parens ()(). * The GUI code is not tested by Travis. * Accessing freed memory in quickfix. * Accessing freed memory in quickfix. (Domenique Pelle) * The OS X build fails on Travis. * Inconsistent function names. * Extension for configure should be ".ac". * Using freed memory with win_getid(). (Domenique Pelle) * Using freed memory when adding to a quickfix list. (Domenique Pelle) * Using freed memory with recursive function call. (Dominique Pelle) * Cannot add a comment after ":hide". (Norio Takagi) * When the channel callback gets job info the job may already have been deleted. (lifepillar) * When a test fails in Setup or Teardown the problem is not reported. * Various problems with GTK 3.22.2. * Cursor moved after last character when using 'breakindent'. * Test_help_complete sometimes fails in MS-Windows console. * C indenting does not support nested namespaces that C++ 17 has. - Drop bsc-1008800.patch, fixed upstream.- Add bsc-1008800.patch to fix gvim rendering with recent gtk+ update. Fixes bsc#1008800. Patch by Jan Alexander Steffens.- Updated to revision 45, fixes the following problems * Cannot use overlapping positions with matchaddpos(). * No completion for ":messages". * Order of matches for 'omnifunc' is messed up. (Danny Su) * Detecting that a job has finished may take a while. * Get E924 when switching tabs. * OPEN_CHR_FILES not defined for FreeBSD using Debian userland files. * When Vim 8 reads an old viminfo and exits, the next time marks are not read from viminfo. (Ned Batchelder) * Whole line highlighting with matchaddpos() does not work. * When using Insert mode completion but not actually inserting anything an undo item is still created. (Tommy Allen) * When using Insert mode completion with 'completeopt' containing "noinsert" change is not saved for undo. (Tommy Allen) * When using Insert mode completion with 'completeopt' containing "noinsert" with CTRL-N the change is not saved for undo. (Tommy Allen) * In diff mode the cursor may end up below the last line, resulting in an ml_get error. * Calling job_stop() right after job_start() does not work.- Updated to revision 32, fixes the following problems * getwinvar() returns wrong Value of boolean and number options, especially non big endian systems. (James McCoy) * A string argument for function() that is not a function name results in an error message with NULL. (Christian Brabandt) * Netbeans test fails with Python 3. (Jonathonf) * ":lb" is interpreted as ":lbottom" while the documentation says it means ":lbuffer". * Vim 7.4 is still mentioned in a few places. * Popup complete test is disabled. * Unnecessary workaround for AppVeyor. * Crash when editing file that starts with crypt yeader. (igor2x) * On OSX Test_pipe_through_sort_all() sometimes fails. * Typos in comments. * Missing comma in list. * Crypt tests are old style. * Can't tell which part of a channel has "buffered" status. * Build fails. * Cannot get the number of the current quickfix or location list. * When using ":sleep" channel input is not handled. * Test_command_count is old style. * The regexp engines are not reentrant. * In the GUI when redrawing the cursor it may be on the second half of a double byte character. * If a channel in NL mode is missing the NL at the end the remaining characters are dropped. * "gd" and "gD" may find a match in a comment or string. * When the netbeans channel closes, "DETACH" is put in the output part. (Ozaki Kiichi) * Inconsistent use of spaces vs tabs in gd test. * Error format with %W, %C and %Z does not work. (Gerd Wachsmuth) * A channel is closed when reading on stderr or stdout fails, but there may still be something to read on another part. * Superfluous semicolons. * Code for MS-Windows is complicated because of the exceptions for old systems. * Mouse mode is not automatically detected for tmux. * After ":bwipeout" 'fileformat' is not set to the right default.- Updated to revision 3, fixes the following problems * getwinvar() returns wrong Value of boolean and number options, especially non big endian systems. (James McCoy)- Updated to revision 2, fixes the following problems * Intro screen still mentions version7. (Paul) * The netrw plugin does not work.- Update to version 8.0 * Crash on exit when EXITFREE is defined. (Dominique Pelle) * Valgrind reports using uninitialzed memory. (Dominique Pelle) * Test 86 and 87 fail with some version of Python. * Netbeans test fails when run from unpacked MS-Windows sources. * Netbeans test fails in shadow directory. * Not enough test coverage for Normal mode commands. * The example that explains nested backreferences does not work properly with the new regexp engine. (Harm te Hennepe) * Regexp fails to match when using "\>\)\?". (Ramel) * Reading past end of line when using previous substitute pattern. (Dominique Pelle) * Attempt to read history entry while not initialized. * Compiler warnings with Solaris Studio when using GTK3. * Memory leak in timer_start(). * Invalid memory access when formatting. (Dominique Pelle) * Checking for last_timer_id to overflow is not reliable. (Ozaki Kiichi) * Illegal memory access with ":1@". (Dominique Pelle) * Superfluous function prototypes. * Sort test sometimes fails. * Needless line break. Confusing directory name. * MS-Windows gvim.exe does not have DirectX support. * Test runner misses a comma.- Updated to revision 2347, fixes the following problems * submatch() does not check for a valid argument. * The 'langnoremap' option leads to double negatives. And it does not work for the last character of a mapping. * Can't use "." and "$" with ":tab". * With SGR mouse reporting (suckless terminal) the mouse release and scroll up/down is confused. * Warning for missing declaration of skip_vimgrep_pat(). (John Marriott) * Tests using the sleep time can be flaky. * Timer test sometimes fails. * Timer test sometimes fails. * Warning for assigning negative value to unsigned. (Danek Duvall) * Adding pattern to ":oldfiles" is not a generic solution. * Filter test fails. * Oldfiles test fails. * Tiny build fails. (Tony Mechelynck) * When cancelling the :ptjump prompt a preview window is opened for a following command. * Missing colon in error message. * Some error message cannot be translated. * In rare cases diffing 4 buffers is not enough. * Compiler warnings for signed/unsigned in expression. * Check for Windows 3.1 will always return false. (Christian Brabandt) * Compiler warnings in MzScheme code. * The script that checks translations can't handle plurals. * Coverity complains about null pointer check. * Coverity complains about not checking for NULL. * Two JSON messages are sent without a separator. * With 'incsearch' can only see the next match. * Channel test is flaky. * Build fails with small features. * Fail to read register content from viminfo if it is 438 characters long. (John Chen) * :filter does not work for many commands. Can only get matching messages. * When adding entries to an empty quickfix list the title is reset. * printf() isn't tested much. * printf() test fails on Windows. "-inf" is not used. * Build fails on MS-Windows. * Using CTRL-N and CTRL-P for incsearch shadows completion keys. * Using 'hlsearch' highlighting instead of matchpos if there is no search match. * Insufficient testing for NUL bytes on a raw channel. * Netbeans test doesn't read settings from file. * getbufinfo(), getwininfo() and gettabinfo() are inefficient. * getwininfo() and getbufinfo() are inefficient. * Command line completion on "find **/filename" drops sub-directory. * ":diffoff!" does not remove filler lines. * Command line test fails on Windows when run twice. * Memory leak in getbufinfo() when there is a sign. (Dominique Pelle) * New users have no idea of the 'scrolloff' option. * Starting diff mode with the cursor in the last line might end up only showing one closed fold. (John Beckett) * printf() doesn't handle infinity float values correctly. * Timer test fails sometimes. * When a child process is very fast waiting 10 msec for it is noticeable. (Ramel Eshed) * Part of ":oldfiles" command isn't cleared. (Lifepillar) * Comment in scope header file is outdated. (KillTheMule) * Generated files are outdated. * The tee program isn't included. Makefile contains build instructions that don't work. * The callback passed to ch_sendraw() is not used. * MS-Windows build instructions are clumsy. "dosbin" doesn't build. * When installing and $DESTDIR is set the icons probably won't be installed. * Compiler warning in tiny build. (Tony Mechelynck) * printf() handles floats wrong when there is a sign. * Not all systems understand %F in printf(). * Modelines in source code are inconsistent. * Sign test fails on MS-Windows when using the distributed zip archives. * Cscope test fails. * No tests for :undolist and "U" command. * When starting a job that reads from a buffer and reaching the end, the job hangs. * It is not possible to close the "in" part of a channel. * QuickFixCmdPre and QuickFixCmdPost autocommands are not always triggered. * Get warning for deleting autocommand group when the autocommand using the group is scheduled for deletion. (Pavol Juhas) * MS-Windows: some files remain after testing. * Default interface versions for MS-Windows are outdated. * When using "is" the mode isn't always updated. * In a timer callback the timer itself can't be found or stopped. (Thinca) * Marks, writefile and nested function tests are old style. * Default value for 'langremap' is wrong. * Several tests are old style. * Old charsearch test still listed in Makefile. * Crash when doing tabnext in a BufUnload autocmd. (Dominique Pelle) * Accessing freed memory when a timer does not repeat. * Appveyor 64 bit build still using Python 3.4 * Crash when autocommand moves to another tab. (Dominique Pelle) * Crash when deleting an augroup and listing an autocommand. (Dominique Pelle) * No error when deleting an augroup while it's the current one. * Insufficient testing for Normal mode commands. * Channel sort test is flaky. * Normal mode tests fail on MS-Windows. * When 'incsearch' is not set CTRL-T and CTRL-G are not inserted as before. * No way for a system wide vimrc to stop loading defaults.vim. (Christian Hesse) * Redraw problem when using 'incsearch'. * When a test is commented out we forget about it. * Access memory beyond the end of the line. (Dominique Pelle) * Using freed memory when using 'formatexpr'. (Dominique Pelle) * Crash when editing a new buffer and BufUnload autocommand wipes out the new buffer. (Norio Takagi) * Tiny build fails. * Illegal memory access when Visual selection starts in invalid position. (Dominique Pelle) * Freeing a variable that is on the stack. * Crash when BufWinLeave autocmd goes to another tab page. (Hirohito Higashi) * Error for min() and max() contains %s. (Nikolay Pavlov) * Coverity complains about not checking curwin to be NULL. * Using CTRL-X CTRL-V to complete a command line from Insert mode does not work after entering an expression on the command line. * Crash when stop_timer() is called in a callback of a callback. Vim hangs when the timer callback uses too much time. * Outdated comments in test. * On MS-Windows test_getcwd leaves Xtopdir behind. * taglist() is slow. (Luc Hermitte) * Running normal mode tests leave a couple of files behind. (Yegappan Lakshmanan) * taglist() is still slow. (Luc Hermitte) * Can't build with small features. (John Marriott) * Tab page test fails when run as fake root. * MS-Windows: Building with Ruby uses old version. * Tiny things. Test doesn't clean up properly. * Typo in MS-Windows build script. * Too many old style tests. * The "Reading from channel output..." message can be unwanted. Appending to a buffer leaves an empty first line behind. * For MinGW RUBY_API_VER_LONG isn't set correctly. Many default version numbers are outdated. * Autocommand test fails when run directly, passes when run as part of test_alot.- Updated to revision 2334, fixes the following problems * No tests for :undolist and "U" command. * When starting a job that reads from a buffer and reaching the end, the job hangs. * It is not possible to close the "in" part of a channel. * QuickFixCmdPre and QuickFixCmdPost autocommands are not always triggered. * Get warning for deleting autocommand group when the autocommand using the group is scheduled for deletion. (Pavol Juhas) * MS-Windows: some files remain after testing. * Default interface versions for MS-Windows are outdated. * When using "is" the mode isn't always updated. * In a timer callback the timer itself can't be found or stopped. (Thinca) * Marks, writefile and nested function tests are old style. * Default value for 'langremap' is wrong. * Several tests are old style. * Old charsearch test still listed in Makefile. * Crash when doing tabnext in a BufUnload autocmd. (Dominique Pelle) * Accessing freed memory when a timer does not repeat. * Appveyor 64 bit build still using Python 3.4 * Crash when autocommand moves to another tab. (Dominique Pelle) * Crash when deleting an augroup and listing an autocommand. (Dominique Pelle) * No error when deleting an augroup while it's the current one. * Insufficient testing for Normal mode commands. * Channel sort test is flaky. * Normal mode tests fail on MS-Windows. * When 'incsearch' is not set CTRL-T and CTRL-G are not inserted as before. * No way for a system wide vimrc to stop loading defaults.vim. (Christian Hesse) * Redraw problem when using 'incsearch'. * When a test is commented out we forget about it. * Access memory beyond the end of the line. (Dominique Pelle) * Using freed memory when using 'formatexpr'. (Dominique Pelle) * Crash when editing a new buffer and BufUnload autocommand wipes out the new buffer. (Norio Takagi) * Tiny build fails. * Illegal memory access when Visual selection starts in invalid position. (Dominique Pelle) * Freeing a variable that is on the stack. * Crash when BufWinLeave autocmd goes to another tab page. (Hirohito Higashi) * Error for min() and max() contains %s. (Nikolay Pavlov) * Coverity complains about not checking curwin to be NULL. * Using CTRL-X CTRL-V to complete a command line from Insert mode does not work after entering an expression on the command line. * Crash when stop_timer() is called in a callback of a callback. Vim hangs when the timer callback uses too much time. * Outdated comments in test. * On MS-Windows test_getcwd leaves Xtopdir behind.- Updated to revision 2295, fixes the following problems * The field names used by getbufinfo(), gettabinfo() and getwininfo() are not consistent. * Tab page tests are old style. * Test files have inconsistant modelines. * Startup test fails on Solaris. * There is no equivalent of 'smartcase' for a tag search. * ":oldfiles" output is a very long list. * The default ttimeoutlen is very long. * Crash when using funcref() with invalid name. (Dominique Pelle) * Can't build with +eval but without +quickfix. (John Marriott) * submatch() does not check for a valid argument. * The 'langnoremap' option leads to double negatives. And it does not work for the last character of a mapping. * Can't use "." and "$" with ":tab". * With SGR mouse reporting (suckless terminal) the mouse release and scroll up/down is confused. * Warning for missing declaration of skip_vimgrep_pat(). (John Marriott) * Tests using the sleep time can be flaky. * Timer test sometimes fails. * Timer test sometimes fails. * Warning for assigning negative value to unsigned. (Danek Duvall) * Adding pattern to ":oldfiles" is not a generic solution. * Filter test fails. * Oldfiles test fails. * Tiny build fails. (Tony Mechelynck) * When cancelling the :ptjump prompt a preview window is opened for a following command. * Missing colon in error message. * Some error message cannot be translated. * In rare cases diffing 4 buffers is not enough. * Compiler warnings for signed/unsigned in expression. * Check for Windows 3.1 will always return false. (Christian Brabandt) * Compiler warnings in MzScheme code. * The script that checks translations can't handle plurals. * Coverity complains about null pointer check. * Coverity complains about not checking for NULL. * Two JSON messages are sent without a separator. * With 'incsearch' can only see the next match. * Channel test is flaky. * Build fails with small features. * Fail to read register content from viminfo if it is 438 characters long. (John Chen) * :filter does not work for many commands. Can only get matching messages. * When adding entries to an empty quickfix list the title is reset. * printf() isn't tested much. * printf() test fails on Windows. "-inf" is not used. * Build fails on MS-Windows. * Using CTRL-N and CTRL-P for incsearch shadows completion keys. * Using 'hlsearch' highlighting instead of matchpos if there is no search match. * Insufficient testing for NUL bytes on a raw channel. * Netbeans test doesn't read settings from file. * getbufinfo(), getwininfo() and gettabinfo() are inefficient. * getwininfo() and getbufinfo() are inefficient. * Command line completion on "find **/filename" drops sub-directory. * ":diffoff!" does not remove filler lines. * Command line test fails on Windows when run twice. * Memory leak in getbufinfo() when there is a sign. (Dominique Pelle) * New users have no idea of the 'scrolloff' option. * Starting diff mode with the cursor in the last line might end up only showing one closed fold. (John Beckett) * printf() doesn't handle infinity float values correctly. * Timer test fails sometimes. * When a child process is very fast waiting 10 msec for it is noticeable. (Ramel Eshed) * Part of ":oldfiles" command isn't cleared. (Lifepillar) * Comment in scope header file is outdated. (KillTheMule) * Generated files are outdated. * The tee program isn't included. Makefile contains build instructions that don't work. * The callback passed to ch_sendraw() is not used. * MS-Windows build instructions are clumsy. "dosbin" doesn't build. * When installing and $DESTDIR is set the icons probably won't be installed. * Compiler warning in tiny build. (Tony Mechelynck) * printf() handles floats wrong when there is a sign. * Not all systems understand %F in printf(). * Modelines in source code are inconsistent. * Sign test fails on MS-Windows when using the distributed zip archives. * Cscope test fails.- Updated to revision 2225, fixes the following problems * When using matchaddpos() a character after the end of the line can be highlighted. * Can't build with +timers when +digraph is not included. * Recursive call to substitute gets stuck in sandbox. * printf() gives an error when the argument for %s is not a string. * printf() does not support binary format. * Sourcing a script where a character has 0x80 as a second byte does not work. * Buffer overflow when using latin1 character with feedkeys(). * Compiler warnings with older compiler and 64 bit numbers. * Crash when placing a sign in a deleted buffer.- Updated to revision 2216, fixes the following problems * The qf_init_ext() function is too big. * Compiler warning for initializing a struct. * There is still code and help for unsupported systems. * There is no way to get a list of the error lists. * When using ":vimgrep" may end up with duplicate buffers. * No proper testing of trunc_string(). * Coverage report is messed up by the unittests. * Can't run scripttests in the top directory. * Wrong part of #ifdef removed. * eval.c is too big. * Build fails. * eval.c is too big. * eval.c is too big. * Non-Unix builds fail. * Wrong file name. * qf_init_ext() is too big. * Using dummy variable to compute struct member offset. * eval.c is still too big. * Coverity warns for possible buffer overflow. * Compiler warns for uninitialzed variable. (John Marriott) * getcompletion() not well tested. * Compiler warning for char/char_u conversion. * Not all arguments of trunc_string() are tested. Memory access error when running the message tests. * spell.c is too big. * Missing change to include file. * The return value of type() is difficult to use. * substitute() does not support a Funcref argument. * rgb.txt is read for every color name. * One more place using a dummy variable. * No autocommand event to initialize a window or tab page. * Syntax error when dict has '>' key. * Cannot update 'tabline' when a tab was closed. * Running checks in po diretory fails. * Netbeans test fails on non-Unix systems. * When using PERROR() on some systems assert_fails() does not see the error. * Line numbers in the error list are not always adjusted. * Not much test coverage for digraphs. * Coverity complains about not restoring a value. * New digraph test makes testing hang. * Digraph tests fails on some systems. * Using the system default encoding makes tests unpredictable. * Digraph code test coverage is still low. * Keymap test fails with normal features. * Color handling of X11 GUIs is too complicated. * Using submatch() in a lambda passed to substitute() is verbose. * Coverity reports a resource leak when out of memory. * GTK 3 build fails with older GTK version. * Netbeans test fails once in a while. Leaving log file behind. * The color allocation in X11 is overly complicated. * Man test fails when run with the GUI. * Lambda functions show up with completion. * Warning from 64 bit compiler. * Text object tests are old style. * When a keymap is active only "(lang)" is displayed. * "cgn" and "dgn" do not work correctly with a single character match and the replacement includes the searched pattern. * Looping over windows, buffers and tab pages is inconsistant. * Tiny build with GUI fails. * Can't have "augroup END" right after ":au!". * Code duplication when unreferencing a function. * Configure reports default features to be "normal" while it is "huge". * Clang warns about missing field in initializer. * Misplaced equal sign. * Netbeans test is flaky. * Setting 'display' to "lastline" is a drastic change, while omitting it results in lots of "@" lines. * When there is an CmdUndefined autocmd then the error for a missing command is E464 instead of E492. (Manuel Ortega) * Defaults are very conservative. * getcompletion(.., 'dir') returns a match with trailing "*" when there are no matches. * Test for undo is flaky. * Tiny build fails. * Loading defaults.vim with -C argument. * The default vimrc for Windows is very conservative. * Deleting an augroup that still has autocmds does not give a warning. The next defined augroup takes its place. * Mac: can't build with tiny features. * Closures are not supported. * User defined functions can't be a closure. * No easy way to check if lambda and closure are supported. * Mac: don't get +clipboard in huge build. * No new style test for diff mode. * diffmode test leaves files behind, breaking another test. * Compiler warning for loss of data. * No tests for :diffget and :diffput * The short form of ":noswapfile" is ":noswap" instead of ":nos". * Memory leak when saving for undo fails. * Memory leak when using timer_start(). (Dominique Pelle) * Pending timers cause false memory leak reports. * More memory leaks when using partial, e.g. for "exit-cb". * test_partial has memory leaks reported. * Can't build with tiny features. * No error for using function() badly. * Various tiny issues. * Closure function fails. * Using function() with a name will find another function when it is redefined. * Test 86 and 87 fail. * :delfunction causes illegal memory access. * Tiny build fails. * Coverity reports bogus NULL check. * Leaking memory when redefining a function. * A funccal is garbage collected while it can still be used. * On MS-Windows quickix does not handle a line with 1023 bytes ending in CR-LF properly. * Win32: Using CreateThread/ExitThread is not safe. * Not enough testing for popup menu. CTRL-E does not always work properly. * test_alot fails. * Not much testing for cscope. * If a test leaves a window open a following test may fail. * Warning with MinGW 64. (John Marriott) * Quickfix test fails on MS-Windows. * No proper translation of messages with a count. * GUI test isn't testing much. * Test_communicate() fails sometimes. * Quotes make GUI test fail on MS-Windows. * Compiler warning. * Test_job_start_fails() is expected to report memory leaks, making it hard to see other leaks in test_partial. * Result of getcompletion('', 'cscope') depends on previous completion. * Insufficient testing for cscope. * setmatches() mixes up values. (Nikolai Pavlov) * Expression test fails without conceal feature. * Result of getcompletion('', 'sign') depends on previous completion. * match() and related functions tested with old style test. * It is not possible to use plugins in an "after" directory to tune the behavior of a package. * Startup test fails on MS-Windows. * Small build can't run startup test. * Small build can't run tests. * Not running the startup test on MS-Windows. * Startup test gets stuck on MS-Windows. * Cannot get information about timers. * MS-Windows build fails. * No test for "vim --help". * Can't test help on MS-Windows. * Adding duplicate flags to 'whichwrap' leaves commas behind. * Insufficient testing of cscope. * #ifdefs in main() are complicated. * No testing for -C and -N command line flags, file arguments, startuptime. * No test for reading from stdin. * Reading from stdin test fails on MS-Windows. * There is no easy way to stop all timers. There is no way to temporary pause a timer. * Compiler warning for unused variable. * Color Grey40 used in startup but not in the short list. * Sign tests are old style. * Tests that use RunVim() do not actually perform the test. * Test glob2regpat does not test much. * Timers test is flaky. * glob2regpat test fails on Windows. * Completion does not work properly with some plugins. * Cannot detect encoding in a fifo. * When startup test fails it's not easy to find out why. GUI test fails with Gnome. * No automatic prototype for vim_main2(). * Generating prototypes with Cygwin doesn't work well. * With Gnome when the GUI can't start test_startup hangs. * Sign tests don't cover enough. * MS-Windows: The vimrun program does not support Unicode. * glob2regpat test doesn't test everything on MS-Windows. * All functions are freed on exit, which may hide leaks. * Test alot sometimes fails under valgrind. (Dominique Pelle) * In the GUI the cursor is hidden when redrawing any window, causing flicker. * Cannot get all information about a quickfix list. * The sign column disappears when the last sign is deleted. * Build fails with small features. * Test fails with normal features. * It is not easy to get information about buffers, windows and tabpages. * 'wildignore' always applies to getcompletion(). * Warning for unused function. * The +xpm feature is not sorted properly in :version output. * Test for mappings is old style. * Cannot map . (Stephen Riehm) * On OSX configure mixes up a Python framework and the Unix layout. * Mouse support is not automatically enabled with simple term. * Mark " is not set when closing a window in another tab. (Guraga) * Cannot highlight the "~" lines at the end of a window differently. * A font that uses ligatures messes up the screen display. * It's not easy to find out if a window is a quickfix or location list window. * Test fails without the +sign feature.- Updated to revision 2045, fixes the following problems * Looking up a buffer by number is slow if there are many. * Netbeans file authentication not tested. * GTK: display updating is not done properly and can be slow. * setbufvar() causes a screen redraw. * filter() and map() either require a string or defining a function. * Memory leak when using a function callback.- Updated to revision 2033, fixes the following problems * Memory access error when reading viminfo. (Dominique Pelle) * "gd" hangs in some situations. (Eric Biggers) * Not all quickfix tests are also done with the location lists. * Background is not drawn properly when 'termguicolors' is set. * Coverity warns for unreachable code. * Win32: Cannot compile with XPM feature using VC2015 * The Man plugin doesn't work that well. * File list does not include new XPM libraries. * Viminfo continuation line with wrong length isn't skipped. (Marius Gedminas) * Using Ctrl-A with double-byte encoding may result in garbled text. * Minor problems with the quickfix code. * Quickfix long lines test not executed for buffer. * Ruby test is old style. * Cscope interface does not support finding assignments. * Not all parts of the quickfix code are tested. * No test for what 7.4.1948 fixes. * Using 32-bit Perl with 64-bit time_t causes memory corruption. (Christian Brabandt) * When using CTRL-W f and pressing "q" at the ATTENTION dialog the newly opened window is not closed. * Perl interface has obsolete workaround. * Perl interface preprocessor statements not nicely indented. * Crash when running test_channel.vim on Windows. * Unicode standard 9 was released. * When 'insertmode' is reset while doing completion the popup menu remains even though Vim is in Normal mode. * Two test files for increment/decrement. * Running Win32 Vim in mintty does not work. * The quickfix init function is too big. * When using a job in raw mode to append to a buffer garbage characters are added. * Coverity reports a resource leak. * Falling back from NFA to old regexp engine does not work properly. (fritzophrenic) * Invalid memory access with "\. * When the netbeans channel is closed consuming the buffer may cause a crash. * Using ":insert" in an empty buffer sets the jump mark. (Ingo Karkat) * It is not easy to see unrecognized error lines below the current error position. * On Solaris select() does not work as expected when there is typeahead. * GUI has a problem with some termcodes. * On MS-Windows large files (> 2Gbyte) cause problems. * Number variables are not 64 bits while they could be. * With 64 bit changes don't need three calls to sprintf(). * Large file test does not delete its output. * Getting value of binary option is wrong. (Kent Sibilev) * 'errorformat' is parsed for every call to ":caddexpr". Can't add to two location lists asynchronously. * No testing for Farsi code. * Viminfo file contains duplicate change marks. * farsi.c and arabic.c are included in a strange way. * Not all quickfix features are tested. * Missing changes in VMS build file. * Compiler warns for loss of data. * When copying unrecognized lines for viminfo, end up with useless continuation lines. * When updating viminfo with file marks there is no time order. * filter() and map() only accept a string argument. * Cscope items are not sorted. * glob() does not add a symbolic link when there are no wildcards. * Values for true and false can be confusing. * Not all TRUE and FALSE arguments are tested. * True-false test fails. * GUI: cursor drawn in wrong place if a timer callback causes a screen update. (David Samvelyan) * Capturing the output of a command takes a few commands. * Cannot easily scroll the quickfix window. * When writing buffer lines to a job there is no NL to NUL conversion. * evalcmd() doesn't work recursively. * Evalcmd test fails. * Tiny build fails. (Tony Mechelynck) * Crash when passing number to filter() or map(). * Still cursor flickering when a callback updates the screen. (David Samvelyan) * GUI: cursor displayed in the wrong position. * After using evalcmd() message output is in the wrong position. (Christian Brabandt) * Crash when using tabnext in BufUnload autocmd. (Norio Takagi) * Running the tests leaves a viminfo file behind. * evalcmd() has a confusing name. * Messages test fails. * There is a :cbottom command but no :lbottom command. * It is not easy to get a list of command arguments. * Test for getcompletion() does not pass on all systems. * Using "noinsert" in 'completeopt' breaks redo. * Using "noinsert" in 'completeopt' does not insert match. * When a file gets a name when writing it 'acd' is not effective. (Dan Church) * Warning from MinGW about _WIN32_WINNT redefined. (John Marriott) * When there are many errors adding them to the quickfix list takes a long time. * buf_valid() can be slow when there are many buffers. * When ignoring case utf_fold() may consume a lot of time. * Can't build without +autocmd feature. * Still too many buf_valid() calls. * Warnings from 64 bit compiler. * buflist_findname_stat() may find a dummy buffer. * More buf_valid() calls can be optimized. * The cursor blinking stops or is irregular when receiving date over a channel and writing it in a buffer, and when updating the status. * Reference counting for callbacks isn't right. * Can't build with +eval but without +menu. * cppcheck warns for using index before limits check. * printf() does not work with 64 bit numbers. * ARCH must be set properly when using MinGW. * The list_lbr_utf8 test fails if ~/.vim/syntax/c.vim sets 'textwidth' to a non-zero value. * Build fails with 64 bit MinGW. (Axel Bender) * 'cscopequickfix' option does not accept new value "a".- Updated to revision 1938, fixes the following problems * Updating marks in a quickfix list is very slow when the list is long. * When waiting for a character is interrupted by receiving channel data and the first character of a mapping was typed, the mapping times out. * When receiving channel data 'updatetime' is not respected. * Wrong computation of remaining wait time in RealWaitForChar() * When umask is set to 0177 Vim can't create temp files. * GUI: When channel data is received the cursor blinking is interrupted. * Channel reading very long lines is slow. * balloon eval only gets the window number, not the ID. * Cannot easily get the window ID for a buffer. * Cannot get the window ID for a mouse click. * Cannot use a window ID where a window number is expected. * Invoking mark_adjust() when adding a new line below the last line is pointless. * Various typos, long lines and style mistakes. * User commands don't support modifiers. * GTK 3: cursor blinking doesn't work well. * Using CTRL-] in the help on "{address}." doesn't work. * Win32: the "Disabled" menu items would appear enabled. * No test for collapsing buffers for a channel. Some text is lost. * When writing viminfo merging current history with history in viminfo may drop recent history entries. * Some compilers can't handle a double semicolon. * Collapsing channel buffers and searching for NL does not work properly. * Warnings from 64 bit compiler. * Netbeans uses uninitialzed pointer and freed memory. * Doubled semicolons. * Tests using external command to delete directory. * Recent history lines may be lost when exiting Vim. * No test for using setqflist() on an older quickfix list. * When ":doautocmd" is used modelines are used even when no autocommands were executed. * Executing autocommands while using the signal stack has a high chance of crashing Vim. * The effect of the PopupMenu autocommand isn't directly visible. * No proper test for what 7.4.1906 fixes. * History lines read from viminfo in different encoding than when writing are not converted. * Not enough testing for parsing viminfo lines. * Register contents is not merged when writing viminfo. * Missing test changes. * vim_time() not included when needed. * Ruby 2.4.0 unifies Fixnum and Bignum into Integer. * Command line editing is not tested much. * Missing "void" for functions without argument. * Viminfo does not merge file marks properly. * Possible crash with many history items. * Compiler warning for signed/unsigned. * Overwriting pointer argument. * Inconsistent indenting and weird name. * Can't build without +spell but with +quickfix. * Using both old and new style file mark lines from viminfo. * When writing viminfo the jumplist is not merged with the one in the viminfo file. * Compiler warning about uninitialzed variable. * New style tests not executed with MinGW compiler. * When using the GUI search/replace a second match right after the replacement is skipped. * Off-by-one error in bounds check. * No test for directory stack in quickfix. * When writing viminfo numbered marks were duplicated. - Refresh vim-7.3-filetype_spec.patch- Link to perl directly instead of dlopen'ing it.- vim must require %{?libperl_requires}, if perl is not updated with vim in lockstep, the following error occurs: vim: error while loading shared libraries: libperl.so and the program stops working. (boo#982869)- Updated to revision 1883, fixes the following problems * Python: encoding error with Python 2. * Memory leaks in test49. * Invalid memory access when exiting with EXITFREE defined. * Memory leak in test_matchstrpos. * Setting really_exiting causes memory leaks to be reported. * Appending to the quickfix list while the quickfix window is open is very slow. * When a callback adds a timer the GUI doesn't use it until later. * Comparing functions and partials doesn't work well. * Typing "k" at the hit-enter prompt has no effect. * Whether a job has exited isn't detected until a character is typed. After calling exit_cb the cursor is in the wrong place. * Channel test is flaky. * Appending to a long quickfix list is slow. * Check for line break at end of line wrong. * Cppcheck found 2 incorrect printf formats.- Updated to revision 1862, fixes the following problems * Using a partial for timer_start() may cause a crash. * Compiler warnings with 64 bit compiler. * string() with repeated argument does not give a result usable by eval().- Updated to revision 1859, fixes the following problems * Tests involving Python are flaky. * Ubsan detects a multiplication overflow. * Getting an item from a NULL dict crashes. * Can't build with Strawberry Perl 5.24 (obsoletes perl-5.24.patch) * Still trying to read from channel that is going to be closed. * GUI freezes when using a job. * test_syn_attr fails when using the GUI. * Unix: Cannot run all tests with the GUI. * Crash when job and channel are in the same dict while using partials. * When setting 'termguicolors' the Ignore highlighting doesn't work. * Valgrind reports memory leak for job that is not freed. * When a channel appends to a buffer that is 'nomodifiable' there is an error but appending is done anyway. * When a channel writes to a buffer it doesn't find a buffer by the short name but re-uses it anyway. * Cannot use a function reference for "exit_cb".- Update apparmor.vim (taken from AppArmor 2.10.1) * add support for the "unspec" network keyword- Updated to revision 1842, fixes the following problems * non-antialiased misnamed. * When timer_stop() is called with a string there is no proper error message. * Memory leak in debug commands. * Cannot use an Ex command for 'keywordprg'. * Possible crash when conceal is active. * When splitting and closing a window the status height changes. * When using a partial on a dictionary it always gets bound to that dictionary. * The BufUnload event is triggered twice, when :bunload is used with `bufhidden` set to `unload` or `delete`. * Functions specifically for testing do not sort together. * Cannot get the items stored in a partial. * When using packages an "after" directory cannot be used. * The code to reallocate the buffer used for quickfix is repeated. * get() works for Partial but not for Funcref.- Fix build with perl 5.24 (perl-5.24.patch)- Updated to revision 1829, fixes the following problems * No error when invoking a callback when it's not safe. * May try to access buffer that's already freed. * No message on channel log when buffer was freed.- Updated to revision 1826, fixes the following problems * The screen is not updated if a callback is invoked when closing a channel. * Help completion adds @en to all matches except the first one. * Compiler warnings when sprintf() is a macro. * Removing language from help tags too often. * Redirecting stdout of a channel to "null" doesn't work. * When a job is no longer referenced and does not have an exit callback the process may hang around in defunc state. * When job writes to buffer nothing is written. * Callbacks are invoked when it's not safe.- Updated to revision 1816, fixes the following problems * 'guicolors' is a confusing option name. * Quickfix doesn't handle long lines well, they are split. * GTK3 doesn't handle menu separaters properly. * Can't use Vim as MANPAGER. * Running tests in shadow dir fails. * 'termguicolors' option missing from the options window. * Test_out_close_cb sometimes fails. * Using wrong feature name to check for 'termguicolors'. * Using wrong short option name for 'termguicolors'. * Sending DETACH after a channel was closed isn't useful. * Netbeans channel gets garbage collected. * Memory access error when running test_quickfix. * A channel may be garbage collected while it's still being used by a job. * Looping over a null list throws an error. - Refresh vim-7.4-filetype_mine.patch- Updated to revision 1796, fixes the following problems * Cannot use ch_read() in the close callback. * Leading white space in a job command matters. * Channel could be garbage collected too early. * Color name decoding is implemented several times. * Some character classes may differ between systems.- Updated to revision 1786, fixes the following problems * When using the term truecolor feature, the t_8f and t_8b termcap options are not set by default. * Using negative index in strcharpart(). * Warnings reported by cppcheck. * synIDattr() does not respect 'guicolors'. * strcharpart() does not work properly with some multi-byte characters. * The old regexp engine doesn't handle character classes correctly. * Compiled-in colors do not match rgb.txt.- Updated to revision 1778, fixes the following problems * When using complete() it may set 'modified' even though nothing was inserted. * When using feedkeys() in a timer the inserted characters are not used right away. * Undo options are not together in the options window. * Arguments of setqflist() are not checked properly. * No "closed", "errors" and "encoding" attribute on Python output. * Cannot use true color in the terminal. * Newly added features can escape the sandbox. * When using the term truecolor feature, the t_8f and t_8b termcap options are not set by default.- Updated to revision 1754, fixes the following problems * When a buffer gets updated while in command line mode, the screen may be messed up. * Crash when 'tagstack' is off. (Dominique Pelle) * When adding to the quickfix list the current position is reset. * "noinsert" in 'completeopt' is sometimes ignored * syntax not set when using ":buf" and 'filetype' set manually- Updated to revision 1749, fixes the following problems * Cannot detect a crash in tests when caused by garbagecollect(). * The help for functions require a space after the "(". * The Perl interface cannot use 'print' operator for writing directly in standard IO. * It is not easy to get a character out of a string. * Python: turns partial into simple funcref. * Folds may close when using autocomplete. * Test fails when not using utf-8. * It is not possible to only see part of the message history. It is not possible to clear messages. * Count for ":messages" depends on number of lines. * syn-cchar defined with matchadd() does not appear if there are no other syntax definitions which matches buffer text. * Not testing utf-8 characters. * strgetchar() does not work correctly. * Clang warns for uninitialzed variable. (Michael Jarvis) * Python: Converting a sequence may leak memory. * Memory leak in Perl. * Coverity: missing check for NULL pointer. * "gD" does not find match in first column of first line. * When using GTK 3.20 there are a few warnings.- Updated to revision 1726, fixes the following problems * Crash when calling garbagecollect() after starting a job. * When using try/catch in 'tabline' it is still considered an error and the tabline will be disabled. * Tabline test fails in GUI. * Compiler errors for non-ANSI compilers. * ANSI compiler complains about string length.- Updated to revision 1721, fixes the following problems * Leaking memory when opening a channel fails. * Coverity: not using return value of set_ref_in_item(). * Leaking memory when there is a cycle involving a job and a partial. * Tests fail without the job feature.- Updated to revision 1716, fixes the following problems * When using try/catch in 'statusline' it is still considered an error and the status line will be disabled. * For plugins in packages, plugin authors need to take care of all dependencies. * GTK GUI doesn't work on Wayland. * Non-GUI specific settings in the gvimrc_example file. * Double free when a partial is in a cycle with a list or dict. * 'autochdir' doesn't work for the first file.- Updated to revision 1710, fixes the following problems * feedkeys('i', 'x') gets stuck, waits for a character to be typed. * Building the Perl interface gives compiler warnings. * ":syn reset" clears the effect ":syn iskeyword". (James McCoy) * When using :stopinsert in a silent mapping the "INSERT" message isn't cleared. * Display problems when the 'ambiwidth' and 'emoji' options are not set properly or the terminal doesn't behave as expected. * :packadd does not work the same when used early or late. * Using freed memory when parsing 'printoptions' fails. * Using freed memory with "wincmd p". (Dominique Pelle) * Cannot use empty dictionary key, even though it can be useful. * New regexp engine does not work properly with EBCDIC. * Not all output of an external command is read.- Updated to revision 1691, fixes the following problems * When reading JSON from a channel all readahead is used. * channel_get_all() does multiple allocations. * When writing buffer lines to a pipe Vim may block. * Completion doesn't work well for a variable containing "#". * When help exists in multiple languages, adding @ab while "ab" is the default help language is unnecessary. * The Dvorak support is a bit difficult to install. * The justify plugin has to be copied or sourced to be used. * The editexisting plugin has to be copied or sourced to be used. * The swapmous plugin has to be copied or sourced to be used. * The shellmenu plugin has to be copied or sourced to be used. * A reference to the removed file_select plugin remains. * Coverity: copying value of v_lock without initializing it. * Coverity warns for not checking name length (false positive). * Coverity warns for fixed size buffer length (false positive). * Coverity: no check for NULL. * README text is slightly outdated. * There is no easy way to get all the information about a match. * When running tests $HOME/.viminfo is written. * The channel close_cb option does not work. * MzScheme does not support partial. * Ruby interface has inconsistent coding style. * Can't compile with the conceal feature but without multi-byte. * When switching to a new buffer and an autocommand applies syntax highlighting an ml_get error may occur.- Updated to revision 1665, fixes the following problems * When 'F' is in 'shortmess' the prompt for the encryption key isn't displayed. * When binding a function to a dict the reference count is wrong. * Invoking garbage collection may cause a double free. * Crash when an autocommand changes a quickfix list. * Handling emoji characters as full width has problems with backwards compatibility. * Terminating file name has side effects. * Using string() on a partial that exists in the dictionary it binds results in an error. * When a dict contains a partial it can't be redefined as a function. * Using Python vim.bindeval() on a partial doesn't work. * Using freed memory after setqflist() and ":caddbuffer". * Compiler has a problem copying a string into di_key[]. * The matchit plugin needs to be copied to be used. * Quickfix test fails. * Old style test for fnamemodify(). * Users who loaded matchit.vim manually have to change their startup. * Crash when using expand('%:S') in a buffer without a name. * remote_expr() hangs. * Crash when using partial with a timer. * On Unix in a terminal: channel messages are not handled right away. * A plugin does not know when VimEnter autocommands were already triggered. * has('patch-7.4.1') doesn't work. * No test for special characters in channel eval command. * No test for an invalid Ex command on a channel. * Crash in :cgetexpr. * Crash when calling job_start() with a NULL string.- Updated to revision 1635, fixes the following problems * Quickfix code using memory after being freed. * Using channel timeout instead of request timeout. * Timers don't work on Unix. * Not checking for failed open(). * Memory leak when out of memory. * When starting the GUI fails a swap file is left behind. * Timer with an ":echo" command messes up display. * Although emoji characters are ambiguous width, best is to treat them as full width. * Catching exception that won't be thrown. * Having type() handle a Funcref that is or isn't a partial differently causes problems for existing scripts. * Comparing a function that exists on two dicts is not backwards compatible. * string() doesn't handle a partial. * Contents file is only for Amiga distro. * Compiler warnings for non-virtual destructor. * The versplit feature makes the code uneccessary complicated. * Can't build with small features. * Still can't build with small features. * Still quickfix test in old style. * Build fails with tiny features. * Malformed channel request causes a hang. * When a JSON message is split it isn't decoded. * Starting job with output to buffer changes options in the current buffer. * When 'fileformats' is set in the vimrc it applies to new buffers but not the initial buffer. * Emoji characters are not considered as a kind of word character. * Channel test doesn't work with Python 2.6. * Channel demo doesn't work with Python 2.6. * All Channels share the message ID, it keeps getting bigger. * Can't get info about a channel. * Trying to close file descriptor that isn't open. * Missing changes to structs. * Channel out_cb and err_cb are not tested. * 64-bit Compiler warning. * Handling emoji characters as full width has problems with backwards compatibility. * Unicode table for double width is outdated. * Compiler doesn't understand switch on all enum values. * List of test targets is outdated. * If the help tags file was removed "make install" fails. * Vertical movement after CTRL-A ends up in the wrong column. * Channel test is a bit flaky.- Updated to revision 1591, fixes the following problems * Crash when using function reference. * Using ":call dict.func()" where the function is a partial does not work. * Get E923 when using function(dict.func, [], dict). * Warning for unitinialized variable. * Partial is not recognized everywhere. * Nesting partials doesn't work. * Compiler warnings with 64 bit compiler. * Old style test for quickfix. * Combining dict and args with partial doesn't always work. * Warning for shadowed variable. * The quickfix title is truncated.- Updated to revision 1579, fixes the following problems * Passing cookie to a callback is clumsy. * Dict options with a dash are more difficult to use. * Missing update to proto file. * ":helptags ALL" crashes. * An empty list in function() causes an error. * Crash when assert_equal() runs into a NULL string. * Crash in assert_fails(). * Using CTRL-] in help on option in parentheses doesn't work. * Using old style tests for quickfix. * There is no way to avoid the message when editing a file. * No test for ":help". * Setting 'compatible' in test influences following tests. * Tests get stuck at the more prompt. * ":undo 0" does not work. * Write error of viminfo file is not handled properly. * Cannot pass "dict.Myfunc" around as a partial. * There is no way to invoke a function later or periodically.- Updated to revision 1558, fixes the following problems * Using "ever" for packages is confusing. * Specifying buffer number for channel not implemented yet. * MS-Windows job_start() closes wrong handle. * Compiler warning for unitinialized variable. * MS-Windows channel leaks file descriptor. * Using feedkeys() with an empty string disregards 'x' option. * Compiler warning for shadowed variable. * The feedkeys test has a one second delay. * Cannot re-use a channel for another job. * Too many feature flags for pipes, jobs and channels. * Selection with the mouse does not work in command line mode. * Too much code in eval.c. * Channel test is a bit flaky. * Missing job_info(). * job_start() with a list is not tested. * Channel log methods are not tested. * On Win32 escaping the command does not work properly. * GTK3: horizontal cursor movement in Visual selection not good. * Sticky type checking is more annoying than useful. * Getting a cterm highlight attribute that is not set results in the string "-1". * Two tests fail. * Cannot load packages early. * Cannot generate help tags in all doc directories. * ":colorscheme" does not use 'packpath'. * ":runtime" does not use 'packpath'. * Completion for :colorscheme does not use 'packpath'. * List of test targets incomplete. * "make install" changes the help tags file, causing it to differ from the repository. * Windows cannot be identified. * It is not easy to find out what windows display a buffer.- Switch back to GTK+2 because GTK+3 interface seems to be slower.- Updated to revision 1525, fixes the following problems * Statusline highlighting is sometimes wrong. * "J" fails if there are not enough lines. * Channel output to file not implemented yet. * Channel test is a bit flaky. * Channel with disconnected in/out/err is not supported. * Channel test: Waiting for a file to appear doesn't work. * Cannot write channel err to a buffer. * On a high resolution screen the toolbar icons are too small.- Updated to revision 1510, fixes the following problems * Crash when starting a job fails. * Keeping both a variable for a job and the channel it refers to is a hassle. * Channel test fails on AppVeyor.- Updated to revision 1506, fixes the following problems * No error message when :packadd does not find anything. * Garbage collection with an open channel is not tested. * Writing last-but-one line of buffer to a channel isn't implemented yet. * Crash when using ch_getjob(). * No test for reading last-but-one line. * When channel log is enabled get too many "looking for messages" log entries. * Job cannot read from a file.- Updated to revision 1498, fixes the following problems * ":loadplugin" is not optimal, some people find it confusing. * Not using key when result from hangul_string_convert() is NULL. * "inline" is not supported by old MSVC. * Compiler warning for unused function. * Visual-block shift breaks multi-byte characters. * No command line completion for ":packadd". * Wrong callback invoked for zero-id messages. * clr_history() does not work properly. * Crash when built with GUI but it's not active. * Cursor drawing problem with GTK 3. * Error for locked item when using json_decode().- Updated to revision 1485, fixes the following problems * When using hangulinput with utf-8 a CSI character is misintepreted. * Function arguments marked as unused while they are not. * Test_reltime is flaky, it depends on timing. * ":loadplugin" doesn't take care of ftdetect files. * No test for ":loadplugin". * Cannot add a pack direcory without loading a plugin. * "timeout" option not supported on ch_eval*(). * A one-time callback is not used for a raw channel. * Channel "err-io" value "out" is not supported. * Job input from buffer is not implemented.- Updated to revision 1474, fixes the following problems * Sort test doesn't test with "1" argument. * Channel test sometimes fails, especially on OS/X. * Coverity reports missing restore. * Missing out-of-memory check. And Coverity warning. * Can't build without the autocommand feature. * Compiler warnings without the float feature.- Updated to revision 1467, fixes the following problems * Error when reading fails uses wrong errno. Keeping channel open after job stops results in test failing. * The "out-io" option for jobs is not implemented yet. * When encoding JSON, turning NaN and Infinity into null without giving an error is not useful. * JSON encoding doesn't handle surrogate pair. * Can't get buffer number of a channel. * Using empty name instead of no name for channel buffer. * Memory corruption when 'encoding' is not utf-8. * Crash when using json_decode(). * Memory leak when using ch_read(). * JSON tests fail if 'encoding' is not utf-8. * Json encoding still fails when encoding is not utf-8. * Vim hangs when a channel has a callback but isn't referenced. * Test 87 fails with Python 3.5. * Opening a channel with select() is not done properly. * When a JSON channel has a callback it may never be cleared. * When the argument of sort() is zero or empty it fails.- Updated to revision 1421, fixes the following problems * When calling ch_close() the close callback is invoked, even though the docs say it isn't. * Using "u_char" intead of "char_u", which doesn't work everywhere. * Tests slowed down because of the "not a terminal" warning. * May free a channel when a callback may need to be invoked.- Disable sniff support, its unmaintained.- Updated to revision 1410, fixes the following problems * The close-cb option is not implemented yet. * Perl eval doesn't work properly on 64-bit big-endian machine. * Having 'autochdir' set during startup and using diff mode doesn't work. * GTK 3 is not supported. * Completion menu flickers. * Leaking memory in cs_print_tags_priv(). * json_encode() does not handle NaN and inf properly. * Leaking memory in cscope interface.- Updated to revision 1397, fixes the following problems * When the Job exit callback is invoked, the job may be freed too soon. * Starting a job hangs in the GUI. * Can't sort inside a sort function.- Drop vim-7.1.314-CVE-2009-0316-debian.patch, Python 2.7 has the appropriate fix.- Updated to revision 1385, fixes the following problems * Job and channel options parsing is scattered. * Channel test ch_sendexpr() times out. * Can't remove a callback with ch_setoptions(). * Channels don't have a queue for stderr. * X11 GUI callbacks don't specify the part of the channel. * Channel read implementation is incomplete. * Calling a Vim function over a channel requires turning the arguments into a string. * ch_setoptions() cannot set all options. * Can't change job settings after it started. * The job exit callback is not implemented. * Can't get the job of a channel. * It is not easy to use a set of plugins and their dependencies.- Updated to revision 1353, fixes the following problems * Compiler warnings in build with -O2. * When there is any error Vim will use a non-zero exit code. * When the test server fails to start Vim hangs. * When the port isn't opened yet when ch_open() is called it may fail instead of waiting for the specified time. * The test script lists all functions before executing them.- Updated to revision 1345, fixes the following problems * Crash when using channel that failed to open. * Crash when closing the channel in a callback. * Channel test fails on non-darwin builds. * Channel NL mode is not supported yet. * It's difficult to add more arguments to ch_sendraw() and ch_sendexpr(). * Can't compile with +job but without +channel.- Updated to revision 1328, fixes the following problems * Cursor changes column with up motion when the matchparen plugin saves and restores the cursor position. (Martin Kunev) * "\%1l^#.*" does not match on a line starting with "#". * Channel with pipes doesn't work in GUI. * Crash when unletting the variable that holds the channel in a callback function. * Can't compile with +job but without +channel.- Updated to revision 1294, fixes the following problems * copy() and deepcopy() fail with special variables. * Encoding {'key':} to JSON doesn't give an error. * assert_false(v:false) reports an error. * When jsonencode() fails it still returns something. * jsonencode() is not producing strict JSON. * Crash when evaluating the pattern of ":catch" causes an error. * The job feature isn't available on MS-Windows. * ch_open() with a timeout doesn't work correctly. * ch_sendexpr() does not use JS encoding. - Remove vim-7.3-diff_check.patch- Updated to revision 1194, fixes the following problems * New lines in the viminfo file are dropped. * Old style tests for the argument list. * Generated function prototypes still have __ARGS(). * Wrong argument to assert_exception() causes a crash. * Illegal memory access when using :copen and :cclose. * When running gvim in the foreground some icons are missing. * Recognizing does not work when the language is Turkish. * Using searchpair() with a skip expression that uses syntax highlighting sometimes doesn't work. * Cannot define keyword characters for a syntax file. * Can't sort on floating point numbers. * Default features are conservative. * Conflict for "chartab". * Using the local value of 'errorformat' causes more problems than it solves. * 'langmap' applies to the first character typed in Select mode. * Langmap test fails with normal build. * Autocommands triggered by quickfix cannot always get the current title value. * No support for JSON. * Build with normal features fails. * Coverity warns for NULL pointer and ignoring return value. * type() does not work for v:true, v:none, etc. * Automatically generated function prototypes use __ARGS. * No error for jsondecode('"'). * ":argadd" without argument is supposed to add the current buffer name to the arglist. * Missing error number in MzScheme. * Expressions "0 + v:true" and "'' . v:true" cause an error. * No tests for "is" and "isnot" with the new variables. * This doesn't give the right result: eval(string(v:true)). * No test for new behavior of v:true et al. * The +channel feature is not in :version output. * empty() doesn't work for the new special variables. * test_writefile and test_viml do not delete the tempfile. * Crash with invalid argument to glob2regpat(). * free_tv() can't handle special variables. * Error messages for security context are hard to translate. * The channel feature isn't working yet. * Can't build with FEAT_EVAL but without FEAT_MBYTE. * Compiler warning for not using return value of fwrite().- Updated to revision 1130, fixes the following problems * Repeating CTRL-A doesn't work. * No tests for :hardcopy and related options. * When making a change while need_wait_return is set there is a two second delay. * With 'rightleft' and concealing the cursor may move to the wrong position. * Vim can create a directory but not delete it. * When using ":next" with an illegal file name no error is reported. * Using {ns} in variable name does not work. (lilydjwg) * delete() does not work well with symbolic links. * delete(x, 'rf') does not delete files starting with a dot. * No longer get "." and ".." in directory list. * argidx() has a wrong value after ":%argdelete". (Yegappan Lakshmanan) * delete(x, 'rf') fails if a directory is empty. (Lcd) * Using ":argadd" when there are no arguments results in the second argument to be the current one. (Yegappan Lakshmanan) * There is no perleval(). * Can only get the directory of the current window. * Python None value can't be converted to a Vim value. * Memory leak in :vimgrep.- Updated to revision 1087, fixes the following problems * Wrong way to check for unletting internal variables. * The Tcl interface can't be loaded dynamically on Unix. * Crash when using an invalid command. * CTRL-A does not work well in right-left mode. * Using "." to repeat CTRL-A in Visual mode increments the wrong numbers. * The CTRL-A and CTRL-X commands do not update the '[ and '] marks. * Crash with an extremely long buffer name. * CTRL-A and CTRL-X work badly with blockwise visual selection- Updated to revision 1066, fixes the following problems * Segfault when unletting "count". * Illegal memory access with weird syntax command. (Dominique Pelle) * Typos in the :options window. * Compiler warning for ignoring return value of fwrite(). * When a spell file has single letter compounding creating suggestions takes an awful long time.- Updated to revision 1046, fixes the following problems * The fix in patch 7.3.192 is not tested. * When a symbolic link points to a file in the root directory, the swapfile is not correct. * Vim overwrites the value of $PYTHONHOME. * The local value of 'errorformat' is not used for ":lexpr" and ":cexpr". * The column is not restored properly when the matchparen plugin is used in Insert mode and the cursor is after the end of the line. * When there is a backslash in an option ":set -=" doesn't work. * An Ex range gets adjusted for folded lines even when the range is not using line numbers. * Using "q!" when there is a modified hidden buffer does not unload the current buffer, resulting in the need to abandon it again. * g-CTRL-G shows the word count, but there is no way to get the word count in a script.- Updated to revision 1004, fixes the following problems * searchpos() always starts searching in the first column, which is not what some people expect. (Brett Stahlman) * Leaking memory when hash_add() fails. Coverity error 99126.- Updated to revision 979, fixes the following problems * When pasting on the command line line breaks result in literal characters. This makes pasting a long file name difficult. * When using :diffsplit the cursor jumps to the first line. * Using ":sort" on a very big file sometimes causes text to be corrupted. (John Beckett) * test_cdo fails when using another language than English. * When changing the crypt key the blocks read from disk are not decrypted.- Updated to revision 972, fixes the following problems * Test 87 doesn't work in a shadow directory. * Configure doesn't work with a space in a path. * test86 and test87 are flaky in Appveyor. * Rare crash in getvcol(). (Timo Mihaljov) * The asin() function can't be used. * Memory leak when there is an error in setting an option.- Updated to revision 963, fixes the following problems * Crash when dragging with the mouse. * Segfault reading unitialized memory. * X11 and GTK have moure mouse buttons than Vim supports. * Memory leak when encountering a syntax error. * vt52 terminal codes are not correct. * There is no way to ignore case only for tag searches. * test_tagcase breaks for small builds. * Writing tests for Vim script is hard. * New style testing is incomplete. * Missing changes in source file. * Test_listchars fails with MingW. (Michael Soyka) * Can't build when the insert_expand feature is disabled. * When using 'colorcolumn' and there is a sign with a fullwidth character the highlighting is wrong. (Andrew Stewart) * v:errors is not initialized. * Sorting number strings does not work as expected. (Luc Hermitte) * 'lispwords' is tested in the old way. * When a test script navigates to another buffer the .res file is created with the wrong name. * When using Lua there may be a crash. (issue #468) * Vim doesn't recognize .pl6 and .pod6 files. * A few more file name extensions not recognized. * Test_tagcase fails when using another language than English. * Vim checks if the directory "$TMPDIR" exists. * When setting 'term' the clipboard ownership is lost. * Test107 fails in some circunstances. * Cannot run the tests with gvim. Cannot run individual new stests. * test_listlbr_utf8 sometimes fails.- Updated to revision 935, fixes the following problems * Test 94 fails on some systems. * test_utf8 has confusing dummy command. * Crash when using longest completion match.- Updated to revision 930, fixes the following problems * When a BufLeave autocommand changes folding in a way it syncs undo, undo can be corrupted. * Python interface can produce error "vim.message' object has no attribute 'isatty'". * Libraries for dynamically loading interfaces can only be defined at compile time. * Compiler complains about type punned pointer. * t_Ce and t_Cs are documented but not supported. (Hirohito Higashi) * Wrong indenting for C++ constructor. * No utf-8 support for the hangul input feature. * New compiler warning: logical-not-parentheses * When removing from 'path' and then adding, a comma may go missing. (Malcolm Rowe) * When running out of memory while copying a dict memory may be freed twice. (ZyX) * Compiler warning for comparing signed and unsigned. * A digit in an option name has problems. * The dll options are not in the options window. * The rubydll option is not in the options window. * Missing proto file update. (Randall W. Morris) * Leaking memory with ":helpt {dir-not-exists}". * Prototypes not always generated. * User may yank or put using the register being recorded in. * Completing the longest match doesn't work properly with multi-byte characters. * Ruby crashes when there is a runtime error. * A clientserver message interrupts handling keys of a mapping. * "gv" after paste selects one character less if 'selection' is "exclusive". * MS-Windows: Most users appear not to like the window border. - Refresh vim-7.3-sh_is_bash.patch- Updated to revision 898, fixes the following problems * Build failure when using dynamic python but not python3. * Indentation of array initializer is wrong. * On MS-Windows the iconv DLL may have a different name. * C indenting is wrong below a "case (foo):" * vimrun.exe is picky about the number of spaces before -s. * Custom command line completion does not work for a command containing digits. * Editing a URL, which netrw should handle, doesn't work. * Freeze and crash when there is a sleep in a remote command. (Karl Yngve Lervåg) * The 'fixendofline' option is set on with ":edit".- Updated to revision 889, fixes the following problems * Crash when changing the 'tags' option from a remote command. (Benjamin Fritz) * 'smarttab' is also effective when 'paste' is enabled. (Alexander Monakov) * May get into an invalid state when using getchar() in an expression mapping. * Vim leaks memory, when 'wildignore' filters out all matches. * Compiler warning for unused variable. (Tony Mechelynck) * Not obvious how to contribute. * ":find" sometimes fails. (Excanoe) * Coverity error for clearing only one byte of struct. * Can't see line numbers in nested function calls. * Test 49 fails. * When leaving the command line window with CTRL-C while a completion menu is displayed the menu isn't removed. * Block-mode replace works characterwise instead of blockwise after column 147. (Issue #422) * When doing an upwards search without wildcards the search fails if the initial directory doesn't exist. * Using uninitialized memory for regexp with back reference. (Dominique Pelle) * The OptionSet autocommands are not triggered from setwinvar(). * Triggering OptionSet from setwinvar() isn't tested.- Updated apparmor.vim (taken from AppArmor 2.10.0) * add support for the "ib" and "mpls" network keywords- Updated to revision 865, fixes the following problems * GTK: font glitches for combining characters * "zt" still doesn't work well with filler lines. (Gary Johnson) * Dragging the current tab with the mouse doesn't work properly. * It's a bit clumsy to execute a command on a list of matches. * Vim doesn't recognize all htmldjango files. * Filetype detection is outdated. * pango_shape_full() is not always available. * Still problems with pango_shape_full() not available. * plines_nofill() used without the diff feature.- Updated to revision 854, fixes the following problems * When '#' is in 'isident' the is# comparator doesn't work. * Compiler warning for possible loss of data. * "vi)d" may leave a character behind. * CTRL-A on hex number in Visual block mode is incorrect. * Moving the cursor in Insert mode starts new undo sequence. * does not show up. * Saving and restoring the console buffer does not work properly. * "zt" in diff mode does not always work properly. (Gary Johnson) * Missing information about runtime files.- Updated to revision 843, fixes the following problems * Xxd doesn't have a license notice. * The ruler shows "Bot" even when there are only filler lines missing. (Gary Johnson) * CTRL-A in Visual mode doesn't work properly with "alpha" in 'nrformat'. * After CTRL-V CTRL-A mode isn't updated. (Hirohito Higashi) * With a sequence of commands using buffers in diff mode E749 is given. (itchyny) * Invalid memory access when using "exe 'sc'". * Gcc sanitizer complains about using a NULL pointer to memmove(). * It is not possible to save and restore character search state. * Illegal memory access with "sy match a fold". * Invalid memory access when doing ":call g:". * Invalid memory access when doing ":fun X(". * Invalid memory access in file_pat_to_reg_pat(). * 'linebreak' breaks c% if the last Visual selection was block. (Chris Morganiser, Issue 389) * Invalid memory access in file_pat_to_reg_pat. * Cursor moves after CTRL-A on alphabetic character. * Invalid memory access for ":syn keyword x a[". * Crash when using "syn keyword x c". (Dominique Pelle) * Crash when clicking in beval balloon. (Travis Lebsock) * Resetting 'encoding' when doing ":set all&" causes problems. (Bjorn Linse) Display is not updated. * When expanding `=expr` on the command line and encountering an error, the command is executed anyway. * $HOME in `=$HOME . '/.vimrc'` is expanded too early. * More side effects of ":set all&" are missing. (Björn Linse) * gettabvar() doesn't work after Vim start. (Szymon Wrozynski) * Comparing utf-8 sequences does not handle different byte sizes correctly. * Can't compile without the crypt feature. (John Marriott) - Refresh vim-7.3-diff_check.patch- Updated to revision 803, fixes the following problems * Repeating a change in Visual mode does not work as expected. (Urtica Dioica) * Accessing memory before an allocated block. * Using freed memory when triggering CmdUndefined autocommands. * Test for ":diffoff" doesn't catch all potential problems. * Using "A" in Visual mode while 'linebreak' is set is not tested. * C indent does not support C11 raw strings. (Mark Lodato)- Updated to revision 797, fixes the following problems * Using freed memory and crash. (Dominique Pellej) * Test fails when the autochdir feature is not available. Test output contains the test script. * The buffer list can be very long. * Can only conceal text by defining syntax items. * Can't specify when not to ring the bell. * The 'fixeol' option is not copied to a new window. * Warning from 64 bit compiler. * Crash when using more lines for the command line than 'maxcombine'.- Updated to revision 788, fixes the following problems * CTRL-A and CTRL-X in Visual mode do not always work well. * :diffoff only works properly once. * Behavior of :diffoff is not tested. * Background color response with transparency is not ignored. * Search does not handle multi-byte character at the start position correctly. * 'langmap' is used in command-line mode when checking for mappings. Issue 376. * When using the CompleteDone autocommand event it's difficult to get to the completed items. * It is not possible to avoid using the first item of completion. * Equivalence class for 'd' does not work correctly. * Coverity warns for uninitialized variable. * Using CTRL-A in a line without a number moves the cursor. May cause a crash when at the start of the line. (Urtica Dioica) * Compiler complains about uninitialized variable and clobbered variables. * line2byte() returns one less when 'bin' and 'noeol' are set. * Still a few problems with CTRL-A and CTRL-X in Visual mode. * copy_chars() and copy_spaces() are inefficient. * Using both "noinsert" and "noselect" in 'completeopt' does not work properly. * On some systems automatically adding the missing EOL causes problems. Setting 'binary' has too many side effects. * It is not possible for a plugin to adjust to a changed setting. * snprintf() isn't available everywhere.- Updated to revision 763, fixes the following problems * Appending in Visual mode with 'linebreak' set does not work properly. Also when 'selection' is "exclusive". (Ingo Karkat) * Using CTRL-A in Visual mode does not work well. (Gary Johnson) * It is not easy to count the number of characters. * Cannot detect the background color of a terminal. * When 'conceallevel' is 1 and quitting the command-line window with CTRL-C the first character ':' is erased. * Spelling mistakes are not displayed after ":syn spell". * The request-background termcode implementation is incomplete. * Comment for may_req_bg_color() is wrong. (Christ van Willegen)- Updated to revision 752, fixes the following problems * When setting the crypt key and using a swap file, text may be encrypted twice or unencrypted text remains in the swap file. * The tab menu shows "Close tab" even when it doesn't work. * The cursor line is not always updated for the "O" command. * ml_get error when using "p" in a Visual selection in the last line. * Wrong argument for sizeof(). * In a string "\U" only takes 4 digits, while after CTRL-V U eight digits can be used. * ":1quit" works like ":.quit". (Bohr Shaw) * When using += with ":set" a trailing comma is not recognized. (Issue 365) * Cannot specify a vertical split when loading a buffer for a quickfix command. * "p" in Visual mode causes an unexpected line split. * No tests for Ruby and Perl. * The entries added by matchaddpos() are returned by getmatches() but can't be set with setmatches(). (Lcd) * ":[count]tag" is not always working. (cs86661) * ":cnext" may jump to the wrong column when setting 'virtualedit=all' * For some options two consecutive commas are OK. (Nikolay Pavlov) * It is not obvious how to enable the address sanitizer. * Unicode 8.0 not supported.- Make Perl support dynamic bsc#804070- Updated to revision 729, fixes the following problems * Illegal memory access when there are illegal bytes. * ":let list += list" can change a locked list. * Autocommands triggered by quickfix cannot get the current title value. * Overflow when adding MAXCOL to a pointer. * When 'list' is set Visual mode does not highlight anything in empty lines. (mgaleski) * 0x202f is not recognized as a non-breaking space character. * For indenting, finding the C++ baseclass can be slow. * ":call setreg('"', [])" reports an internal error. * Occasional crash with 'list' set.- Updated to revision 712, fixes the following problems * Out-of-bounds read, dectected by Coverity. * Not freeing memory when encountering an error. * The filename used for ":profile" must be given literally. * Various problems with locked and fixed lists and dictionaries. * E315 when trying to delete a fold. (Yutao Yuan) * Fold can't be opened after ":move". (Ein Brown) * Compiler warning for using uninitialized variable. (Yasuhiro Matsumoto) * Joining an empty list does uneccessary work. * Compiler warning for start_dir unused when building unittests. * Searching for a character matches an illegal byte and causes invalid memory access. (Dominique Pelle) * Can't build with Ruby 2.2. * Window drawn wrong when 'laststatus' is zero and there is a command-line window. (Yclept Nemo) * Undo files can have their executable bit set. * gettext() is called too often. * ":tabmove" does not work as documented. * It is not possible to make spaces visibible in list mode.- Updated to revision 694, fixes the following problems * When starting several Vim instances in diff mode, the temp files used may not be unique. (Issue 353) * When there are illegal utf-8 characters the old regexp engine may go past the end of a string. * "zr" and "zm" do not take a count. * There is no way to use a different in Replace mode for a terminal. * When "$" is in 'cpo' the popup menu isn't undrawn correctly. (Issue 166) * Memory access errors when changing indent in Ex mode. Also missing redraw when using CTRL-U. (Knil Ino) * Can't build with MzScheme. * Session file is not correct when there are multiple tab pages. * Running tests changes the .viminfo file.- Updated to revision 683, fixes the following problems * When using --remote the directory may end up being wrong. * CTRL-W in Insert mode does not work well for multi-byte characters. * MS-Windows: When Vim is minimized the window height is computed incorrectly. * The search highlighting and match highlighting replaces the cursorline highlighting, this doesn't look good. * Typo in the vimtutor command.- Updated to revision 676, fixes the following problems * When 'ruler' is set the preferred column is reset. (Issue 339) * Using freed memory when g:colors_name is changed in the colors script. (oni-link) * Using "0 CTRL-D" in Insert mode may have CursorHoldI interfere. (Gary Johnson) * When 'M' is in the 'cpo' option then selecting a text object in parenthesis does not work correctly. * When using netbeans a buffer is not found in another tab. * When 'compatible' is reset 'numberwidth' is set to 4, but the effect doesn't show until a change is made. * 'linebreak' does not work properly with multi-byte characters. * There is a chance that Vim may lock up. * 'colorcolumn' isn't drawn in a closed fold while 'cursorcolumn' is. (Carlos Pita) * Can't use a glob pattern as a regexp pattern. * When netbeans is active the sign column always shows up. * Using 'cindent' for Javascript is less than perfect. * Warning for shadowing a variable. * When completing a shell command, directories in the current directory are not listed. * The first syntax entry gets sequence number zero, which doesn't work. (Clinton McKay) * Missing changes in one file. * When a FileReadPost autocommand moves the cursor inside a line it gets moved back. - Refresh vim73-no-static-libpython.patch- Updated to revision 658, fixes the following problems * The tabline menu was using ":999tabnew" which is now invalid. * When using "gf" escaped spaces are not handled. * Stratus VOS doesn't have sync(). * When splitting the window in a BufAdd autocommand while still in the first, empty buffer the window count is wrong. * ":bufdo" may start at a deleted buffer. * Compiler complains about ignoring return value of fwrite(). (Michael Jarvis) * Configure check may fail because the dl library is not used. * Can't match "%>80v" properly for multi-byte characters. * Xxd lacks a few features. * Insert mode completion with complete() may have CTRL-L work like CTRL-P. * glob() and globpath() cannot include links to non-existing files. (Charles Campbell) * Text deleted by "dit" depends on indent of closing tag. (Jan Parthey) * Missing changes for glob() in one file. * Compiler warnings for pointer mismatch. * 'formatexpr' is evaluated too often.- Updated to revision 640, fixes the following problems * When using Insert mode completion combined with autocommands the redo command may not work. * The default conceal character is documented to be a space but it's initially a dash. (Christian Brabandt) * 7.4.592 breaks the netrw plugin, because the autocommands are skipped. * Marks are not restored after redo + undo. * If no NL or CR is found in the first block of a file then the 'fileformat' may be set to "mac". (Issue 77) * A search with end offset gets stuck at end of file. (Gary Johnson) * Incorrectly read the number of buffer for which an autocommand should be registered. * Can't build with Lua 5.3 on Windows. * Combination of linebreak and conceal doesn't work well. * After deleting characters in Insert mode such that lines are joined undo does not work properly. (issue 324)- Updated to revision 629, fixes the following problems * For complicated list and dict use the garbage collector can run out of stack space. * Syntax error. * The NFA engine does not implement the 'redrawtime' time limit. * Vim hangs when freeing a lot of objects. * Wrong ":argdo" range does not cause an error. * luaV_setref() is missing a return statement. (Ozaki Kiichi) * luaV_setref() not returning the correct value. * Compiler warning for unitinialized variable. (Tony Mechelynck) * Returning 1 in the wrong function. (Raymond Ko) * Compiler warning for unused argument. * Crash with pattern: \(\)\{80000} (Dominique Pelle) * May leak memory or crash when vim_realloc() returns NULL. * Possible NULL pointer dereference. * The last screen cell is not updated. * Compiler warning for variable might be clobbered by longjmp. * Coverity warning for Out-of-bounds read. - Remove vim-speedup-gc.patch, fixed upstream- Updated to revision 608, fixes the following problems * Compiler warnings for unitinialized variables. (John Little) * Can't match "%>80v" properly. (Axel Bender) * Range for :bdelete does not work. (Ronald Schild) * Parallel building of the documentation html files is not reliable. * Conceal does not work properly with 'linebreak'. (cs86661) * ":0argedit foo" puts the new argument in the second place instead of the first. * Using ctrl_x_mode as if it contains flags. * test_listlbr_utf8 fails when the conceal feature is not available. * When doing ":e foobar" when already editing "foobar" and 'buftype' is "nofile" the buffer is cleared. (Xavier de Gaye) * Crash when searching for "x\{0,90000}". (Dominique Pelle) * Using a block delete while 'breakindent' is set does not work properly. * The test_command_count test fails when using Japanese. * Tiny build doesn't compile. (Ike Devolder) * Cannot change the result of systemlist(). * Out-of-memory error. * Memory wasted in struct because of aligning. * It is not possible to have feedkeys() insert characters. * ":set" does not accept hex numbers as documented. * 'foldcolumn' may be set such that it fills the whole window, not leaving space for text. * Running tests changes viminfo. * The # register is not writable, it cannot be restored after jumping around. * May crash when using a small window. * Compiler warnings for unused variables.- Add vim-speedup-gc.patch to improve garbage collection performance. Based on https://github.com/neovim/neovim/pull/1761 (boo#899747)- Modify vim-7.3-filetype_changes.patch to expand tabs when editing * .changes files (bnc#900839)- Update suse.vimrc to stop remembering file positions for git commit cases. This fixes bnc#538369 and based on msys commits 1ef258e and 65ffc90.- Updated to revision 580, fixes the following problems * Ex range handling is wrong for buffer-local user commands. * Segfault with wide screen and error in 'rulerformat'. (Ingo Karkat) * No test for replacing on a tab in Virtual replace mode. * FEAT_OSFILETYPE is used even though it's never defined. * Ranges for arguments, buffers, tabs, etc. are not checked to be valid but limited to the maximum. This can cause the wrong thing to happen. * :argdo, :bufdo, :windo and :tabdo don't take a range. * Non-ascii vertical separater characters are always redrawn. * Giving an error for ":0wincmd w" is a problem for some plugins. * Having CTRL-C interrupt or not does not check the mode of the mapping. (Ingo Karkat) * Building with dynamic library does not work for Ruby 2.2.0 * Can't build with tiny features. (Ike Devolder) * Address type of :wincmd depends on the argument. * Mapping CTRL-C in Visual mode doesn't work. (Ingo Karkat) * No error for eval('$'). * Unicode character properties are outdated. * Redrawing problem with 'relativenumber' and 'linebreak'. * Matching with a virtual column has a lot of overhead on very long lines. (Issue 310) * Using getcurpos() after "$" in an empty line returns a negative number. * Wrong cursor positioning when 'linebreak' is set and lines wrap. * ":52wincmd v" still gives an invalid range error. (Charles Campbell)- Updated to revision 560, fixes the following problems * Tests fail with small features plus Python. * Crash when computing buffer count. Problem with range for user commands. Line range wrong in Visual area. * Cannot build with tiny and small features. (Taro Muraoka) * Crash when doing a range assign. * Using a range for window and buffer commands has a few problems. Cannot specify the type of range for a user command. * Since patch 7.4.232 "1,3s/\n//" joins two lines instead of three. (Eliseo Martínez) Issue 287 * Warnings for unused arguments when compiling with a combination of features. * Highlighting for multi-line matches is not correct. * Repeated use of vim_snprintf() with a number. * Using "vit" does not select a multi-byte character at the end correctly. * Function name not recognized correctly when inside a function. * curs_rows() function is always called with the second argument false. * "ygn" may yank too much. (Fritzophrenic) Issue 295. * Langmap applies to Insert mode expression mappings. * Various small issues. * Missing part of patch 7.4.519. * test_close_count may fail for some combination of features. * Failed commands in Python interface not handled correctly. * One more small issue. * When the X server restarts Vim may get stuck. * Appending a block in the middle of a tab does not work correctly when virtualedit is set. * Memory leak using :wviminfo. Issue 296.- use SUSE LINUX GmbH everywhere- Updated to revision 537, fixes the following problems * With a wrapping line the cursor may not end up in the right place. (Nazri Ramliy) * Using status line height in width computations. * Crash when using syntax highlighting. * Sun PCK locale is not recognzed. * When using "vep" a mark is moved to the next line. (Maxi Padulo, Issue 283) * Specifying wrong buffer size for GetLongPathName(). * When the X11 server is stopped and restarted, while Vim is kept in the background, copy/paste no longer works. (Issue 203) * When using ":ownsyntax" spell checking is messed up. (Issue 78) * map() leaks memory when there is an error in the expression. * matchstr() fails on long text. Daniel Hahler) * Still confusing regexp failure and NFA_TOO_EXPENSIVE. * Crash when using matchadd() (Yasuhiro Matsumoto) * No test for what 7.4.517 fixes. * Many commands take a count or range that is not using line numbers. * Comments about parsing an Ex command are wrong. * When using 'incsearch' "2/pattern/e" highlights the first match. * ":hardcopy" leaks memory in case of errors. * Warnings when compiling if_ruby.c. * Can't build with tiny features. * Test 63 fails when using a black&white terminal. * Value of v:hlsearch reflects an internal variable.- Updated to revision 516, fixes the following problems * When generating ja.sjis.po the header is not correctly adjusted. * Users are not aware their encryption is weak. * "-fwrapv" argument breaks use of cproto. * Generating proto for if_ruby.c uses type not defined elsewhere. * Crash because reference count is wrong for list returned by getreg(). * Memory access error. (Dominique Pelle) * In a help buffer the global 'foldmethod' is used. (Paul Marshall) * Completing a function name containing a # does not work. Issue 253.- Updated to revision 507, fixes the following problems * Setting the local value of 'backupcopy' empty gives an error. (Peter Mattern) * Compiler warning. * Crash when expanding a very long string. * CTRL-W } does not open preview window. (Erik Falor) * 'linebreak' does not work well together with Visual mode. * Issue 26: CTRL-C does not interrupt after it was mapped and then unmapped. * The "precedes" entry in 'listchar' will be drawn when 'showbreak is set and list is not. * Cursor movement is incorrect when there is a number column/sign/fold column and 'sbr' is displayed. * Can't compile on a system where Xutf8SetWMProperties() is not in the X11 library. Issue 265. * When using ":%diffput" and the other file is empty an extra empty line remains. * Using byte length instead of character length for 'showbreak'. * When 'balloonexpr' results in a list, the text has a trailing newline. (Lcd) * A 0x80 byte is not handled correctly in abbreviations. * Abbreviations don't work. (Toothpik) * Check for writing to a yank register is wrong. * ":sign jump" may use another window even though the file is already edited in the current window. * test_mapping fails for some people. * Cursor movement still wrong when 'lbr' is set and there is a number column. (Hirohito Higashi) * Cannot specify the buffer to use for "do" and "dp", making them useless for three-way diff. * When winrestview() has a negative "topline" value there are display errors. * In Insert mode, after inserting a newline that inserts a comment leader, CTRL-O moves to the right. (ZyX) Issue 57. * A TextChanged autocommand is triggered when saving a file. (William Gardner) * Cursor shape is wrong after a CompleteDone autocommand. * XPM isn't used correctly in the Cygwin Makefile. * With some regexp patterns the NFA engine uses many states and becomes very slow. To the user it looks like Vim freezes. * substitute() can be slow with long strings. * Test 72 still fails once in a while. * Typo in file pattern. * Language mapping also applies to mapped characters. * Cannot append a list of lines to a file.- Updated apparmor.vim (taken from AppArmor 2.9.0) * add support for 'hat' keyword * fix highlighting of comments in alias and link rules/bin/sh/bin/shgvim-basegvim-enhancedxxdibs-power9-13 1700726989  9.0.2103-150000.5.57.19.0.2103-150000.5.57.19.0.2103-150000.5.57.19.0.2103-150000.5.57.19.0.2103-150000.5.57.19.0.2103-150000.5.57.19.0.2103-150000.5.57.19.0.2103-150000.5.57.1 vivimgvimrcegviewegvimeviewevimgexgvigviewgvimgvimdiffrgviewrgvimvivimgvim.desktopgvimREADME.Japanese-XIMgui_x11.txtgvimrc_example.vimsuse.gvimrcgvim.pnggvim.pnggvim.pnggvim.pnggvim.pnggvim.pnggvim.pnggvim.pnggvim.svg/etc/alternatives//etc//usr/bin//usr/share/applications//usr/share/doc/packages//usr/share/doc/packages/gvim//usr/share/icons/hicolor/128x128/apps//usr/share/icons/hicolor/24x24/apps//usr/share/icons/hicolor/256x256/apps//usr/share/icons/hicolor/32x32/apps//usr/share/icons/hicolor/48x48/apps//usr/share/icons/hicolor/512x512/apps//usr/share/icons/hicolor/64x64/apps//usr/share/icons/hicolor/96x96/apps//usr/share/icons/hicolor/scalable/apps/-fmessage-length=0 -grecord-gcc-switches -O2 -Wall -D_FORTIFY_SOURCE=2 -fstack-protector-strong -funwind-tables -fasynchronous-unwind-tables -fstack-clash-protection -gobs://build.suse.de/SUSE:Maintenance:31593/SUSE_SLE-15_Update/9a77e4e7e7833a7a0267af43541d7d8b-vim.SUSE_SLE-15_Updatedrpmxz5ppc64le-suse-linux cannot open `/home/abuild/rpmbuild/BUILDROOT/vim-9.0.2103-150000.5.57.1.ppc64le/etc/alternatives/vi' (No such file or directory)cannot open `/home/abuild/rpmbuild/BUILDROOT/vim-9.0.2103-150000.5.57.1.ppc64le/etc/alternatives/vim' (No such file or directory)ASCII textELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=038a36debd1dba2963bc739991a6f5c8700e5b99, for GNU/Linux 3.10.0, strippeddirectoryPNG image data, 128 x 128, 8-bit/color RGBA, non-interlacedPNG image data, 24 x 24, 8-bit/color RGBA, non-interlacedPNG image data, 256 x 256, 8-bit/color RGBA, non-interlacedPNG image data, 32 x 32, 8-bit/color RGBA, non-interlacedPNG image data, 48 x 48, 8-bit/color RGBA, non-interlacedPNG image data, 512 x 512, 8-bit/color RGBA, non-interlacedPNG image data, 64 x 64, 8-bit/color RGBA, non-interlacedPNG image data, 96 x 96, 8-bit/color RGBA, non-interlacedSVG Scalable Vector Graphics imageRRR R R"RR R RRRRRRRRRRRRRRR!RRR RRRRR PPP P PP PPPPPPPPPP P  r iutf-8af5557104f051bfa0ca439064c57623aee7d9e8367f5ab90175157161a1c10a0?7zXZ !t/,u]"k%{J #$yuC̵覄=vg,d74rn7 @`ߝ[ٚb{:ȸItt=w|.Sa0R| yOQݲb#>Z#At?S6C Ԩr& FCl'y0Uq,"v*翓ʬ9iɎ9y_hѰ^w-oes/knJC`pf-B% ҫn, 'r\P^0*V=Ԉ[Bn+;p9v밼j_e Pš5YfZgOi9$hwӴO, yz+o.Mu(z1>i'uhHٛq "Hb[[i0~=?zxoS?;T<# Z!mzI>fx63~q}Ap.rH葴[{mDA ,jpx*gj!PpGza [ࡻ|%*b&u׷QFy*`'Q ^"u"3k­^!^Z"\&~MhzVՎnv ?kX1j yQd9SktߦT7_$8pnwbA74%˱`9K!l&?%v3;$>3\rH=/Q!֝aVAnv2{uZNAwʛ1*Dz!IPb2&}/t~ KEfvƒ~Xz; #0gJ,rJemZ} ŇYqWnBX! Ֆ\c[7/a:RuiN{71C{E(YCe!BQ1|78 :{pו Ar=+: (+΁:2Xfl)jc#U)X;uD]xdfz^6@=b(SWJk<$^ʻF5A{wF©#)m@pnŅA]5p΢p-y8I CgvJk ?* ODuiQ4¬dZfa0⽏ۋ!P?cox#Łk}x0Z\dMU.  bPM>Zn+zM x85YP| EqnEpZm$8 cj wiN2eL`Bm j)lW4g1aW}B8Rs`ˊ"pIkTT6͘DȂo 7m )7![-y`N0ޱF~dkNZfs?Yi%r w#txwFn,7Jv370"p71|rާk*\*9f'%_KkFԼ^5 ,ꨡx\]z(ޔA9I"4<`^q'Ն}Ba~0Ri1M+[ )=9V.}V?0_^O4ȼIj‘ioZ pm(#_1pX {w`41y}CXz1 S7O\U~Q V&S b}j,V2'ߠ%͡ ;0qk YܠS&XhVL-YueW{qi6 2U)".1Lg:&mF¸04P# A Ճȟ~v|%\iZVN]2!W00Pbrq:$sɭ>Vr8d=l3#g}}(-w";e iCMLSCXND{"D3);(m 53>a6~H. ws1i0@yr.Ȯ`lN0 aK6,AQt0'cp (e 7om„^IcP!yխ!00N\ez~{1_K\V -ポN4粒LF T#qsf J%~ Ǝ7+PCsN @Sc!8(94cs -49 7mpJGUUo>Ԉʬ^t&m?Ni"8w@TL^}i2#NJ6!oR^gg7,R[ 6g\yXNJ0yYucS8י ggB1|=Bj8LSU% nTߍ`uE?5h6Y{z㼲~ '}Bb/R$`AHTU3 t9@A'~]rqhzU ~igyn>WMI=@yRb`TA\t#(fE(eJR ޞӝ!3&޶ vH`ѝ7՘A"hI HqbhD\cjӽ3Xɏ~ W_^_ q1*U4[a&Ea;I_>Mɍ(_OxYm؀ŷ=0\n4+c#юa,b;ށF#`%.@ GyOy M3b%IcQ+p]) D%mh;GE* 8&3ep龭BӮ3oE騡ϱC#1)@F5Y ^CAܽ{ zl\tUMi5wa c)YJ q gsH}CyH 갗h5f/Ҙxd&e|/M>Sfj ~o2ymS: kt)Os/ E c/B⓰tSO>P$sg { :IbUVy=9|X@PŒैQu_zy.E}`ZjrHB_jAL%=O)0Lt83RL0:n衻TІvIeIc, &)ɵ8t /9Nu,`Cs* <=k]FdI5*b(%TvgHPx=OyU[qD 8AZ*hcJ̴ys ed_G<4B#%]d`k"jrEp烻yk yc˪}͸4KTpd6 esG\ ZZ|ZgQX>nn c'\nv@VdGBLpͦMWGy𮔞HݸwpJY([h$Ec^ (l1rЗq\@+瞨̺އ Ce$ ,Q@Uze_f )P@jmάXm!|@ `Tni֟ry'*fU87%昮(qOF<¶r;bkhvXT_;Ugm w\*3HNsY%TnwǧߨtO^wpdx=vNA]/M=3?.@=ήqϑU:t}~Sͱk9hE}$#Fcfm;@n^dCmYFfɄr`o \tsݘ o z{*7) r~'j-8&08G*^rswDh #ݰC OUSezqHҦEgzknp'0c G:"@@ΠV{hWŸwQ+ڌ'T}q#YVito= Nt1 F"6سO]Ngw[%T7&i;D W+$%Q'l»(۩ ]eDއ Rȿ.쫤SoDp]qaO(Uף]*p YD|5Jy`AdE>nUmrדRHͫ[(=]tɏԺr277j|3ۭFXCS~eK>Cic/8'Q"ӛ"~E)#D?2m`٢r|YI<Yȩ;bM>d|M,Dr=HymBy87߷}(s gB2emr#w͡8(ol=B/běS(QP,9ēP$:?Z@Q,kAe42X_ V(0J?,a ,*kRïO⹢G&ÂMkybdH FpRLDTQ?@x7-eoV%^/d%5,c/gu쌥GSTI#Sk2ޘ{~C*t|=#˘ߌATeBE*$0h-8`JRL_2ʮ2$uJe6VpYNK\&DDm+ݼO*moMj݂XWQN ֘9=@m*{SnM%ue#!ݜ*`$]Tpk6b%G%^:Dz:B[*bG9z]x\T,r85X6؞QU}#%m1gs(GqMm\m_UG~VO"s)`;nUhID#ho||USməyBdt 3hﶭR1eY8N!̉r!+9Uts:%$*m$9./to%n߯o Fj}#T:h_6{ʙW)k|LÏܧ^ߵ?V1CD=)NHF4ljn - _JډC]}C ;^O"?R$cN#m٠p(BˢTQ|~<"¹k6*QW4ݜnow.[MMUq ]P tp g1f?}Vg$nvT ud6?B̲LgW+gNSyD+'v!HbG hI+j*uu#ϵ/bgR&lb(Gt躈75"YhVagŠ#Sӎ*I+.UU?> rR{#'q_b#:gT?OU(4 0+ʗhLq_7kHZz +Ϧdnr*pMсՙb>$d Mɩ&ͼw;dHhFrTC*eV$[=st`H*x6!uO,_bcA0E~ZՑnZHŃSM4\55VUZ+-s_mare3B;m)Ch'f޳މR!^U%OcO>B~fV4H1G6V$ c(lpհIv*|WV\w!A,*?5L>FnYvulFzTҤj=:j&XS}lGos%9!k3;>D9 VfNLG%F%6,^\Sh0C6~ڨar Ye:.WMdY~$C={Ց`GbU˟"~l=דa|`j9QW٪O(΋-C)kZ}(E hy@g~2FFɐ.≝6YA^9ujԿ %"x (1j܃7I/l"\w#6=#\6GeOKYYtS-&^I//h ^Y6vV0Edv1?8|Fzty-r>*1x_%XCrTXX3"%;9)fX5 EkZD<1pnGqM\:F=H纣cJ[1UЄ񓤄F>yP48g[ +y[AEc6l:L; r\m4VB/LVE1ۺ%36V]B Yz ;5, LA_gn5C;NK8X"b;F W)~uA(ZsoMLS<7qjj 'SAqܬ.$"C:}̐\)P4M f%8YTFW4ml; Ѳ AL5fnXE x3bH7x:iEmfa1ew A0B^͸C`% 2πߐ#"8 om0V`LNi{ ]FF3цpZl.Zs53SA܎]HTa̾.6H8"'U x@E!Ѣ;EvfK %eoh7$|_(X,o>濌n0r[X`Q|H wT/_"a?]80ٮ7Ju?W毷jsK YM0zFԱ-(򣛴jh:䚞z;&2m$mnՀ^wŸʁQ3- {wQ# 0dJlCVT>mgӢ T,M<̰ges\?m@}nJ5P9zÓ t>R_О(ݠ&yU.WI/4袯 s W5{XrRb/妓UIa)0 l4ОBYm@=w(O 2םLSiKc$74â,tKrؕx#S"! {geg7 O8/J EkKW_.k\tV0 ji8oGY>weOh~9"HIc3ӷ>E-RJ9!Iޅ&aG)WH?؇zu11d(Q{wN(.jׁu ,qv53/u- ΰN4$ 5AVӜbE2DyJ< %QF8 o`C $,O>dx\ƪ%6bJAibfX"6|2"Ͽ׌1`uk ]V!\EM[[~W֔> ϴq*W^LR@c 5V;UP̃HeK4=b'1ˆ;b U?S4;j\HݷNCCVi`AF¢& <^83AvKP/d0|jH2#OˡG{ڏ٬@,.TwkvhX ~Ҏ9Ӧh}M:J0vQL9gZ%PDts1s=eԶ8q/reՒp>=KJHS] FWe'\ #Z|.ǝmӺCGih2Kh9C*O۩޸[?o=\8o?C >/ -R}\~ఔ5bwqHJMjwR@iC??plw϶Rn &jBefck!\IlA,'ޒH`03Xk㛫-1 T|!@Mbԓ LN7afC.]@җ^Vqv+xn)R[Ҹo8ڽvea(>&la~NXg\6Vҋ[qje*=v j[aH${)bvm"Wplc) ucb],YGz-y₩!bΧF װL'sBz]**։L-ŭ(6R3~%+Z-="ݘJcp"9R0CeZؒxFcЭx,#`dB2{*4noL$*1C t-<h`w^DQ2Sh-cza N ȸ6|{a q&3[ gO)E. -,O/EρHǻ/\;͞a#ΨVb2IX ߖXV,`&K ~щ2`Yg@vvq}kW fv W`0Mw+0SX`+(k(QL泚&LXj'|Ԅ@ˆF 6z]5%W0Ʌö`l˸=$04?";95oF_bGTp-jхG q`@okg ;U } ̎kEiI&vq)HWp'r[ɗ t,Qޫ{S'|nG9 6Y$Q5uDsNZbI_Sg|\TXmpw6z)ib}Wdz;ęO[qPF8m*oFQ5fΉ&O!cꖺޡT ` U]- .x_=(,֔i Mb1QMIĨD2 Xֵ!65AIф(FP9 v Y|"HXˠ)粝5;<{D!FoרPa/M-ER\RwwZs):8/ut"DV7ZDt8տy]^@uFa}xZLj[TeЕv`R_+=끫ItsBpi)+˗; ^a QZ|UVd*@zrUnk+L퍧?OcQv/xt0V6]=?<]!|ԉeѻ= d^}dܗ5WgeA)T `PSTZI^= :S[-d48>˜NN-wYiZr Fk3oEBSHGxO5g;ʵ@ls4 Cbza.{Р:PX(Ð&zfO7Wd Q1zu@0^}3sI!0d.40eZQ{8Kdfuۛ .r.Ǣvwtb 0I?K )k_LJjy^R0MsM7˜=h2 w kJ0_[h md aXo8OzeD:7gIIz0+>[oyĿrDuS Wp伜δ 8! v76»$Y~~0- »mu1[BgT84y\y~rVJUW^m|s7 Y`V 1: 8o`:փ\/)GuCV9py¦0r((dBzCV'>)[$#r:Sxpm+P~ p/J]V@cVo"f.Bx>Ч1t!Bg. n&/ўA*E^{n UO-cIZ#MfL~5?09' 7$/cǤxƜ bCuPAcm];lEg;$"Ƭ?7n30VP `Ø&D~;2w%c~*S!z1:O&ޤ)Iɛ"yF6E%u7))yw9^4DвTeK/yTܶ\d]QGp~iNtΤVAa3ŘME<^hxU"6<`Qv b#w ~p'IsD^SU !)mBA#Q/?gddI8Q <ܠ5`"SߖcEA F0a͍.1 AڀzDPr8K@H'bRLgab}n]<ʡ%`5 n\Fz;p5ߜXmس=-5+r @q7v0 ,\ެcwft6PeФcE$P)/6)1$6 lfg}:pL#따ڝ~\BaB_3CTI.BM `!>k%V%YOr!-ǙM=L:@hj)M{Δ7H.4_ 6kJ73M= }qK{19uP dmhY-tpK"qC`< pnkgVsW\=f[QLU#30|F+p){/觇ĕ7z?0]+ ^ %Ѱ&UQKrC-ݻO[(aÁ|?|n*Ytf<s>uC꺿'&(\E3t vC[;лdB!zB-]d2yGMrIYҘ֛CkI ^u3>`5(Sk+Rņ_47$ BzKH#( Ѽ (?O.lBADA&;mˎd;tvh8`|P\/w}\URo~>:H8QxtwR_9@9,E`tR~)$6$-$0._U>kC Y+yaSn- nP5i@]~/&;/:sY61cE uϳ$[B^uH9"0qR5@9+P"zB0zL&a)Z t}u`n<*T4:i'e_fZ?㦃eAB^Gb!6sBJ8t*2Y-e^" L$nHjpC㸸C0f.HT q"*05ڸÕ?ZiS0N q뎡n(푍j *qc23ϔc:aG"r,Ou^ywZ8MHF1ЬGfqؤCz~ 8}}v(W* ն^ZP0_,-#㾩jf.WC?{@||HU/i\lV%;[tЍH^xWgR8lGv 0<[B<^*A|=K9HТmW7pelA(Ba/v(n%`zSP;7˂3bKӝtu'@_c{6jAqm[oTH{W>nҩ.cĔ/LsLu_[)Z}s,ʫ>HMlUyz)7#gȕ(V ndgZcHi#1{>28@Uy{XoJ*lsкrc3Aɢe)\KآkGJ6jVwRtFW%H< ciz%*^ l9b~QIWj)B-@;YB:'bf@xV~\e=`a9ZC8)B*]/QZör~ Ag ulՐ4*%bXcv9[nNkE9Z`aQ ̉]dvpg\=RgE p]LWۆ3 S\xk[g-5]<-oFJap=w| bPY$`6J!4P= bXs#k{m1Vxk_Jf+auD}坥qc.;1mlQ28Sŏ'ϺB!R?z5N2AT}nWl \cK.T'UN BR_c =TbeO2}4DI'A~0ٿ|t\szE`>AXN7$e!r#qAPPp|p  WU^ XfWm"}x;c*j1^@vx?0kWIV[&8Q {ptՇ @i]mYE bB)]x.Kx#G*$f}^%n5%a{%>bh宀%xuqLv,A}ZIWwpJ˞OMs{YyX{E]tJ,>xs>Ha&3(bu7%ЬW%7GDpܽꥌŋUJo<i_D!MF¿OvK\EMSMZzIcd$ҳ_G콓|+14! `7|9?G&,#!kbᆶ4ܮȼw;hkM; nbGX=! [^!h4-e^ r[EgF۠*ew2cnj;:ӼWU! 5hڐOrYS) ebd Z\uv`-Ev^g))\W,:bp2Ǵ5VjVg8 BĿ49<d9:JV̲|8|K1A$l`wǹSV [ fg]JBF{ >ZAC<\!\UÜ[REH4V;0Y*~_OOf3$*uUr6@m)4gM'3o6⟞g2;~HK򷫬?)oV́\K}5+\M7L;ktHo>&R@)_x273DA\ɤ`+ U\Ӷ 'Who)C_[!un 9%5#yg=6; Snܙ%b}0WbP }K(iH7U!q(.B~K@"İK ^w޼|'pK ]83d`6>j`ye2>ꂊ1jϦ@ 8==:S_ҍ,B]HF`hJ<.0t+N0G#F/fBꠐev0cp>ipppqm&}wujgDadMQϱ4R|I=.ߛ_mףG;l$ٝ,FԘkLМ&j;YJZx V.PCS3&ȍnxceGZ=;*P;T>ȷ_ڳJC&@UL  \f[ LP:к$GlW k[83kʰbU= XuO΂r7VaMv `NI`p!xDy`RUktȉ5pMя0xL˽3x9c;Pd:V^<4V~;". H+%[e*>ZKzbT^r]uAQJ3R;S͞8K_w7=}"qw'qWfyPF/Hxd;C<),F10x8p`#D<t~b8Fr)rys =ѕ/saNܼiNP+j5Ԑ>UGEh]KP>z|!‘4eѸϮu]q?\58r&< zPR g@yM&B0ڥNF"꒘tM  {.\=dh)'*=;WbYqV~=z gǾW {t#DdwnzQT*l** h譹D3g=<=y\*-˪Y-4Ȳ&_w$8 Y)hp$s[}Wms{B7  cel? Fu/F NSpC4AR9ZRpuI[|lrJQatn+|1_~Uԭ3EW)۠7 )״zP2ʫ0W1:)ЃemWgtggF+EywW"I5i B `e?HU?Su\-Iαx$|D15"TۡXdhL*v_WQ`!ВJ Ǜ+202 1~XAWߪ`FL,=DP('N覝rbZSCb /1FSR}OKSj :Z(./wTܝwZšQ n\…) i>y%S)䓑[;6רsZQ.e,gU68|&U;y{m=:bt%/D$Z;J?? ΢'ѡ0VȄշ^ m3fyTⶃxjr.jyY9]kRozI࿽9h&E1h;:'2r3XSH vc;H/ 3ݳDRZUKD"u4*81PeX0vP D] _1mc^hXH-jþv,eTOQxJXS40c04 \rTEm [Xeӟc:~H ',>Ai"\Vʮ`?6Hמ= L?#fP%n8I_y-f)D̛zjai1Ν(lkto@c#ySA|8D-bմhgm0z0 SzHr/0݆2{>$KأaVFNJ:(AnuedY|x@Hj!9 duѬTTԼA?]EBGZ%5Ϳ9`-OkMzC|>jLh{ ?WPivh 5W(zߜ)iNJI#˽{+A^LKWLF)"R g/Hm$&@]̯TL-M`|鏇n!0 Ss\%qDhđMkwnW@VMO{HkAarb:>,"z[a( $oD696au/5T*7a.yՕXq`@ph1hܴQM| *K:[!!Żt~ t ܪT>X"j0z^mKm/pvn+2WV7Y;D^1}nmѹt2*~Wi鹣11zX]ѝ.USQ8%rm$I jV쵨~g;WeCYn<^*pkAj(kbgƜ݇d49߾LJڞ#!8R%]ȧ!܁~?>͏$x!(t\7)߽K|c?fr9ԿQ5zE3{5zE'=Gos"HkK?PֵoYq7ʹS pv!SIswjmj)TҞã[-\p5Hh틱|O9l=E拉 $2?;oaTT}Nl Rβ%C(xodH0(p9,P2pX  zǁ7>,N(B[ФsҌVԩ{P2۸I[HM]G&vFD!up20<֭IЧ?Ekѐ5=Szbň>t .J;aW'EiIMzH=)f xθPVYX u K}$A*o+7IfLqdm6}S酃+#BOm{.à9:}msX(Z0UEƜA[j|* ^ٔԊ$Kt#wE)A `=m{5#Q\5=eoA.gC(J͍]-|9y }C;+ 8 ͙^۵utw9g]!7E#sM_ &T纇 e(xqĬz<:\A~W~ݏqXш۰4,^ghGp~V"'NkT4+\!P}s9 T_t3|g?S,uF JV{P(Y>6n*ݙ{J OeHWҩ%8;+A7`q |l҉xT HCZ.3e*5>- <)BdsԖp+6C8:|9s7$n: ,OB\2U 5V&pc#n(aAޖ9^XWCFQ'ܝm AekC.DF S4+\/@ŷ*B#PqU+rIg#ΘQpDh}b/|Asw৭/G#`j!nmICIC5;L?mq)44 sf>u& B{"ɻO !hN Z>Pkȸ" Y$F*EO\A4e=(Fۣ?v1IS|r 4Ke2%AQ?GH}YQiCǥ9>C lw]$]Q<3 +qݘm>V_KC]G:̎!p- Em6j')ifI1`BHKb£a5F1Tχ!ɐ_lxHR~ FQ&ח̄I$Qm)L2-&}g:/HU[f.Q«NnۧRo'AC:֮Q%|H;ZBb\[qZM#Q6`&}"ĵPaiJ<h/ZfEA,GO&<1G-[\.40s &}gr6t?/H_JЩ^{&6ǖ0ǤǞHV 1NU-;1t3r] 5Hb<+=VGI<-p#hÀlR&ϬC(_~a [04ԭz7-4&+~+". 1Ϩvw%7a00&B5Pqyy9ch\#~4{(o KB4NcneZ C`&b{ЮG1ǝkQaI]oiF:rǜvpD7n7U0> &Moz* aTj㲜 mHn3^e1}rТt OMl MD#Nj@xhL5Fj{b%|n]/1uYI+/SvѕS2:Ã7IBQ.39VOQyJp}I…~x8uxZVLN+0=Н!Q-#5̛]iӭmyM0NfKXhafKL9?&¦$oYQ7;':P~  x6; x %Ea6V}%yB*)L=y2A*hzP 9%bĠQZ?Y@'h+}1T(Ii5y_s,L_y9I"WFļ9 qA{Z5ֺxk{ik7}PERtG9MC%#(x1U]qƣ 'ێVm1S_'sQLJB+25.\'C(5߫bA0vVYJ1 w_2O*>jIAW[,;Dw~50Up`ʯ/5+,^wBJ4PJt ?} <̍Ct; 18|Y^TPJ39% :j5.A'ȷ5X +ݪNGѱ`S&HdUBM,>BcQSf:m["̵ 7 %da5fߜrhA/(9hOp_m)GWg.z4+3pneLweYıXaTf)MO=E*#ӥg _ka(!j 7$|wF>H[QgoupQkؤ$F@O7a ΪH3nԮvǪm%eg,MQy; 6Z.A4瑡D4 I jZ)Y%!S3뷉!^ U[b'2`ی,z$0U(id1jU*y@f(l}GʇY/4\~Ȓ:?gيg=z؊Tdj_l^ R;f:7etiK"ˤ\}ĉ |TeUr w'Oxwf ڵuZw2ĝfv][TI1ojT=@=12 ޢz'..=AkuVL* ?<<5 cC1A#+RmAO] 62=kոd3ݪ7մ3fD_ڔb¬b x^yq7(Sr}*.ˠZ˵ˌ7e=H9|^L_aUG :i,{!,8QM-}8H5M|[]Tg@<Oq( ߱WUj4Pv+epu)zg(s3F's1̚Q,P4su^r?|&ayU8x§Urn1Dٺ_82o,褂$m6 ,Vvn1vbfJhAnbJ? Lz~8AQe{OroWDy+Ċڹ*NPQ-Mq 3aѢd} ݚh{\NL„6V!8ck-P ӗ#v\rhe>ex 戤j3Wl>s b6a7X$|K}KS?.5t޳C؏5~b Eh!?Xk=졁z=vC9+ =!v`XN>tL`Sܪ3mҪ¡f1?߄/09/Ayz0ܚ ߊ`|rW!LpPF>y4ҘCwBqU O(}ɪqӑq-qpCމB9ґ}1bÌv2$7iݒǁWE>R>fK;N0)R~92m,yHmR?JB8#:l'Sd஗qr"* ])5£L%N5l _Hb gt;ݔ=>M;գxRˊQ'l$=]%6/%oo  \4ib>L3~ * уO󓰹v _"-q|>tɟxEjݙ{CXuItܩCgYE:Cf >t+ ^}xVC9UP%w:U"I\h2+I$;XOC&U'r.+ z!2*G =nb˷|L/bQpyt:Ny}\tuIlݦr6g dQ־:KPⶬE"uMЧ3wiG9X@3>(jTB(Zg-ձ&p~؞ysHzV(K6J90;Nc&U!4<)8WRZMx pZ˗y'MU^hs⋳vutoMcJBAGk4X+Vzmwçp.̗] pazK]/ǧY̱W $'~-V Z'7#jN+ۢ\F"J:bA2.G0ZϟEnCeٖ7gLR(!4w|vjU_(2ȅ @Ʃખ|O׺@M~="'XCt J@۫CԳ4`;ŞQX>Z}gcA{K 7?trwݞbŹ(3{_2AɞcGŊ Z¤^=\*rHg_Cz j(QW;N-k,վkzGɕdE;1~&:6I&j>S;WZxP;|dÏتf LF;)9SQP,+'w vNJɨf <hx2,!4J_ߓ2}"yCu>Hnrw&$+4~e^5lY`U+3ߕ;ǥzH:T)'!n s:g(Xl4>`>(*T+YN%3xl!lҤ'i0;7L9!%YQ=#d'tp-X<Nﬗ8,`(BdA߹6}pS}*zx=N?()+Ο~G/[ S3.#IU>M+HCp|2 uYO:޷;=ZDU1!V}G?clE3d&VY-_tdQ}؋-:4L 3SDP~7k!(r.y{ D GmGD'JϚV;hZwu|v)kn* W<8|r,w_JY߰F0>|*PTXEq"-C~EW._?hh]:x1gQ,J_*3ĚM9NPNStQ*,DDGPՑS8OG(<3IlZh2<}a K|G:ͬE멉$% M7C zTmFiKf064H،dV#WͽJ՝f'BF :y"ckA~ A q H`*YU>dq:~z~YQ;2v|?ȻJsm<~\E֭̕1e/1?5K jӫkFfY!pox)dp!u\ :bV/wu$D塈? J 4Ca@.*ihPjh]vXXI Q=k٠v֢'<kU ftfs),g#mWE?\eaSU0uY`LJٍ Mk%SnI0zP`NJ_n`1"?4%^F;xx # IdY$sIJ.&ڴ1)^'D1,|D^z%ɇ"ap}xDsn(? :T DŽLK_/FI:{\:;2ak}و"P'Q;k>)0.39ƒoTEe51 Pn@wI^U'DߜuXP[$`'<D?>1s|2I%픬(鴤 cQO$NMAB&ϝXxԮ#2 i8b;}p(s-*~}אxot;P\ b/3+gjya ;e}H02 ?]ռfV4pÚU6iG~:Y]QTV+Bdl[g[!q+nbrxY}!@s?N,5DZSbd]|[M\>FVnoG4<6gˉqoML(c\Ça\kN~[.J̩h0|/ !Agk60^jfnk N-󋧶-C&_uB\ڱ{t oB~"՘B̎,]sp:.*,LS^M8'~tSiN^|*f+<tI꾖>>TB8Az ZzݫR'8]ā6y $0;/-t`zۑE%o R8'nw._t`:ùJ|w^؁r^g͉ .X0jNe~o3-St:CT+AޝRf4 Bx|>EDzT^cR{+)nn}J\=O;K*`&m-0/l}Jx&K-UGK0N_+I:Pw[J^3䑽7:eC~0F3Mi5AZeNUBm=j~+0F8O9=d=_*?P ý%H3gqb1qX%emʃhW33Hu3oRt:vu `MRYYڳ92×\5#FXZ dѱq?|Cu5-0z~07D \%NI`g9V?LsE);Oj298<9W k8 Q~Pqv+[,D٫."*Lq[o T4> XHXuT"h_I>;X55-.@ Mq.MuGMhtl#z2PLR$":xϠnW_E(򅖠a4-Fxjo .25S)Q/K[ y!B3kER.a֞BG]Ri~,ɸ,Q3aO\z ˡ셐Y녵$`@5#!l=l%@@{c;uXoULM{'*:= RR=XFbo :zxL_G-F`lAG+tʱbw(<Z{#J@;SesQW GpsmEw\UM#?BTQ?3jmq^T{41vb؆|,Ԍ[j܂@Wvqίҋ m eð)?Fd[ c"SYJmcUB@&U4G]m)1D4XOmk /(~IUvnVm!PRɋkex}!bdbM2,c шVsc}um<ݥ?!/Gav6XXu`|q WN6[AVǞ1?G*R.i.Ol8Zb=!_zB [>&ijV-hkwMwqT$:/ V[G$UU⻍6 hxrDq+rVKGt2% yGүhECKH~k~l<6% .O_{c4~ӯLcu=.á}1\l2p1PL q>fEE3 *z5$\C>1hc|JGA0ʂ bpvV]m+Q=LhH6Ri_ǷeWX;]vܭw6n8YBҢBa܍%#u)>g:u͈zkBeJt#P9>7C !>(vc.f; ˍ54YL])|uB HIIdiQKR&4j]V0hibnL0 ~IӔ7~ :&+L&y$ &kn[qBPwNNr|ظԙ>tWnΎ?+r.P.*׭0DXYM9;)P2zQkQ8ɢH(8{!-ފVNebީЦ235:EL.=]m$s jV"aKѝӍqcHv4.r "pW`R_y+xe ~8kӐ'Bd2UZ<"WE-KOt[fT[ wAy96MSTϮ- .v1CfJ]xTvc ǐ/$VbeH")4.B~g@awNj[Đѕiұ?. Rsv4<%{i0ʆmJpVˈY#v{]wI|" t}eM J9ҭ n>1xc֦?juV˔<{$v~$6>\GϽ|Q? Թ,9tVhbLd*8ǵP*ڿ3΍d yfU2 }Q޽a?> dn8~QVpI1! Yۭͣ+ν1͉8_>7 cl ހZɟ(RD+vܮN /(h$99 D\@Ɉ&kбG=@()RCzJ -*tQLDG̢a9#rr b`rS֦ y5,?#̻[2(zQ:-a0o%I]NMykBMİT\0}Z!^ ~_2D1mqA_΀N7\o]!*LsїW?R@ ]k *Rb1r";qij;LNHv q'> fߥ9Ĭ#0(\ PC,wsE+Evk=!&JqSf6UX꧙T0So[m -) q}lKҬ꙱("="wDb]SQA 2ɛ'dElKasl%4$cUwG0^`]i2 v* eyA 9HS[1>Q_3Љݻ ߍQ㨷,+‏Km~AA>&X? Z vpHA?6mq+jZˏ`)A'lZxG /RIN,f[4[dMX("ytnŪԇun2W{ю]5?c4{c nx[1%Qo u\c"&|ԡl|Pԃ_MeIOy1L$ڟlQO;+m5j]Dt aӺXFQ|,5D]ZzH/7 9Z4꜑ԙ|!Ue]|8d˨X~8IS?0?^. i`X  ןz%]rE.l ꧵\3QY $}(jn%͌4D$ P/Cb< b{w''ם1]\ &щZD3;S@!~z#ޜO!A삛,2fkNiwtY .;*fFp;3vRҰ Ҵʃi0$6R L'q_1rZX 8C94b#dQ2-ţö)Dl *K +ՑQ޻qyh|ҖB~C*f)4\Uɱ9\VH%)c҅ L?/ K*!0 ~,\PDepn,-.DVTtٞi>$qv~8m.v5#~Yt v_ϮEso%o6X4 B9!SgX~}{ρ0mܝVQfLiJ! *uHY7C5`R]NNZOfs/,k^</n:ao ):jR?DlcP>W/ e紪(wռx &0QSš"sSHܷS=[Qs2 fb#)X&!\^+۹˖<^ȵ'p_HY8K(9]tKkW^)a;{fZmD# ; Np_lL|q4r6@J`[`r*gA?Th;,hs*J#YyiOBQ+BވS?2.Ƕ'InUR%V~U>lVRi.-LqC|j,n6vb;3Ef 8zpGhe¤o&rDf[%*8zdE4b]sk~F2 Yʻ{5ԏ2p*N20ܤ`+Q?DBXzkT*'w+T4PN.GC׮ 8\{Z;ڙMHxso \Ę-6u&R(}ǡGv&\CUx1'BݍϝȒ{+BI4onCŷ|2ޭL5=kD?Pj^\ޛw"űA6W}CQS. m Ԯ2p@aJɅ΋[|bNaukULZÝ4ǒe}q=3LcA's7?>ֳ-.x(J?-59y5rwAqѱXuj!5߸ľL_9y%'\(l@=&*bJKx[@QLȭC5Kme:Gb#x8aMI%q+'bBuPeβd'K@*XPl@wړWQ.W)%^$t5l?BJľ=RڱVYhңr\(1\CҀr4n?3٣oJ -MN&Z?)p dm;nڽw}|KE5eu$׹YLc'[ʢ:Ewĭchژ8+%$Jw.$E$KUEGbӦۂIBU+oHa%$ư p !ef $@"s97>ƬS|_e͞3pHT1'ѩl.N0?K. ʗw%{àhSjH[ RId,H^i3K 8`.ߥzԛkT9:SE!zZъ=PI{ 4 Hڵ!LZSr!# ;֔IcQu`=Muppmz|F@HꆻPO8C*pqCSYN֞K< TWx4]i Ԝ?٫/ؖHTUL|LStWy&fg48LְFp QrV!s U,P6G0WC0M2|4:ЫVnl D d Ws.4г;hާFaw5#Usr3$*+d${v+xAbE)ͅLau )OdҦnQ}ɾ S/Fxлv~`\9̤ɕ:`E)<ڑN)5  2DuMLDhٓkX_?>xyμVD7tmEJ57#h>hTx#Bs&>Sh.FΘ)@0Uɷm149:!Aaƒ5rD(P9e~PPy![w0.s9>4+ 4T"%L^H))#EȠ?p Yc4'xCi2d2e*lтASoy0]JO),|=Y7*[ILІ* (qj3&XOHO%%T;>i"=[:ǽI0 Հ1 :R.J|Y)k dw$5Bɰ h~ k[A7^;?: /0ͽԁN>C SASoAy,i=:](BEQ>V37Ec0a({УprM $U 9˽˨5>+d.Y~6xWX8lq!o:.}cirߵw0 nlq0N+L-~Ȃ"g8%` 8#`*&U0t6&nuVM@w s kz. *ا߽,_ o՚3BHn9Cbh*.v*Ы\k,|]+V,jmTnoo2A3'!OU 0|n)׵<<9->Q"(oR6&mMP>u[-{KsɈ!!SNy,}uR,ZD~2JV"ӂ Np{C.5l55+/d﹙P?&Jld>=e#@?7 J E{̃bcpbrѸ?*ٖpDC87xɟP?⻙GxZyE70Z7!zW+KwO<"@ N"m<:l / nGk67tLvꉘ%Zo uyZzrDZl~HsSeywK|Mtԟ8:cV /uNEC+"S=E] E׀}PP*+ꞡ(q:/ahހ n)զꋕhiW&ShdEfB1eЋq'7&J [cG[~rY 1K.r+/I|%b͘*i̐Ŷ,] ߼LWVxF͙ ƕԵxYe;- % '0bn JvзeU *vg)̵ ,}Wvߕ Z}cϻVa18!bcsՖ3?R2"K&I`ͺA?nz5+!ζZ:d 4qs8_n%Z:lj 46JaYG&2!ou-rh.d|(F&R:^0q:j Ξ8ٹ`c@ hzwZD9Uֹ&J%L^(a16FC QE*h@m ?дu/#LO)wCMA jI[G0i9 vReH.^WoXToGڡCGƟׄ8t-hO>BJ$W['m"q)G%HNi$ |PډBwWPw\*ݪv *)KE71 -֊I}? ^8,p=puA? UyyI8I Z8'FcX;X-;XꥈBa,) ~epח3%F3A⧫pā^ztIް!N۲s/Ҏ@o,)sUBwYn k>u!t{e~òKmyWW+;P,v$mTjW0$|Iq+7ڴ{fLah*\ z+4jO0.OLj3CL@Z[m#W*⁖I]j=KH\(vnA[1t&L2VSK2Ӆ#<.t4Rb!FW?CXYŶ_V)OtzkԣrC/#*`.Bė!c;W쇒y0>2!zMD'vlgSd<)au&kF H 7lN*V \4c`l3v 6<VC.]'!99|>ĥCH; rj )WҬoW^a0 .B*z f 79~^V_xgGL skki)(`tC&'',8Vʥn)/[VM5ƏSO_OS93ωe&7C(u<6d (6c<*(2VǸx.^ A? 1{`S|y69-~"B5},`n[T&#/d2JGX;&}t)9"tǽr- $Z@*9¬34rrD$;^S]49o%bbgFsKXYMTvךG2:R `W"휇K"Օ#e "UPxM-R.l?g0?y0-l2R|&,ځ)zM9-uHKhL3,Ht.\Yª >$/s.2THR^qMvh`V HM7hHMF$ɛ`V #N^Dj EKhJքJ=gY8JnۼWU RgTE=+[DrNXSOHv|譫Sv S_wRBRi"ud%,Z?у"s?'Z(lORI^-c4V~sN)mp7wUS*񌠜EҩPu8 ƭډGG{jtKNDZ~B-D\P.)ih _1rYmE*#W2$#Ifz6W*` 6CYcd#M@>eL(S yTp1<+Yeª8E@{*abgWOu Z3H''._r>e};_EشoZв2cg[6WѡvK9 II((|я@?ʯ@ /,xj86bmXA\p$" I\?˫tT/䁑*25od>C8ٯNϒ&"0 2F#w.P#aG71T 1EJ@e` vv[^ic n^b)WZ@ j1'9t﷦$+̷W!ԕ}cț=GvŖ(fRV11.Ƿ‡`º )T]Ř)iF)OOb\z19c+}iLp/ZVfNG'Vo%+=VFؽ(G6b9q;]rh`$eS)u{;j%el81i,7 UFKOS;`.z.YpVI/?ӒROK^+{֑b'< g1MLLȬN͖NV hBM$iMv[0ÁPn\))Pϸ]SVrnN߹b~#8,& -$-(wR~[Ya΅u͒#4˳˹5u6N3(JRL>,*ҎȰLz'۳zΈ_8b4ư |o䤳#sS8JxڥŸ45ʉbnk# vlKdzERjV뙤2ԉb1¸\Hݛ %Fy,NFZxHC١VZ1YgYƺFVp:\K͜7zS}fF4}X3V/팎1~2]h+N k!9O>۞h7{)'~7bnX2u U~ ϔ^ '(BmZۂ.p/rX|MW܂ `8Rˬ4jJ]һp?lEQRU; 0M3/t&xMˎp?ӦEDt"uhNsv"gA)/q{1-XJǛr]~3{Gh'f LԔ(fUjAdm~2"]#S$^H@,KG|e 91</nO&!d?q~yoB$&8]V\}>µM9Rwf%N3,g_&qmE^1 2 >`òZa/ iݛ}3K L l46O}{HS3 P3Vbmc|~x 4HYHV X%c'6ߡι>p $E3PVe< 9i[ox$.00-_1%]p;Q\pfA`G3eM0ʼnfwT)/xQOOя V99U>u˭@ ~;*U&!|tݹr7ZdlɞX8,="ḿ ^uNːMjdFdz OlȔD3+um'sr5lc( 1DY\&/*m;+\kSqEdߠ5O$El+`W)YMfu(J}vIwSpV,6YؾPJӺf嘌^6Kw'#Hű񔝯\f5$m,v/UsNy0DU(%b?_X. U`6;eK9~!:}Q}+D[-ꗻ치4F#R]Eg9@#d{( ͓;3ؼw..LY22f.Xu|MSv\R(^k$0j:`bNZH]Nƙ >U|BuTT*{+ͨ_cmŌjLп'^>SUG%3y8ly,85#D妷:@GYwFL=>@k { {yKi$l5;VA51908v]e3k#i`aR 02Lw;p F99֬~ITM+:L=ƛ߉i2жc|9DF sؕt)y+XcۆmM00סeqiυSJ=4ojPy ?,QZ "+}BH8'3%^n'O t(MNB& Nlbc(laO:b*]> vw"5Ô*d+ݙ^0TJ+qeH^&L\XLN~'2"ı-9`89SrcTQ&4/FMx^<.5sǺ- _wltv8ܫ:r.7ó wkN`ῐ$eyPTJ7jP` OBY"n%VBDH IHI'jZ4))w$a0~' S&?(}J?<5gUv6'J`J7mV2ڬ!> &Q/[SҘY{hU]SFj-x!Yul[ \E%nq8 hu7OmL{}M1hato#%W1h=Un)=\RQւ<[<#g/vVV6JLH~ʂUgOnBUԽ` $`iy#QQ;#$b*rw5޿'N`2=EXHt b}[#r`NWm~Z,ikCw݀OC݌6PjlYR M|Cȼu3W 3?}OOw2y30Ni|G 7bɄRaN +2 NNLWYY(Erd||dLjق8k=_pu}S߬Z촗 r5geﻗ ŸvXTƇR9E.Z)2|Fh[tsc.aI)rZ'kt^PK:8ĬAxFeD(5 ?kȊ>o[F0ɉ#ٓ=&/o&A: ~:`?ds( %%Xu'X[>L Rt;bi, _^̈́}dG*;A<*iBn/w״,A6K]&JAmVj\5;iMܱIW2zFhB ĩd-*ߔW%^)fkX[XQt\;r_$`45w#)GPqk5̀=Tj=C/gcϵũ_A&NbbVHJA+F?JK N'nP|qTG6ti"hּ?V%#*^ITR^yO /je }@ILFbnWNxD_Y6(:Q 3 %Y&nH=S)/ LH>QF>ټe׾R(Yެ`"[T*i3Om~ M4]$`(K؞\!oa$C`Hr:!v_2<+DݿqsVvǝqK\_ KU7.iE[O&nڒr >rzOoy qIr@8Cqa(n(+'6 ^1BfG0 ;uD/p=Y2҅x\51,X|k(eZuYr(#ޛd,xmH/u1i/Mbz7-L +(ck/Uܼj>zDx#}â meQhYK=aa:\c-zb9P2GWn>'Qg\T2ׄRʡr;ڝR'֚GdSwxV?pWS̥A_93\TnT NL:ܳl(VI=&5AB`Q ,sWaaTlm1;@f`.G8w؝cXS}}wT6L**zIӡ|qCJ AaD8X֩3ZިtDb{w @[&:>p>^6uaPd=X x \7%#AR&g^n. +"{SK;4Q˽~WJX!ILhMaٲzZp ]x U.:ج[M.nPOU6N!T9owںhL60,s='2?#g{TLma5vSWP'"l(8&3kW!@ E(ChZ=kwB2PеSe S,>~W6!*ڰ%abc|L8F ?[69Vʣ'Z)7 L-LſPߏ-0tt~fؖY^T&1:Euey>w~1TN%_́e.RmC-ܢZ+ 맰r^ ~xJ툜9]QGY]D#p]o9{k!bbh1Ϟ}&>yMmB?Ε1p vm9e=SZpX9&2-1FiûHxL.w7kP w~.oL;d/vxK3(+bn0Xipz% &[~9X8>$'m1vޝ5R2sy , V?HK0`){Ȃ9e׻񧺖kNye<$jwNJ(܍aCH7vE)rbQ"6<^p/Pnwwe=UkCgn=u!h7F)/3;69pw!P[0\y}Tk\%$=#kio ޺JE݀<Ø\h.9`mC \D@HCeeh@Gb-|3[_t#$qa[.x0aKv;8 BTM&+f5*Ԋ0K.2N0}Ne2\P b,Q mcOТL9@u=ނsZ^t[Uϑֈ/۳ʷA/?!VGsާ)seTo`EFcM߼oFH Zk)\r",Vf&wcݏ7+GVT/ܼMUg@n<rUPfy4;h` r\K1s"T{ j/@0KG; Ajyc5!l2ԒW<qA P*M nEmۨ3#v e Xt3EQb%Lc}?/-i0J"6oX'Dh-!=9#Эmt'HF|Wbp{6U8&T06\ \`8Տ%hJ+.HGx]$d#uE Gjv#{HbBP!8<qÊY%*&Arl ?NS4]6 Qi%ЮOQY]A8)_I9n# E@v32l1 Lo Pnd%zb} BVd Q)~OMeh(׶vαJ@`0A_D8g"+]ށƊh[^YLjjOheGSs?^Y+K7/iesz܅!Ǡ*}f(zQ/)<&*[[5K]x4_K٢M^F+&%X]B 0/qKBD +g*ѶȰ`nuQˢ,߫VSm Y)ܖrkuRsۭD[h1Ǔ*at$@&pd-ťIh=s~U=W'ؕE p JDhdv+M* MKXRH/6aRq3 &buZ:_q Ykj\%־cto4(Q#S3oW3ߡ^PwM7މIq٪2GD.C@,[Q!,O'fF]@H*9H7։cj{lJr.x0}FDEX]P- CK*V(n~WȿNWwGc7Ƭaނ/lɥDxXY뫤tnR2|$lꘒ?wmd\NEWnjNc2{ MV Rg &L6ŦͭtBt=&-GZsԠmFx2<e`r2oGQJeaE}f&em:H^y s;i%PIC09qƴ$"?>{  ]rtn[Wydvpc * ;~ 3Z,6GLׇKlFv WLϝڣL{( h;:OB NH+t3[BuXhlZ!'O_@*\8ɣg;*AɱY.S Dc%[⽵X=~nfDv!+m#6 >ŒgEOh*W,iױ7e)KJ [߅6 ">A_+gFYUnܚEwA$e(^M2;Ih|V .Hh>u$riVH&5xvD|ȧwU_W; 14f !@nǖ6KNi [?YP9bsKj _9ٺN6{s𩲽:#*k_^&ILmP\ra;Af]"CqVW.Gq sn"Pkw-"hAlB_uQ\"g1t)Ƕcb1'e ޷ "O(\O89%ݕj1{AO*K!vRQsw[Tވc\ ؾB##*+)8LeXXs^T΃ (G͘-eۀBXA>Wp<$b4u8o6y`Td52j9>o-閛6MA[D GǫRGˆiZVbhq/[HyÂ]&kh [ JӠ{)Ί+e n7*OUZgxf=5gUT%w VhLSTF7'K :gKZ&Se/}Rp5v^Jމ fKkiy e}.1$r@R;SLNW@f1Tf9 O,FrZՄsUҺ |&X&TE n;R|Vԧ%~v3Q]j<Żz %>|Tk;(Ifi;`Z;րYVGk1tx}BwhҬ@ܡҨ Ai*^Ш H3{ii ,gOu [H-ܙ/mƑWn燋7j?{Ar'emOϧNl']@ޛfrL;8b'Xo.:[Op/0@@JgHٙ@F;5F7 r8rl*v_T蒺 v=yxH&'[u#U~mai-e`z#IsW> Uzn6P*<5)y3f0A-X|}&Հ ـed$:Bh)K j_kƒ yc]GF QH0+&X3&30 UX9˹'M&1pIó_G*aB H>Ξ{SJZd?;TҶثt-nם@mB9JδU5* b-ٕyaxjI/-Fon6m{6|ެ\% ˲V0"NO*׃OlFIJu2CEeu PD :e7g%`7%zFӳ"dڹ@ǘh+RJm{C?[+ϺuD:ݾdq jY>+1{! s0@PMEK?m%s5vPmF?Οk;^"pgYՍٖ)/`DQS> '+}$Ca݄â[85t:X>`bٞTbC%&##OH.:\Uh~}>H,eZOiRE'q.`y#mФUJ)9w[Tb= UU^  DV #Mg){*l)v o$wANy)&Ӡo;MrV͐ [6{.+ԩbxIlOәZ{pk},$ھb/phBkb' V3F^Q]mfկЕbm rڇ@h3 r82nm6ޖy]-;{(]>nc}5ofD3tD8h 0?˟E7mM4/`ұAך%* ;|͚o2ZՏGGĿn'wcQ{[yS-ם,qfJR-Ҩxn!cwѬQOrيtd'*4r%3yϖت(|M^17&T9y$U ˌΥ3k&UYp%K~D Ěc=w[`Sa犆Ҥn^c:I WVL|h, Fm,jv3/)%rswWimkV.NJG T9ҙkɂ0w =z"w"!~tym%7H1 U0Y?ȔLǼ?o ^~ >Q&<'kec׌bqfU;lA:C~1^[j'-`֧*2\9k ˒|Rp ݱ; kjĭO3]EE F.ҩ_4i31Oފ;KDHu}[hT5FE>{,ʻW vz }+dC>ʂ(qjGaoE׫1TNم|ώ'Y9 `$&F_cF)DfU3jƕa1FQ%{ԞYw/{kpsT% ;e%_YїYs8hf1}_(ҖІGcDGC,jGM)9g/[X6ĺm`͑4-^guHŮ @m<ǭrkWD U/d_r4q^3wcTtC{俟"pM"ea;_o>:^-G61+mHO@(šFc??a)kLc1yBӖШ ^%.LWuի3CTsK$q[=tWƾнv_IDS+NhG>7(U?;B{ƭ1-w5"Ttҝ Q\VHEYS=5$swpmΚz3oN)YCTvԜ"a,EvQ_h *3Ö6ˋJ@P+Dpg'3n1H o[+ \ 6oYQoUW1Z"#̐1kKĩՎq{0ORT% ɗbg-*0z<m7K?/ Vp(0d8a.kZ~@ta5wo 9O&hKleK+g" ѷN#ק&$4|FK" 95:&xugKa0~Sm_[ٝn>ۭYU9(TՃ_*Orз6U)ɻrk|\_`T'U R⥯(pf$o1쭌*5mϲFz'nffa|XSː=IEú=[ 3}/"KHtBzt[e qgǪ a jz-P+NYYK\&$y7; $ADha]_VQ'F #Q&Pe~AN=l@7Q2'4RhgqΊxFF5^{wꮮǂ})sP]{jВK|*YQ8Z ÊH(b+jMũmJQW.6\t+;lTpM8 sqSa԰e^uW3뭓7;F yOLc>$sӠhJRJ&K09a!  '0%|BQdO%A 8;;7 BNIgpwsD gU>-`L%=lo-T%HHHXH{jJ%=L֧bm}_ëʛ>JF%^ԑ+^1mJhRAvJ7Auy3 ǧjpnwx~ΥV툗0]m]{)cWr \CA-A dة'tBY|MBw3-瀏9 ]W+q(xyY@l-1Dw [_d" H0𻚊Fn19ʟn[gKO-rvSsn"ZjQٽ'5h7]Ϟmϕpz(a'"RӸW\4\>B|RhC@ \uQDk\rWJ܌&73~)8GS+R:\X1G?_y,f}}"SaOg7r!GJ äT(9& W(1;TڡڄVㆸRcX!ҴoY)dx06Irzb8;8M'})Z  h0-  _OjG /?]h0!X6CD@0D1D-Yp <9n"/kZe h1<t*xK^~?U_w~! L2,a f2Lx^{ˀs8\-a1َz71@rj"eԂx3ly %-,} emK3j)ҹdP]:3*> V ]U:?\Ug\bAtXfX(bJnw}p>3(>{HodaMY3  DyJ!h6,e%ūGpzpRz j+$]͔E0d)GEͤy{WkxMFUT{\u+/.^ zhc҂p 2اOӳ\2Ҳ8quň^w9{flV 7,+({[6tp0v'h_p>-DxTA3یnW(DhlO|8{L$P{_oz}]P+{2Lv:BHx]yUJbPr[zflٱ!fsHJ,I:iiA6 sH֡PY`ZG*1K7U?#sUHB\du0֣8pq:7l.v c4]λi ~ vU ̭t>9|_hs>oR ROq6Ob8n|a4 XS46j6u;p. ŀ<&`*}"DHb1OJ]*a#myF(D'@UK&b2DMcej}G'pF%CWӭ@Lz%JO`f4 L*td!D b/6ݵ[dgoDO;q~q*pyFBo}݁^-M^tC""b.'n?aЩWAbgkG從MӸ+x%2YelBI$]ODq:hrSG`0NǬ, Jy{04&Cq1=]p5Q ~niUq S^A_#x~*Fn 3 A0{$ 10$bZcRzhgh|xm~]3$#[/G !|{>|? y'Upz9,N{ir\w^ umR=ZPזx\, Ċ;jFKYkd%a6׭ԭgNTJ 6ņ+w:Fl*Xqw{2D2& >P{ YAh6/5& QnLBytVWz$_yh>$"@lhsҽ -MSm7"$oEi)|8LVW>X ,mYv:Q05Rj{kE|Zړ}\?VH9tlX'0:̲ w]n,`T8/qH0oY>C&(ށcNKc"4&ٟ4$d |рÂt٭ 90=\ᔛʶU {"!-l独)y V!. Iczp*1Sll|Tn8c !ejGz˯yYf{#ݮUB\af11G*h4++h`<S]5έ&sہ1Tlkz*Wz`I31 am"]c~F" DhQ_h,  쪍JMoookZ~­n@Z\pGo{;m*l vdGt5zxu4H'<A1D 螻zDP=ȃya!{8:K'~FMskyԄD70B@z<]RIbO@$Ӗ6`BR) :^ mیʠĎŘIb _ WOj Iߵ>UW}[fV[4 =Jw.>~Lftmq-\-Vp=D95\+}.Glƪb { w0Q; NJy%/c«خ- ,L][2>2L\ E*,GP[#CC =[˵Le:aA+Quk euZ;snAFMY(Gf^Lv3iV)a:ԜЫv\Nΐhsmx _< J1/#*x=JQawŷZXXevSј!;Xbem['ƙ*Xk5'm ]kcpL{qPEWuYC(Ujo6`D/6@=%^DF.(+ el U4@h~hoKwfNVOgTdX)OT)"1޷-؆]\K)?ejuḂ+`v0fKD,R ("شEFЌ&kg{@&D+ >eö$׃{-`msSڑ35n;lkt1S;"9B 4Mr{9CRĜvܑGBI" pNVNbν":!?`}sRdcپz>ăZmM|Vx`-ҁq #3%g;۲70yq8Fʾ ^ !}" :BrNQ> .m5jܲ ̒D6|M[Og't[>qH W@r%MH\Fhͽ`An+ hӍi =)Zr!tӆYѤ:M^ nwCMYI__is=+YG C⶷,0/_Xϟ%KSM ֊zس*褏)y\E:ir%aipsܡ:4)h/¿>j Z @&=j#Kɺ8qyDm]Q$% -P H>iַyRH~9$؎ YVĝDc x_$/&G΅ֵ(T 4e0z& 4"w(._5KH]vt耉hgCg=u|qdp'rh'ە0QFz_I Y̍H_d,0dJL=խtV}kAD8,nvoohl $ Y?# I/Ic>WIǢѩ"R&_v1~ʪH;L[~\|:oIX;mp 99A9!O$څUh2ϽwE)H,l|[mDZNyNcsr/Bn%B4JxavA` h'ްNk }! BK'jJvze4S>(v[>r]0{  cso߾|n7Pvo0[2=~P!hqo1 1+1V 1vZnan`x'CtR&7N__~6= 9e{cvZ{j?&?+e$zWkx묤-A>rW]ƹĵR?jB(F> 9m+i׎CPyڄ''}f}K^4hJo9Hc;oYޮRtR;o5+&-7EܟLp6cJ#XJ.;C>lC< J & f\GW𯹞g#Md{. N :Aޟ3fR4@:4/(@Knp oha-!pllB-n _̇}r5f{u ~ٓ*컏/~ae3tv a8k*`ryL,Q>'jC6yc=s/'cֹ-mjN);STF*,X( "v,Hh#%p "#s0Xq̯%cIBj1CfҗիN S1>j!9ݘ.uXv:ۭ8mF5F A\ J[!Jxw\rtB@xё/x sD]rqmmp"nq`&lXonv a 8]݁RMv}~Aܘ2,XbeIm}UDlH9JE- f1_+ "0WTBҸ>t,w|Tg,qBCS 爷|Z{xMms j&I#{2 o/ Ǝ9"okL^@EJ4qȣ Ƭ}Ovڙ?q^k2Ǚelxv"~3e!k2>S$kʫsOwM3b4xwj9B3SF)a)ĴEs̹U(11ʈu7v(+J&_'G: vg(M~mPmzSW1gv*ZTZtԂ*Za]mb^ CO#")1_*l>?9fbX?z:{w/F #[%<e?=gu]rQDD:|gdzա+Mbtw[cn=:ԉ)>~NОgv}ll!&e:5|¼ItG*]9naTsUr=qڱͪ&̓  B r|d@%&|DC5 Ô4RTˮ./~Sz x(˛\ XA7U(1&fB&)ZjmVBG$wk C#䷽yl-*v4XσHh18#<2~Mz؛bS^$:oWN"_r5( -aFDi׈82 Q Kӆ|LӆRQD6[Q ݞ՚9xZզ_ě7(tG! =qٞx[YL-{n(؊l8@ʋ3C`c\k_մ{:Ʉ57(ޢ|Sݹ_i n~!j28"akjŦ4V<=]UPMi׷D X+eJoP5Y5|.ġ&^r` E>uyjpO{G{{sq^B`@R#1AQAPo[m;nwj81K#Muqye؂bj^b5MƫɉwU"oyIpl IUE!2Rud򇇲WKvHRKF\=y r!8H7O9dVwD'&=Åy$-`**e KXsyD] |(D9]3:y ~AiA HA&BqR#hPޫU!|[bqcu*(_Xc9Su[w;HlXB!R]#o5[YXD0*7UNTGh@9:;kB!&W!|Z(ټz5u;]ϲ&Bd^$3=,1GXC|&Tv_7|!CJ.׻/j@DN!# \Ƙddda֜g3ޯ18 vx=r%Hg"d4%H-Nu1Rp6 (t`q;Zuyѯ"6n|KaM{[hsa&A{hmNJjh gdHlrz2)dNWqPN HA\iVWx. L^hQ9O~ kMEvMek\uR9N!8|=|r$+EwPvc< cj6LqN b#8Zs:5;V{4 9~jo.1sE>Ke0'Z)>>roh1( LB:wvXըlAtDՆ;E)F7 Yk}=s}f!ve*P+H+v{|JԹ>6dv<Ŝ(Z{u,!ϥxr,gq6 g0yײL c7P[ 3#2 l!8ګfGSBG{@."Tswn،{yպ1.%] oNgmk`&0(ξ[*l/lvbc_VϷjivp%) v@7J` INMwD0)Alٱu)N# QAH)j+uǺQmBt$O?V2<2םKnw7˄Ѷ4:p ,IGeA ruTr^%#K0*#/.`%a &{UU$/F c6R!OV-5N`&fIVbH\z[NTi# s9=0ir϶W%vn&Q~f@ "' %]󮿳G'fQ*w7\ }g/ScoXnd@sm#s3>6DFA\awp=\1O>FHRGj6B(sݽbrO{8@pw,Np돭u3.svsKIckVm_xHtxӦ{dX-Y3K=QTu>=C ֋u{պ6lUl3:R9dǜ Sor+_^Cu\eK{ 7uպg[g=eQdU^'Boso3sM0XG>9 :[)Qyۢvi>oci(7Ev {܌-s3QQvQ꣱ 6AH93m]"/SutpK(/䇳Nn`p ЄCΆV[/" WB~췇um_Ypo5Ԅ\{nhgk\ &0"Xs*99'9GMa{|{V~ԻVBa5d=sW9͑"E>{V-3Vj?fޗ#BdoaN+Z9W{Z,`yf֏uפ[Y0H/An;RU$\p/{ &b"#@urh.pQ&'rB/m~'gR_ Cf`/-/BrS"!Y `GtB yN@1α(L6 Z5PCIb%©R_p=ׇN[ ؜.!B5nK&&-4t+R'u[@@OhqǏY 4>4-ime#@4#oKX7csJmd@-O_Pvk'43O2+VV=ޡi!P(< Z53^5m`k=Y~%bŔj, @DQ mONKNtykڜ4&E8Q@ ,N vbDhB= >#XUE 5d!_hV W@VWt`ju5E#eK;ݻc_:^k\혰V L@7֦ ݎ5^yh6_eha(|f b؃ytyШ PcP^!ϧ?Y)UMlY;Qk z`}bӫi_+s^NG֬}!%y{')}AvLp4|аA3l>$Ҏ $$ ,3Yv7pGg}ɶ8t˯ʴ?zG6DAA77>6ZK@b,ANΔZEq0ܕk$#򘆼رf* (ax1'n{g-UX!qr5xt2u퓼,w PdlBsıO%[Kr>tᷮk7P k=I B6Ym>8n{.g 8<:VB`ݡ`Hˮ@"^\oSAc|>:dpy\c卶qj J6t|z Pԇ2&K` Z{ʬ-v 6%$ujAtX\5$4V 00aӆ!OahԎuX-V5,}:paގ^UE K(-ccll/ |$Ì[Q=% aye"='fx鵣_G]GWbF%ЁS@`DDDIYvdi [j,A3H; Wx~ԍLg@rÎ7Ko~rˤnpv!8VHm¢/Bb""f#x7R&W&{A 1ø<1w!!d@mA"V$uS"{ĦVir +bP >G&0;k].wv;A{лǷx;b| #HAaGP$lU0 R7G۲.T ]$/uvhZw:2nitU"MR$nQ#xhP]X-@ #9$b Ј' \φAƌ@\QKv9Q͓yBbDv)30 FRxV:pOg~!*ʯDLX2at7kC*kq7@v`v#*Oj! B5, + u`&ii|˺ՕD&s`7 N%L/|"SeHUn >Zc"X|mwg'nNV&4Hұ9kk0{DbXG"V{ ZP?0c`PwOQ!0i$d!Rf)v܄*9\n&o_g_rȱ.5iE,313|PJcJVz!0$e C|e%t0iphZOwqUI\j"92~*S QӭEmD [S "TaZ¶0D;TA> A7a}0vpv5(uŘt ߊ!lƸ< -!vS*IyB:dgԅ#1paؐun%p xt`Tv5%fl k rmȼ^z ж8Yr b41@B8ׅ  OxMN_0E!b\MBD!Z\C]'7_s5Aڭ˦2b 10VL܈vv[VǪۅx rn`SENfTuV4ص^ VӪZm O@rLIq/Q?JO4ϲ><,RƼ98BIUq+rËvYˑQ~|/y#Fى6]VB4)x&g がB`h|cR`-5}e`'i@3(ևŭZn]$W7ڃq~NT_JU~B/gb=={"Xz ؄[d"4(EFZlA3Jp[tĪoޢ<3aF@oEmYrQU(<*vE0uv)?0ء*8|rZzvL8`Ө,'u|iƵyzfu!tvf-q^ `Avq 8oM߾ ~IOX[=b#YܜF#wiu~X*Y]s$ wm13d@V[>#Sݳd3}$ 3dp\3 qMvh0 qК8"][rU]_ +ĴAWmbދ'=7 !Kpb(21j"Gr{^)`]cK 'uނay'SchٔfsGM -^3wSCV D迕P>*pb;;SB-V1Į!zDT_םx8yZ+EOmHXYh[3Ӭ|U s;2(^'1<!"+R舳 Ny龰.QnAB٨:!dU.dPiuӹue)eí(%v ̚j{_-A/2?Б|v‹ ?χnGH$9]x@({#ޝXu^rGG5oiG ~5W  `@n:#Gt,@:$"9 1[5uWW:ȻPaCOH]蚪bLlĆF`g1CYΐI \Y&LOarI 2`b`ldHd`; Hc/lXvI4 S҅x0WSv~:1cـl@A(#q JC(>WC~'Q˼ x_S<Ӷn jwG;/3^7nf[~,zNA$2P8 W$zLF\ٻb[Jm ǵvҪyp5V鍹+mu++[KLjBHCu_hHH)v{1g,a?QB&Wk,%7la2Ǭ 3H=xXwR믷V*^`b16RBB$c1u\Owy'c|kttƄHIx쫨\w~dLc0gdǷ4Sﰲ_,^UBy8ae{^ў4fmؔ gl57[*щu <辊tI5@Pi?_9q~Sk QlgW]ַɯiy8n2| | @((~'BBL~`ʛ uwIsnW\2!6)x}יؠBC2O+s7Pw(FLznʋZ1J;IfjYrƓicy{[w9y:=NӗrS'>??$a2 DIQhL..N:kv @^BH&SC52{3}iw2-}M!!CI@4{ɫŋM}^0cL̕zoA+:YLH1 i *@|֊?Oh҅V"R҂$! ;T$a ? =E0wHda$$ad)=M+~'mT0.NS4X4JW%)Ade=62ǐYt g*Zo0P|\ 0(,@* @2lU!;γ)xV {~aI '0q9]!$~}I{-s!޽@& ^ bk,p!sI}oCvy8O@ $?=' lXE>n;^ݖ9 ^s0Yp-p}l[-= 05:gXZ)@=HBC2o*~u} !N^slql$YޥW_A=z Rg $iw|)q0HWoqVRF1  6EjcHec<jYް}mLg4Dc8s`Yg$*]18#cP1m> 'cgቂR JH=ḞcZ!}פ/;d6C.7~Ccl Pb{@q9 bDa팣jX=kThGq"ri:lYA15bB$zBYAa$R> b7I! @cB<&/d hZmO);Mu<{HNM_hmYU$t*=eCfDU+ b RV[jnD9ӿ}q-Pb%( ,M2<.^[/a Wp cG` Eܿ͜=3X72o9(B ouՎe0 GI[6 .L0OE` ;ǩ?h=lҨQr K[9+D”2Rz-fTs"``ͧ CI dtٍu nNJqaCJ#8Vljp[+5)Cr.@T~"`o"8tup}KP#lVT`r{F]4 =ISoZٰ1msv80fu$z R(w7I=]CDHb^OgʠI$6RB{~:/ǽ?|;b@,ޒOS]yw~X@۳n-:#swV8r N+k|Q'C. ĒbB; oSkh!Dm cpy^#%Pe{j6$ &@p h5( !\/fP' %0OL{ @0ƞ./`36NJ3 4^fɏ$c9+ x@0na7g:23_ud6DCTuW\&H_,brF6uxN oSܙF|ZELwX)j,EjCo4~{q& l;XD2I_RbH?xeqgepxA/0ݫxhQ&@3zm\@=fƟ;s t Q͡'BOV-ڔ.Wc0q"GwZAxzi7OW=(P d| z`fMͿ/{X{M.F>Ik:&,Oqvʐ=wxere;y/Rfݹ5 "  Yѭn~rD,I-<~b5E@^'+Ɍn@!FT&6xFb>7me;Si@j [[40PIHhj0gl9J0o D@4BBwf-\^fXo59\m " ƅ8ƕTǢ]J|}[,T^-c `<ʀ@a0k]97p2a7y/8.nSI{܍kfWcr/,K~"4#0"(ĩ>sdÿǻ2(a{b]~Fز2Kln; F`Ep00 l=T\]^ك`Zy,ríkuXOa۟]_$0Y;-~Eqryd0}^aڼ`@HHayuZ$ $ IO@Bx, Ҿ?+n[e׾Q8?wP1! Pi7,@lWަVޫ.I=)tw N!IB{!IgMR>X@>OqP?iHbaۙD p7=!Xt=Ës ]Nhq7KvlZO}:G}s$ɔʥ juPC|ElㆊZt $ Ę$u?|āHq>}z;P$zO.?ɫ ruIYNۡ NxyM۬nD`<:2`(NLIUHNy~:f4$ĒCʞ I{먟C \׉(ytmn}!I7R !}Â1u]gNUv=4f K$'I&d>Sn{{:n!y"'+#)BL٢)*iꎬ<xCA*8Ihnw:0a%G$YxSA`3^YUPM2qƂNq3SFZ||FOavp~VET SQ^Q{֙ɯJqP'.(Ǥ'3(>. linZϧtf*HWRz]#qo5?4** $< 'O6kaز^ FDt]x9Cݤ6@+f60P{L<ÏySBnj~/[n)UR8QYd.e (JKBmAE&[1w~>_/@~XIH& k4*7[7Q'w͘8QoL~&]TZ~WC& Ic(ȍf(b?se%nF6j/-t-ٮĩ8sVbtb2x ED3N%!t6J!1yȱ(4v}" $~iYj,`{JWJuHER]܇q]t )")8䧐a H< s:*?.ŐwU&,"L"k%$ N }{OuЬv&ʫY;J"pQuJ98ɿi@W柕yp,,d(rGq` rHBGi2 GmתKxٶb]q!߭W3T@`ā; <4HfIK !xOy[!$?$NWa'y6BFZVցmuvyy\gOүaмHo[X8|pUQwmҹ_$/[;l`u#>Xlyy=qI8,3#3Mos6‹Iz2Mlkxy+<˿䜆Fxz%fSB]?*Ժg./{Jlvkm o"3EdkpbӪwϧU rg0[=}W۳uK:nN#/*)5Bk(y&,j6lK2*t< ~o햱tg7R.KC%l塯u|/KcmsvԘކ{- zzzjCmf[eCPi>Uxʽ[^*=]GV^s'-- !Awij0<S_Wx˝f=y FUpZ,КǗ8:K%jvcLl ?=.Q6@c6Iaqj7p⪽TMyM˻ѲYBXZW6#Sǽ!OOo!$F$OP!Oa?zDyt$a$ T>s(C9@@RAO?!i;$@$&B@XB $ $II$1QAb`۰Ǥ!$3 E$a !zn$2d@Hg@6't-@$M~̢L,JɆȩCQstUTX"" '%AX̡Q~ *PC,E,XE 72@¿+[Sڍ?m,v9#Upu%ESNj$i!!U!;Ddɲtf$7 i:C$3@a FIemr& O YHHnP$6L|@ tI+E&Jd`gkI!:Sq:`^(|׉bTIж$Y9,߸L 7CxiȺ]2٨54ՠ*̋`1"mCN5ĨQѲ-P}SFEAImR,]buIT{^T̤BH( ާNs׽s'!!?lt9$7IgX@,HHnPkd!YBN$[1CU&R6̖duL l9/! IM$9U qY@ꐖd&"0Y :@^N>ђ u&s! I N :,s 7I&$&I`:5LrN.NF>;6ڵ ul;}Pvͳ `Ҩ~둯q8=]IPBL 2@ǵ 3:] H!Nn܌!ԀH{@P$&PL OT` qYi0Iv m0Ns/aҤ8nf=YX0 }Dmp*`w$U*/VD9*dQz8u&>O/S-ZLF L ]eahcafLaBZ]$3u~:ȊĄ"L(L;47ec<xV19iĄ@w*=ٷ5sPdIu/.ٶhh5@2$&:L$T!ֲpXB?fFZ4;)MG i:Ku!FJB+S,\a?~蚎Ux1&~űѱgbByt$2 HuC!9lPy@22C3Byd,ԁ C- '`BLʩ;F`G]>9$UN`g$Xeݵf>_r_{iyHoYHQHInj@WiBM/g!IPa=;5&i"LCQr$$uAi(!HPR)(ʣ57\+ryn @3^!cmPd@6ն˱X5d$$Nca ;%B*^$I8vI sHoDIǨHp@רB I :!Ť3/X^`dWv^kȂdP! m_t9=.=C+o?i2JX,(BTA` DQ36(X@$NcLX?qRHad!z]@$lu,s*G~l NB 8)vObu"Hxí`CkwS=sy-%2==CMĚuS@YJATD5;|fIX,;h]IHetىg,>)WniTXyjEвvu2V$G$R)ve;߱ f"ek>\ |HةF QdXEu}CvHlv{kN4dP:O@MmN3 ;}$$neegZEC@ Us6RRl-I;&oЁ`֖wH;$CQ:d&>u10׮?p^;(T@X:tpPDT YM ۾*uLf0!XO̰ Q"Д hVd\q$z נ>ՠI@%MU`A,6tHhpyv$湯- @XphT%ue\9igÄ:}3:].0a:v/&+|x0a!y1{̻1,Q`"$FE$hԒ@'`Bh @ņұe6P'C# ˱n320l5}]CGSI1*ɛ!cG:d *aɺr;^3A0©|b VN_eR)5SomI@ AI$3]@MTfdԓ58C>MmoIX9MD>5ER];Q{"R3w3K|sWN}Gk6^HB}$$<iDU_M(0S!!]ɭLa[^}oꭕq[=MnI 3_:ng$$ l?t$[f^}C9:.It3+t [!;v@r:r7('+}I'v@+Q)l q7y. ޽. Z􅳫Y1RABV`"LIٲEQd -$Ϣ] B!kP9 -J rhN5j!g)39< ,jх;gG^6$ᡠUI9%]6 8 _\&3 LqفQ6՚eP,hAccyYg'.AVA'hBI~-.vsNmgbXTEdmrn%T$ ́;&RE*Tål/"^G ѹdu =+CMNKvЭ ؍JMHK$Ti!pF5ۊ:f)L^ %"f<*1b@"TAd$Aa",H *Ϸ) d+,(B '!(2Y{J2 JRB HE(M@$ EXX*I  $ S!]UdCM@:l '`#VKiY$V2HT"\I@|_&p܈Iz$]?$miA1q804E"XRE> 2ĨVVJBWINBXbe'L:8LspkEQ,UAVAU"V, kA$텵6;Y|Ms'vQOz 8'b )3J2ґUmt*$ p80QTZ)&0s֎CX:??y<%_{.<0nu]z_Opzg hI9|4w&n4u <rx-jw@&V"( TDM:izz󝩽772=Lno&]rkl)1tܭN˰I+|^{WucsR6'Q\I\dd\S׻u|&zCSG-͝AA} TW0@F9(! "pr{v抲RҫmUf\ù;s鄤UH$rЎm _>W'_79$B\m˶>v"@9%=IQ WvWduaӼἽm"G%pbWD,+̃r&J"H)x83dI101khX֩!33GR湷XAI , DlREVe > @ xHImJ!@:fj(Œ*ceEH+mуBsCkl o^A+Z6!1H%$UR, "IHQ !ϵV;`0W=6tz@EN^Ho; x{m_.[qt# !Mb!4:׉puuss;iůԆaaZj$0| 4-sh:+qXgGʣI\7Sj<&4i0-ppda_M:D Vzngnh8{Lb}o9~ü`s?c}\̴ Y+TI l ͺێNc崊"PbF2ޱskOm[~ 3CghN:,4PQV E \E)bKt;qGJ}%LK|O/woOd\@2L1 ͨ^:[\Z%Fr6-(3 !b`J^[F sWQ:|~)@ \|:”,}#W'5~lr N.Vot0^h]nk\ޥ*AϫeŽ%c9P)?vi̗D? n5of8/ #q.$rpsas46@޻ /ZԲV. 1PL{Bzj D`U.bB Zea>g;^bǼrJ+ 2Fx/Ib9?J @Y"c7@LBHs H*Ij6R-R[`>̙՘"Jk|ŎBkLf3 L: `c\׿)15EK;Z@kcM$)C1Z+3>^Ed= AMz `lMYL.г׸[:ϻ8;G!,Xk_F{{<ѪQCk3qnO]8Mav<04,m聨W)2}+TG 4@*Qs}i.&.a[ I.meSg/cf9]/¯"JR4hH}^518]hwx <.Cs.BMds/h>۹KDp7A6.!%jd'o1b.iC`$.9iBnćJL]H6©RMZJ> EX)"5s@@լw ]%LIy*$qp"TR'ea&K zxj;t(֍i,e_Ƹ ݸyxXJ@%((S}Nmwav X'<'rPsrezK&1"=Q ̈́`nP8!*QT [)l}+Kf^ʙ{B1HDj{ i0&潋#~U:ʂ &Ȉ0bf[񐚥 %^@_(n>֧Z*]MqW0{",BYt It";-JXpٙX b sܠԈKVr*Frtvz@"{P]WOu@Ro&A^n&VM&s~-8C5-gjN}+ # [}2JŖ~6{x[[YM|KyJS*,R#K8 >NMLZ&㍘ee DTql.[jڴT7(1,FXfF2 oޠ:>mamȋ$HGJ->"t\0ȠqNYsHJA&;\fvC,ay yeO>m9?/6qQLLq[ozT֪+q+8O)qu5[$M:k/*l_>uwWP| gQ IѦ0@/% \Q~Y->=H81G21"ϑc$]sz=fG]ÛxF#.%aI[<1r ȘkW#Du-4>ݫ™|ymB5%6033tU\*,^b5$[k]d⺙-p/vpsy"rnch( ҂U*ytLa8K9yeANQ@V$əos:NjfknvzkolXȸb.*DxyW5n=eb-[6 'KBV(Rmj)+ QtFasI@ W6w9K'E bZe$cۑcR ,սHWJb' Dl ^PL 8^֖rznW)zb2niVN-PFLDrd5f!$ɲc:x׽)#vER:/٪gY: &2^j A$`ې# U͝-S l@fFC@{,c:x,(2'>w\?+.0:d 0DeMpQih3} },c@=@˜@ ł|U\ZE"FO+DS2QN6QRWHad W%0/:r_w dm%p69ΖwV#Vf@S/y,:2 fDԶQ6VRaF0*.]]OMى)0&fޞ fc6ڽQ4)%oeG.Flw.#*&~ T`De+jy_[DmV &<(wEe.Ұ$5<`8sa !BM$PJPAb9Cȅ~1V B v$kR-c`C{xQe5h+$ :3Sj-"6D c,ˬsdS]o^׭b ga a1E"^kj':HBwgã6m_ OgLb'VLR ۋ٥E`k \8+l1XM""(DT@Ά-*`A$-bI $<ݻR|"PRJq6 ٺD((hYj<Ҩ^/V}SlO[rm=.)ķ*[ASg{CUy7xg5zQZuwiϳOz {_y]rXUΓ7 syxxxv}^G]֣g mL;'HRWkd٨˓YQb9kF]SΗպW-Kj5OCl {h<7Qs:2֨Ŀj~lD::ǿ\T;nqК~BBpO̾߳xDZt~Mu˲l{ۈ ncEovA?%;s"Yr1p, lۙVkk_*C~#!o c2#<<~ֱ/{|-!xxklIm'?\uf?bmgdʧfR_Ԥs*Zy4mEO?t,4 ;fMfAؽ'#?ڏŮݲˆEFQ߮@b*1GLWޱS^!w+E7gX߯?cK{vr/g00A7Ix'Y6jWEl Ġ~;aCdqPAHHᴞ jKx W-{(aS(e$&!XD@7,Ej->ӓW{ly"L ? -@,/La-"e,U,W,Q.)Ze[kZ’=8/h'lI$=HHM@KiiTj[Z"ʤXjT̉dF&Zbf%[Klif[,KJ[iklvમS26[4C01ami\jԵFuJZЬڪ.9*FJ#cEmeqF-)iPm*T*nYVKFk R-ml֙\EWiQB֚R+kFimK52(c)K-f0Zm6Q6 mm#ZZUaK*VjfU,\mB SmSu0qm̹U1e)]`fjDeJ[[mj[UmDW5Y1\qaڻE(nq2f&8:ҩTPvܹҖBD[XjBLjh [mm)ێF(қqhpˉ(k+F+vJeUi[UKT*d B|BjI @ HI@0b(h!  >cBBL bt 6f 9!IMˁ+ 䆦6bPЄϡIcaV$BnP !2!4@>[ a@ rI `B@U HM-F I'4@3֬b 㫙P%0dR I2$t PpL0(EL- YZ!d)C3F(NNx;SJnf @)x 1:ϓ=iƛć{b72 $R !& @̭RTa HJ00XQTgTb  TB Mj bmЅ쐦@ )1ҖD&~ ?)>yPԊy%H+ٞdvl22ŋ"ML=.pzNy@c)Ξ0½!>XqNVoRB5"޺HIycpu$$!;,$wd̒d!*zf(wL6^^X{UA8ÒvDWlpzs:1u-ܦZqJD3 xa$S|S$I!B@7 CCb|OD;-OR\j 9j 0B@D%R(to[uRfJ((]V)db%dPbMrjE 0;Vql` ITIͭkm< #k Y)6܎5{˷Nfc2wOs e0!=3 O$q) &$t%BHM n@'2 &I.~]H^Hk &c @]=r^טӛf4))%3(ThFLʱmI6%M5!Mi*.&隆E/`@W!C0⩉DĖHMIIܤ:fBaB$2e%-I $!> HH\ɌEq& 4]ŦfQLinZ9&[+Q H\@ dpZ .X[Hc$HI 1ѝ[̹l'`@=qOnHdbc73启o"iczzQrjde1jkmD,1d1hgPMI$>3 MI I$6 ~s T00#|󌜐]%i^1&d];kWZC4C:ooI $kArH@zPi e8Ըs YyDFi7˷%B#o2<!5[\Ma awzi(wztNaY1>#|Xp$$TBRI3 C&BBY'ZZW! }{P춲jXR6mhT* *'\'w $LL6R])ׇyf1G7;B}2=QofXy|&0蛶\"]15HVu3kLKC:s}h)ll "^o' uIr:1sveJN89*@()9ڄ!!qYK$= (P>Bi9 oh$`PZ至+ T=>eu&5m mCP=SS9o7qfcS#Ot )8]SHI:HIוr %훲8̫96ud&Q&dR(?_Y$$>>$ 7C0-o]/[G޺#niOF^^źEw9 Ѽ8[7wЮ|tXIH䝐|K Y$;zrܙ?x;s%S)h9昽Wg\Eo}l"IֲNz-tfl@>gBIdNaf{'ԧSZ^ Jՠ.Ij?7'wc$y;gv.0fu$)ۏK֪;0!@ $H@+3mύޙ:I1d$b좄Ӳ)a@i0`m6$BH3$&C*hX LH'*~ 0;Ap35_ed'151}xRNNa3y|fayi0H\s |SS{g2͸32@U k۶zl g: )$22BTI:`!8B,d J ^ Hi2L3IK$Ê]3 v, ,R(ۭ{O֦ծꘖ(ITR "H$y wSE;7Tީ˹w}BI'L0^fcBO,$6g3>9,Xj l@`šf7&IfM)H&i3DNüQS{;ZW)ť:ůdM'Їt } u褳W@q}p.tmQrmUa![?]/rg3Vffp!!==ğ%'vw.L5R]gl*{m}lS}&Ul*v;s͠Qܲ Uu[lr=@y@$ԒKo/ ](CdZbHBKL?*z  ;޵ocw͖Ly"&B)*E*IG-/9}!% *, %,| 4:'\O#=+°]*ݷq5~y8o-">ێ2gIEp9wi0ѷlKw(+JWrI]fnzl8Up&{9\t)緦2qo:fǤiRݗ`C&/ $ !r:vx6@|` :lDO7TBȲa?E CFzL(~7o53kJűoSXܫ{ljGdǑHF^ 1~{y*@ɼ@ \od?\8Ǹy6RUoy 3ku]=W3Yxٶp6'g^ kXlζ۵r8-{dlĊtuv0"{}^=zLDN c<մOK5&gChBƲmZU Dg1*4;>qɩ=3nio\4}wh-p5G(u 6 ryVofzygI2(wV{IT0j@bWe>e}L>p۞p608\\3U̿LJ6VO+\U\qhڵ1,kMyPʝ[~jI= IV9m,>]:=кoEE75z%0N~lCv=9+?7L(㘴%cgʽIoNMiZ/ ܬ)1B@ חkwmv.{Ii;rrl}|Woncq>44v;ǝLQҎ]<(l<QɨV.ȯ.%r6 =ɞ+b@euWKEȒ\͒^e^^&Ai=]+YSQ5|][UѬvvHo] Ű1ؤ(}~K`M#88Jx害DiK0D??*w]V SJ.eYFh$Gb{K=Jmqc^z )={B-rK>_R>ϵgKp[Gcz; ǰRZPwɭm ?սJ#`uRCqR!83ʸݗ<ҭ:ll4_D[Ybd=[ISx6[VU.:1m[XxO=2R|IT[/Z:L^wf$}RJɅoeu |Ͻ?C&ʁUsX :Y+r% :oxTn狘G63>X 8ɑ1G?yc>j2MckpW=.Uz} {ȗRdTôYWC]Z `[F %H| K'QЃS$`WɆd(pzSXݛu3+Xǯ@ڥPS*a~ jR5Q.[L2ȼ^I8^xQn߯hlNK(89ZGi(Bs>r }lJ9 ջ!٩X>=Ok՛:< ft,q؅v0#lnrG%>=+ᾺW.r.jB0$ޏAD&s)|v}M u@ _P0yEuڱ}W1@Yֻ>@Y" LS,!J9l`.b=p>O+.DYog *lw41E_FІAʬe1X%V{pyO"K qÒu-RX3*++ YuW~!T卦t|~vYFϳEq`}T[gO LSi7)h_G^I<3$8/ < O57zL"E<\&ĭ-,I  *>Qk)-BѿR^bR3*8ףZǺ0: nX[?o}{3l.h3 pP= FKx?vw | :kUQtt}d=Z;w m2Ҥ=5j$kYE?t&;:>}Mʏ=:8h8T9 %ZN tqd$K}8[ht1Ý/5?ӧL$E(Wmۻ9Y ówv`jpOaU{ˤbբBF5 %>utBE{=#HFcav0pI#_D$} ;"HO»;p(>p=I_5P-$ Wnok] =_JJ[5y7HGx<_}SaJ XX]X8M46J#}YwmW\븪h&s\ ӆ˧*vHr^{TC=/=xDJo?$vjYBIίv&d({m^GC嫬N:Dʉfe;#mg..Y982dغkt1=e;6"$!#8*ce˶ J_ɵQ`? I~co_eg.n5Q { _w{#_ w f<99*a sSJSDUUn-L/A:||mulػ(,INYy]|K }R?uO"|h XJw>RO>[`u7擢wD' 4OwE2^瞽1$$lI>>ͧ oc_MyׇAbvR:Ncڥ X`#nϹ0"fE fAq%CYW־&'ZdvvbHAuk㪫p*JpzCH;Dr )rDȯv嘤°A#NؑtlLkG~n/PIpK_g}NBnKk^*#-%ʌIa6k~^K@_Eі xYhH ש]>4Iwl{W͋C": T+O5Z I4W 6G#F8.0_(a^㉀lӥ%{Gv[ QR-MXɏTxToM/E !"vk@-Y~&E?& uq tZN<`&VE&U7$#!wl48fjwН-Nسߜ@--zΈL& pC!ssG%Y&a%xL~>sOO|A щQ) 71i[@?r }MˆҢ|pP`25®Ʊ}G$U7TRيܣ(9fnĥGm)(R5 eFiesoT"[MVg]B\|b˳k֧^vCUA XRW«S?y4ȟYgh,̲&:<"1-9҆JK>in\I]ִ6V]{l+*ɺP¸z"(,Tce m_専fzTH ]5=f;]6gd PlCVӘ%&C"Q`e,ghTe.>.HV&0tr01"@XI$ ISy?j^l!?g⥵™82_ȑ`dYbp_8up8}'}*(Pչ'v-QŠkmu.$^l0Wk@R0dz $ [L{-&OiHYZ @eۍʳ%Ts%%Y@I_]V5ޒ (ɛpFmh|wf4c@9 BvԎ瑶02An֘XLI 1a3j>J=9@İFK`$ ȶKKgd_ӪpVe3. Ԛ0 129fk u%|e7 1őt*ox+p6W/w6bYYkX->Gu]bO r_osRkA0GA[7q(Aº^sU'=`@21j*_f[יZHz7{͌uŨ;iwt:ATҋLhV[i׳|Α[ Fq~'M pc`DlРV|ḓu3,BA ȉLѸ(XN6"S{H&557iӶ -c )1IѰNLyy%ei-PuHT]]mƵ09-X.hHu./b "x, \O )D$<ƲSNٝ}[oJg"DAX:rӊvw'Fzx"X&AFXַaڕBz>Cp#g`w_vge2X- 0 gJ3)K-7|q@n5 ,ЗކdQR!W XTD{l-kFơ$[ZXw&S-'뚧0hXP( J0jRL`d6 05BiRdS{gC*悢`NDъFK~Ң$ J)9K(פ9q±30bڔuÜR/%3{'j0iCSXluYl'i" 0B%inK\íjf&nSt=Z% EZʪqCMᤔSRQs ( Lд@AYޔx/"T]jhMOEqkTEBRAs-Dֽk[@p5QjFq5&L2d 2!*!0HcQrl-9&&h=.e24uҾru_Bd_Tb<ɐ8Z*5-@⠰@&PbNh&wqiv4vvg"tɣ!^. [WUG;Ό'*pםlQH)!~,O:[e秭OO|:w$;Q$.Ftʰ 8֟ &'N<$!ł >VХW7)}na?M ]lfh8!"oYujIl׼#eJzjهo"±5X4a$8 ,d)3T(!q>c8A @H b"A3 T×EiXް")KbOd05ĮtHa pF!piQf96B,SiN6Uτ\5qԯc̃HjRÉ\Z\KU$N- -iY(ؒITZ#p*3PyηZ;xm8`W+s2U;R=زr\:g{5槪X;;&%*8X17m!i8%31 2fBT`3))K6c v, aA0)vHU\ujj['NFMxݽe0>vxX-ꕂnJVSDD ,*l0f_uv!${0i窶FY(aSB!3Y!ģ6i}DMfଖmrjBc#U&/Up6;k< #q [St(j. ]76;c^7rI $x*vsicрnWVIUL)m "ه:t NjzEkQE҄IlaUIlHqFƒu\12,d~z]!@Br[ bZJd!9 dй01lzA W3D3Z:)|w,]nlwXkolVeg #W K&]D)X l4ݺlIִeYD IuI8G.YYI/~9pp5vpS eDZn0`^%z6T t(73b㍳c0kstZBHvrH1[3&H/ 瞫27v2t"bCL2Y@12m(iM1҃+Q[*v+eMWpg,ړE 6aH<"aaAp}/dNQji_B-a/5a}:DfB&t= M *tj!.DCK/sr7dDIY/Y1:rg-u`1@*!5u#ޛ魼-ތVHf2FAkLuEA˜jŽ2}1 .ӆ8ҽf u<< ( S90ůj+ ~KXXZlI (QI vK)1eY\vD<(0Ri M|a)Qs$61* cpi7u6[/%A{ݳ-xbFe,u`KB:E a҇֐ʤsMLfhFAULZJUfUVJHc/\7 观R4!2T/X܁e0&l49`ܮiaL_OgZp"׵4#p֤ChLhǭ8+TdWZΰp [Yk wӻZYԏRJ2X$ ANU6<ʁ8Ӏ-q~T,Je`3W& N#<מZY4""! . v%H!-u2dPTϔO&A+AMtn`Y8#bSF(Ҹ4DU]rqr܀*$d1a:!':I7Y N*ʅĐXBeB< p88gHKBXN ԋKΧ^mXخxJى~EJum/9u qe)v@TvX3aN3@$ $jHĭZ7 CfbP"lJsaKHT.ʪzyU>R%B=`qbeՈg{(` ɽymwg||k@<)JP[H;Xμ48gnP_ةWZjcZ^4@'ZP]484>i`"&ĕ6tx~\AFs5_#T0BeI*B4B eNd>Wpfuu w@ _ QW}wRzSCn- _ٗbp̶7@ p֋Mw{O.W<^t7{v>t+8GA./inm̃kOgp̩]B25@{ 5m6#;L kěEZx22rtם: Y@2.ް,ƙueִ˹9|(F20r25?r=\<x=vq!r9KYɐ^avs5壖uD(0r'[Z%kwV8קW[۸@9 9 D‘"y;]06׬{5f ^h o,;Q-ˠ{L,aBlf#ccͿ FFn8k7pUm̿Ě}-jK"$pGe:Dr͟[N='j$'7m|? .kTr-.H&>xڙt kmK6XYZj%' Cɽ[?wK6XrÒd`C} f[cٶ'!Lj"a,B pELX(nzNIG^K.rupDh ,,9—KZ#T6\Em,Oїaf/Ǣ7%Uñ^}O2 YqǗWo~[!<W~"h@47rDbA!!t{^cJVoӿlqA dו.pӊB_u7͈;<_֑ yE#Wf9U&T|)r(f Nwd#(@ d ,.raE#aW&!IpZp_NF)M|i5uXMJc *kwFURNJ+Y߁֔=JT n1Tb<"?ƺueӣ<<8; M} ;}]J0%ЉR!`xE}$Ĺ#nEʇ|؍dFE~s {:ȌHu Y>|X3(7m4g!#B_o5Eps.-%HhO ڳigEW y35QF{ZXc*vʜ-ׅ"ʤu(rٰbʰ?E#>'eqrϊ߇]{N,㋢|sNy2?ى`݇1J<`鍯`8ZRǓ!n/aoQ"9zІ9kdDmIiiɢPi;W"̂ ʳ%y޿< 8hzJ\6ݎ *Zɲ3Ez jP↫i h)=ͦ),2ELFgdc{N5\bU sT2I+:=u,L:,bb*w>^ۢ-]kCHd[T j<̃_پm.D[L3FCjPoYp3h|v~fS6NASF+Ʈ_$;Aj,3F5bcJɫҷG^3|B$Jclʞvh?չ!a2ӝc.(at !ૢ\-$f+Ƴ5&AVCJCάa>?qQj4[eܮƜt5gt[h=zwX*l-Ar!PN w42x7r: =j*{kȜFlFWˠA%<>Z/%[uno ?`vIP:&b%u:f!j{hh|Br{8Mj5,i$Wv0V*l9Nz><ڂ8IRɇlk!"ı5X& +dy:85ӑs`hȪ@>KPς4xtnyѴkt;rݍ8TAE+ZKm5c LӰk TdnLӢj^7i|p^m7K:}MjyڨBEx,hfO"BUѫ9$9Փ'};S/.FƱ)b;4_5<N?TsLA}6ŮQJ#(DǮ"PV|"iNjWӖbk7U5vK5XDj^ce&d-ol1I͵`e}KOk&0wGdr\kjbt#[co3ֵ֠SPLq F6[mxT^Th ,!Ƕ${l VJ&:[x(䐽zм1GY}8; %#"Ρ!s>QpphW wfNvJ\IL>ݕff-R܄i m¹8-?*;1/ Yzf$Sv V:&ȁ,5Ifat#&" f|Ln弗'Gl06̉5yi;_x-Ŝ"39j׮huP4ЙW+}MdYp_g&d4Fgޯ6gS}k+k+nӇdJ0/XbVeΦNMS‡]$cu6.J\OIE=n[+:8}ec+.x֝%U}/ʆ[&[ڸ=1hVI R$̿K9m_gjJJ]ǍQTc eb\~/ŨFq3S0aHeSȡT>.E,G2HU k1[RȑgfH:ż(7M10$37\I1BeZ<FHΏmiaj6ζݜɂ{[M8ERUǵ{kߓֶ g4}Y`#y{tk]z붻Qi&ӥníc jҊձ5#Nv#GâbwrL[]( K_]|&QTֵ1w$kBX>wEu<\uJ*4DnvpYyԶ7 % \t'E:TDiO S[veQ3RGRܗgS>N=\ׄw.6ӆ?S!,T aqCz p{j1ˑkvQW+$\X\} {0Qp "O*.]9!fEQE%2xg,8 yctB3Qz" +ͥ˟)p먿5Ƴ ,z׺9me,lFro_y|/vͣ0k%dq<^T)c4vW X}om i#&anfOAݴK1ȘґNS&\ccZ58KijEAC{‡~KQXN3+NP,;-|(R-uCq=ڷ}fG?P#D=kVcVԤ$Cuycwh$/dl^՘{؞nEpnP\9ѐ)6A!(/plVAs5d9hz[mĔ%df 6&-Ԫ lș=C\_9@t7J5{:hJ\{dd@O]Uq:Wvn~-|3O2:͟'Bw64P%́*DV <$5gdM@ՠu2kPj rKc >*Fž{͌f]@(@t]b(0:wL'gw~DTSw|46f>\fRdDb7<ޟJ}a/(h4]PRr*GQ'%'sâo+Խ"!N/Mjï) @(_5[Fazѽ9{ xH  16 }cӶT/A%S(: kH+DVwbHt-F]sqasom4 ZNw;u0eaYkĨ:TfjO(/A B yLCȩ\5ͫrR+!Qk+"T\J2O:(>bߪ>EHAc{TSp%Cvm+6'hxJ:\ l<}m ܉{Fr~*#VOl"h &d״4#K0 O<7iۊ);r|Owgy_$jrHlYSȋJQʋ*1F3"c3bUȟx& ab|,dËt6aREHfOtN}_:=˗*G/O0hVe$)vq|} B݄ WsxWE*V2Aɥ 1[LJ9V_ oa|(1%8]S1횰͏"[Y0f<|]:s'i9+wGSWi~99=w F -5ƽz-r2S=eׅy 0OB TD<)&"ߘHD| r87fF2=3=bܝlPU~A~fNu]vqyD y'<1XL`z2Pm}7hDg@~@}|b^E(i@h_z|/I|_ { "F ҆x ݥ<<[ccy}}O ,xtNn=:~n/VQ3(&}=<&Kԥ3ĶeꢽmF5NK,WW_14Y5ø6Lō1SR#JM f|K>2IP\iS?Bן-8enwAᾦ~כ5 #]^wHѿC;J3)05|V~p)Zm`zL1<|S7i\αkwq8_)OwoWu^^.#{vtnUtob}hXlht1״rBp^xCׅp&Els9NKΰ{(DZ_TW2m WkSw;4[jF],mEy8LfhK+}t8;}jj]Y3OҲNe&VW*py{ B)^T7ϡiyW|^䗾N^PؓlE>vOŎ;" -pB$VOD4,&ax=@=|Ȇ/Hh7?'x7HKI7{ziLTdDot?ﺟfHku$-ỷ_5wVaNdZ =9IF/lk*%'/ߋaEi*k2m:ߢ1}SoW\HPp;V_.uY-}y]=MKfq [WEKiy??6?Kya S?Ji ͕,/׫}CCBL;g^M¾fy^:'~kcd)8\xzϙB_ I毩DSqaF~:r$u߮{Mc=01A7}\Wg觞zU{(|\]ū#OÑM uÝ ¸_ıQQVFr{Cpϻw`:gXo-LYq!Y!$$E$mIL$ 4Bi d~c:؃IQ LĐ!'BC`C2@$LNRCz_`99MI&?1! $8$n4 oZ2c~Bo󌆪$3 4lnjB@&ScY3Px,0pxL&B8$زI Mf UCӤLLL%칐ᄙy:vBBL,M!!%06쐄H@$[m~}v,LײB Q l!!2Q IL% I3dOqCYg0$ʨHmВLHg2 erv12L du,4RQ=o/|? ?!RReb1d*~>JwYuh)>y}3_"ԃc6t:[G ߋup]1*_ rw -â$焋?_uy~_~”;2qWɑ JmUsGj62F"ߎρ"O."c,ӝJOunE7 FZ_2;r{jʷoϧܦtz$Ѳ3u˗ecݩu8ӷ=~Fę}uzԻ}9p׾*2ƣ2|ʗ2|M)ONbQ'fbͼ}wH_ݷzct3WǛduxG1I$V^u9ںlp[g_gY j( +~&9IEy{Mu8M{qz%CM,bVJF)-pz֛(x f* [Xt^MQ.orMoצغb>ӭ;5I*j{)w㲉'lĤZPkB.))Bk٘aدfg;-{;A=Ëj '=dueƕ"J+m}WID\dʚ4[,)?]w~6} 7ShzP9Fo=o.bJį4c_D1-Z}9O1W㳴)wZ!: {1~S}q2o?vmK~v.򠮁2HY !C4Z& OqVzwܛ*NW#A^^T1"w%1v]cm$+l+d?15C3חM|_mLۑ }i唴2<ǯ$w@z27|jȑd )s~g\o5OSM'[|]VE{ef̹ʅΗlz!6gIzޢG}g-7vs?[u2{q^_;xvLuxdtK.up|>g1;7ηvSg}wtP7-Co\YzN !ŮW:j7r{Eͮ/Yj6V~Nw ~Yz 4Kk]:v{w+E0dj&? FYe_F``&A8i|20e?nP{ԣ1z/׋!K> (CX(k(Tw;<8pj(w͆=2?*J#=_ӇχSҾ 3 ΂5Z-3xOP |EGkQ!O7VHS^H,S(Hβr$$$HC1|fBf I@!$0bI8 .H'IL$>oʢ^I)'\I$H47&$BN; $MvII![I:d$@̑@4BdB@@$ $Y!8$BC- $126 @8D!`L}]9 HHIf0ݠn$x$$caܲFV45;b&MMo9=9rW /znw\. :ojQ|PvJ8:GGkQN\Ot|I_=#o>9]g+ m⾟3 &nBṘ GBmTͮ?LT0 ޢ됥7}PuTkmK;):^6)++\z Je~3YFJDͷR 06>|\S$ޭ|_C%õj+6, ܖ6&Q}݇RQ gmdN`R.&t#rP8$"G5ۆp4zDXCpK]oea2o' Uܐ/򾏗px9裑*>y4΋膸E## e?ٷ4 g^'뱴L]N/<|WG`1 L۬sIj夁 $(&YR,|J%%0?\; 4מ7ͦƍ0Ķf1|ԋ{Xα[ش8u3|zZ$cHNu:Y}Ia'S ׁװh y(*s؈ϒhyWV|/٭thl a Nԙ\5l,6̚} ) d@3ZKlVnޡa`9lM!LĆS ͘e}e@3* vz$h2Bk!)k@3XY Hh$>*چf៣ud6u HI@HABb`B p J HCɬXBc$/B=) oBO M/H)pL[(m2Ba ń! HF@̓ZI)&k R $⤄> HB́/BI ’Bi%섁HC1;CB@Cn@ $dC 턄 d`2O<;/RzM$$T d ,!dL,' H`I!YgHp~v??Z: ҿe/>n_v] +lUx]!: `kliޗ{ftbui"asC]ơ+4yBk&>dwᾯ1Zw6ndFbQ!dDx|t[`=,+ZHiͽ=$nųf{Rp`-o YmB}f/W8gw=oMMF8#BFrݐUs?nI6鸃nf ZAwn,nD4&sx^qE#lʦ$b*Q 4@F6Ƚ(E;0t[K !4s(z=Td32YS}'b)1.T*#Y8R:䠈Qƻb#geFBsF(Ҹw;4MK8n&kJ_P@$O%7 1sU<^]imDeIfKpBЭh&xV;L,Й2$6 3Ҡ,p֜ 꼣}Z KItM[ i`3^io ٻiaf Ab&I$oWst"s Б *2>6H_ Cj11UwA0`$Bإ8,m+S bI\ $V|l-g=QCia"󿱟?C _;a zg.$l b ֎ %^J+2ZJ8T"PS TN@c\WҲlQɣEM1@BgZr1N$&$ubx֥ 4"qFa"mE@dcf::peLK79."Ջβ4P̐2#$J J+_F~VPp?:# ?+\%kKi|cokgX6 4I >LES8ͼskS,O~s&S)6|EPa UrYX)2GRNunRo~zŨt: `>UQd,k{>/Ͼ{'@ iHJ1,5Rz.ٛˑr?Kl},#SLE;X kJ%WY8:Km.\tSЄ0TcD];FWܫ㧱]MeĐ$Ce2 F0hw`ɍ4ݬU{gF>&& VX >/,rOHω%/۹+ !P3@UEBRjBFU,(_ko|V45}%h\dSoힼD=zզ}[yrSиm[[tpz=䟟m&6;6mH)7P;d!{Ŧ 9)߮]DTAF Uç1NxmB` 34> D}(Nkt.{ie05L!y6Uc裘*6\Aѕ ֋F1j&f#CZFFP҅/rH7 X%x1y!B-_-PW:Pc2 m+:rq5We:"|=::tWt1h:d7y@౶즵sO#:sל=(2q9Tt1a2<017 0%kj2a)1^i0$#|=A Af^Û#O<$8 .EFQiO 7x1q0anVX2h F.@7%(@'R\ާ+Jd`@{|8}t4cwG+Ylw}~=9rfb132M]GzptV6[>2n?z3-KTXRϏᗤ~7߈+7eNClMF^Bw qy>*u$09v=NB,!""/FSy}Qрu3Yfh۸KY@o:Rn DlW'hHPh ϱ贴[w2I HX!rjhXV``{S&6x́Al$ Í7 -ȣp $ u ' z pĉ4Xa`fE({o2E6KG|EYY=4[A<>ÜfM=n־{7ci/=ce<5Zeqteʨ7Z϶{vXQƕ|g{:6ã}^3u +fʼӿGGJh.LMޙzʸtN\8m.a5Z:" KkÔЏiE3'g2~,9:|:xk*1̃ab|/X)5qEgkaLr)`W?#F#X싔C̘X~nЊ aѢ࿿؃9/rV"dffN]qi$ [^_F00auͺ.& F C<\'&ن2Khn=8ȲY]5JSTPM1T%=Xv Z 1iɎm ˯åG61R1rяCfO<ӡZ/,ǖ!0k>{G|: ؓ"B)&30!().I%oXXF@ fʸ!rgoh n8,5$!Vf+d1/δ"7u0Q$Ēa@a8xV! jQu'q[̙̔ .`fL `EfT zE!#/V*tj Yze\j9{L&7?y028i*YkY񁮫ܠ]l)tH=Ԃw΋xqAƄCf-XD YdXMBUہ6{3!V͑vg9fr]oÈDK]t.)% m1(s>{(jycy1=1s™nrv(i9wB b"bk?نm򬈣bZlE.[`-Z5A6.A PbOn\"IBR9]w%!oWT\STo$HrVc<3 `KuvVznOocQ;udY]Fej'=֥eVo>b(!L4rg$CG'La\ZS >ΏT7|+ar?ijNBo 0uUXwb?utߓ[G,]~ZkzeT0]}8Xw *vٍX8$[բwR8hE-))F0 ln,jD !0ʨFٽd&7 h,%2xαnlؙŚ^zcNJ!1,bmmpkJZga)T((ByUSR,r]t'5sFW1Ad Vּn$M$ {vGd1@CZ( bāvMmc@!ElgZYZS$zdKzZui#-]c*wlx'j17"R7PԔ t't HHa!LӢ0 ֵCjITED A9gO0AaeU}uepm[ nJ?)moE,Rŕ0-bWXC|QւGah%Κ^b*5 LCtBM᪝M$Q$2y9Fq_*ch\>v;m@%w+~7<{z &8zOkh C.ur-o*.~#GLG<}5ݱdGST|3pjͫ"ޕb{`| l1@icM$z*"0 4Qݡ̸v"@FECnu~w9:L+ݏ!reuM"YYuVٲTgb}PflETux W4P52I}Yw]ѬP3F&Wf"$LԲrm?:rkGe'}SfYLqAB@q ׵%_ё˚*`CD^e(4b{sBT0;}m5ĭ1\Bɂ;bi~~V=qʒo璄!NV"P  ҧU~[xE~uݝ7Wc{N v=Ս;^K|W(/\X_ rWjB;eLFRj.v_b /2 P󅍄Y$qqZ >)#0׆9 5ʪvm L\JKVfuIJԐ RAd$װ $!{ lI`@f@@RTIe {Ȯ\6K+^g?KŅ#^{? IS_ir!2>VY ;9Š3_s rUߏ T8|=r 7RalKek96Cu<4nN'|le%h@eG0bGCTد.`t( $=sTl {~bg?B;̠fB:{}w?M>FcfRDvJfE IX)Ǵ'>=Oj(vrbn5>)7v)D~;& ?Bo9& l3=t?;X(OơRDk:* >FNJY:H*B*Ny({Z H22$xW3 ٍ͚ 7*b`d0CǎZ&ٜ{lG'0ժAt͢2 5dn.cNͦ +si !x*֢CUdd5K&UTlS$=M/f݄$3Bd;rf!鐄 InPk.d37 6Kռa ,޼6HD*I$4u-`$ a DX!rB@fdXu$1D _mh|ۖO$AeXՖv,륊lj>jMjY8pޖ?D3 ?p9.HpT}|#pmSzex9]?j6N(4}ʿ-A3؉QIwwWrbt4a!` !'w_;0i?j:>ip!뿟ŷ*V*XFqG]vR䶆%b`[:l"?IHP_΂3Ae2,Oʢ(C2tw?yoo;4Cp:]NviƧ*4*w֍۞; 'cE0CpVTcjx|w&?Cah}6[)o =3?O~t?7)Q6 pRqŌ` FшCɒatrB˖+:k,? jG~nv+v2[k 8-FR?0BbNhB|N ~҂H D"q'Ϋ<>cI_^?=w|OW ~Lft8kwƓ?ÍtxFLpj^ >|.C&vY"(%A\P@RI @R" ( ,,H * V,"ȡ ,X*`(E,$P,"E ~ow1_ze}IxUO5OL_"HP@ז>:v i_bbL |xnݗ03>k#R =[p+Qr7e@vAp>Ê;\n8[WS.:kH/R[ })EڽoZdsDgT󰹜o?}Vm"7K? [[>anRZaw>xf؀"B A0%q2qP|Jcfq\r0`dJNf(;K5 ^FGI} HQ7=w_[Us{ΫW%a{ .Dtiz;\iH&*6%(/I O}jȺ R\ ^U<,.vÈ(t= >sdAE`sBE$RDTHd%dXE* ,X(" d?aH*TAH$QTEDB EQPYAV,1FE#" ", #}wRR:y FT" H`\.@?Һ!vv{m|+k+R]i (ܶ`HawMۊ;6́nz>AJ(vw5zzɡ0!dCᳰ[D|>mf`LEn7>1!KQ P>ϗ@\n,.ČϙbؖoL]es [Du؛ >nv ۏ. 줿 wgvB/Vex WS--4x›ܛr OZeT>}מDcŃ- VǴ'$Y䭼тF+ZH'7_;'WbӢ_Rc-*Y^Cwkk? l{Dž^a!)Ŧ҃ 0z1 Bnvp^l 1G44OJ{$'s?:kh噺u }k'd0M>?ߞN3@Z:9wzTd HfU$$*bPB)@ l$BJlt>ݒBYe3HL}O~<ve@M!vY5:m&2ښnؠR[3bi~_|J[);5*]U2ژ6 tvh~$"ݪRb*QKsNo1w"K=s'~t&ɂ:XJ3DxCw1XONE` u{p'z PڀM;VѼ }3WnXü=~%+uZ\il3osvIfpgjc}qK1&Tۓvx`@SBQ =0CQ$ST|=kΗon+Қ:@pS7|H=#^ efnA_bZ[cqZxV%`_h?:}~noR{g|~UQAIq喍qȍldKLu)WtN,}'p_nmNVVpr N-!U$߄lI=t{s߰qfJhjIs@RHt jgjh=wF*fcou~ @r͢gp5; TBMgbCPY"*Aa -Ie8x Fk^] xuP '$`CHM34? b+{ !GcBH' bjSKRg aBK!fԀt pƓM ]3XxCYY w ɕc5ESXȝcCR0E+lο"a@ '~U0|L{\6 b:&) G FD@|B]kr0/o_JҘ{If9,Y0y5pb mqoQ^gp_Oj )ߑ2zx?i_~e8Nb'ˠ誷`|@j?V7h]61V VIީw*GHGvH'~L^^^½HBrOmn&'~{ZuRsG7ӲtnZW`A}ۈ]_vГ>tjld:1`@EHobpI 8jQHD@# 9P,A_`# N *Snbٹ|Dc|,~x`n #)GF' C>% 曆42XfFP9ۗUj? + u>.vŕ#b1Uf# hUM{||.k"N!;+o2&ukԳHykb;r +48ከuF( :3.:^p(l.bs&-Op8\NTlض>r9[К|4=']`@<ޏov)-8 > Qyf˵\/h2 WٟX r~GEj* Wk]ŊD\CjDTX3F?{迗saPqM^XKĽIbȌ#2E`!̓T\#>͌vXxKa(a'zu=uƐHN= ~F=^Wҝ~fCQ6䷬!Lɨ:qb|7%AllviS:+h}sICFr=l7 wtw-Z%^Bw&-fv@$ɇ*U\ mK5Z7V/Oa8=DjNv92l4u&4^yk:RԙIUB"ӹM"#tmKaLZ1?͆%*OP@Coo#4]==KošBHnl`ViM(-XzngGYC2\J$dՍ*ȝXi}\pԽC9H/W5U=RIb\g^5JީLnZ9-.&*nLߍdK1QQڔT<+l}pH ~!Я%ヿS}˃Iߥ6;^dwr^~>m,|_6?-z~ 7}>RP@ofXUd^F޿E|R-fE4Kv[6 @Ď SzmP@/ُ;?!nynq{uApmoPxv]3W)3q/vB'Fc/ZFL?:ٕ˪4X%eىIi.6r]`܎;O2_TFa br) MEe+v68bV>c^cJx-~tϻ 5]?jz=[QU r^\,m6bVHY>kLo1;rʦTFYc2\fkB܊,8Sd#taFGΈEPJ` a56c2qk6$:sXh .e:lJ-ȵX#_VngAFd@q<#tBvܬm~23hƱ@i*jd37!?ɐ XO$n0Ԭ/sմSppV(fȒ$g7F vu#>M>ˑvv7 MdLXR`gX6Rƻʓ$.~]xI[ZKEoWRͅ;炋fҋٵs]|/ d%:5nO] ^-3o3pNܶ/ZG=yHHLJp  |Y`Plz Smp=iüTC؊8;e5>=9 Œ81$#6 >ezڀxD߀)6˵"]3\TTU%Ԭ8w LSK014*$;~{K7>K!Im3k27h hpZ *:m9¿uݰM' Uu>+y ر #ѓ ON*Gz2c7?'A{ŢC#iہe[~V?]:AoN5 e~ag)&=΢:UJ6o% @c0Wtqܤ-ȑsJ88jPIkG2zlڲΦfݫ[xI$!W ]$m߰$ac{h7TɓZbLn!xeN>8.zp @ f$+ ;2a@$5Hd+@t2@JaL!B@?P m UktԪ5RI!gHbAΩ7!,= gSIa` DI :<6MfCYܦw:v|vvM͔^8w?E^zi̓?E goNح2iIq㴌F;13^3s:m{|+0mx^5zoA9Rg0#5V۞ji4?|UMq>^5id0!" +Gdpb)@a; 9}C/k@L\k)6%^mc* ϟ;ks]<`$2l'ľ&m>V16Z/EE~3cZTW互-?`YH pZ@_3Z:I,vTֆf͈~ڢaP3]LucKY.6:iDvң9\(DnU0dI% ܐmژn&I3X҈#ǍQrq_(8lo\^yY^(i>#D3#F?VXZ޽ }r$mWQ5(w.N!D}q( oBhdp7-z^+oOp9nRa6Քu08 l1 32'mFrn:;0Iq8bWy?UCQhwk]]ʮ7[=\v#RܸX!t5(})Zɖ5ʳG-ƥ2T8REԦ V6k+Q凾ГƠ @/[OãfE۳rWXm)pѐH,w56'T4+~'.콈J 0jJB~BY Jښr sF(h~L9M+5Ί/ĸh0u25;`2؃&_a c%h4#9r4M H4bI_9Y>-&7%nM' p!Dh$aQ+}8Mfnj\-ъ:0q"֌w:ygfcgS,2|0ߔ)BܣuvqKgtҫv0%>f"FEX#QzBѓrXApIdpM85墁*UYAu8Tk? J0 ~p8g?=tEzgfJ䥐oZfIO(5040;d SD}U-fEl-w.| f 67$JhsŗyoX(ZϨH/h%YYQPNe.Eߞ؏tS3[oL "9ָ_\**"\^)mx2BuY*sC|&;oK<-aTYWW`r•['g_CxoxVg7wН0ִGK15Io c+)LQ!rȎ9A1g8/o.%'|X~m0CqW,wh8E-ug~b=t~_tgjP'_z` C)c){*ShsA6q;MwX RV !\R(`uim&'4=VK ny69gBu D^5/0 ˀי{ag*3c_g@caFN*fvtF{܊:Osk-w"[B{5=ƪcjj S'G8&PeXboNjwK* н4^喈@aeXnYMT57khF5饙zG!KqiUĮiZpJj*mcXkɡڊͰENJuLs=t9X1C° KiY͈1Y*KYn(SÊ=SkXf(WL)L7.Ž@3Lȕ Fٖݧ8ӚۍFX"靍o0 6q0 dC%%vShHXJPkޔ 쮪fQ0Ԡ,,G' ۴"$!@1ⷆX/Vr32V5hӜGBHV,lG-"ƆXQ!p#9dIߖM*n~w/?xYҼرJȥmlA܎8`8[)DžXiNg c~fK_N3g˾ؾu. ֕5miئv?W~@"ϪP[6 ;eʗKרdwGCцdIv`ӰA?'8( |gAc]')f'_a,f 91Ds`}!So̐- "&`0,dՈ-ve, is_ {*= []+'Xʈ҉d,F`}2Q jۦSIlZtV`F;TciG<PyZ$wx2_`In*Id IYl컳pXH$nKAB@FH 3<԰ 6md$3o2dtqp$ G ;{$C%!LadBpΝpA?zP6߯ד噶+઺u,y r>og˸83ʵ7XeꚤOOݷs<| _ 0[l)ꔸPٸ{G Is\ ą>5Riseh>LuKUeο@ȹi.UYg,KwlO¦r%;+CWq\0B˕ᶚ߇g!B&r͉v6)I߂j S[amuUn9q[zsХL?0 W#×J2Df̗6lٳ'J$r[D o xF\q3&7~_F26')"ϋwǛ+gv+o4~,'zE!hUFL`f-̈9d|?չוqa1zIb}aAnoQ5wLv5`A6K QDC@,,Z7I :V^gwmxK&養eu@HR0%D}m( W\ a ,AM%dyc^:\YLZ *u]~BtgΘ/z:K'|]3EJkoS4TAVгMQidB ?+GMRߢ4ɪ,?'?ٟc}@hi~k!|Io9*pE )#i@_uC]|2qۡ $@ b0o}ku|IFh{]=[޷S{MWB`Cuá:0ɢ(d8λ' >\^D*V!%-yX9]pI Q<6[V<coχgИng Ztbe0v2m%ivkfeS>F5bW4ni q/?Wc$.KNQK2!ͻ&LH?%.su ĺ7#p8\NF<;8Ɍe.ekc$8BBAuwȇ[M]m!>u Ǩ~}&^?3?KP%60/J<3B{j6kkk:x2_tbUuFr{EM; oufMʼn/TnFg̀L &,^!אKRakw2ީMzN".Z5uFb2pa~kJ4 &~Lg(~2SVwLuʌL' ~?2jUGSӜG WŠ[&yuBYo#O깊&#;P/aWs5r_@fX3R*]Vb"Ͷ  Ej̨M>pjvOv]x=F]0j}c(}=J5yk1<xeCG%=*AggTݒ m?|9Dwy-:q8WI|jPqp._`~;1_8)Qܖv|ЧrxFF;&[[?4aOzaMP@lD$~׊ hv]\!َle 31ycp=S@MBߋ>0!`soxn")kxvDHcxl1)o6-i0wsSm fTBiB j o:Tʎ鈜h Ht[eGy@RHZDv,I鲬_¡b1oM 3S%ݴo1\]4=ҳv֐;pZ0]_o[]^kإ]uz#~{xA>!:5[R0Y1oigUL# B` CR0Ƅ2*Mx27p)@d?ɯ*+SBك:ImV`~\ֲ_Z^:l8?:I5ȑqgGb[Ǫ"cuNnq|L#_i8Oi*XDER*;#AF1Qp*"eu\XƉS 52U- HnX d"Ȣ0D(Z2DfDGDDQXx1aOit0VQ3<7:9Mw'ea& a*k86׺`/.=0`k91֖&%3EKnq/T}&ĝe2J=!vna1bx]AUP,a=cc1U|ّ½e"-iX-QQI1 "*WS wj.,YRJZYjQR*9MT -6eLˣ DW ٘ԩbW* *E,zLW-"6Ņ-w(V8YQ֨f2B0f%b%˘.U$Ԩb/6WH 3,E1E!m%QSd-/{Nm*C1!3,§dܢx+2bZXW>51TDF0RR=+'AHhY(Zk(TA hbZb`hV嘕0AfF,F XMq2;q*CQZ*.-ƱTJjTIApͷ Ͷ.T-X898Â"qXrlvR׎eVؤQ h# = ΉCpf=V=$ ڨ# IDUJ;r{d78F1솦rBHőB"D!ThC D57*.@;_)1&,k9h{#,R¨tF++_O3$eFeU/jEK_P7Ѿ|uN7Q_ut2`5,Afլ{k\kO+ɸAi'p6T{}(;6].+>>Aas-cۧ_Wb d1JaW*!fL a?lut Z.i^@$J^{1Tgzg1YxK֯N>]-ta.z>6IPܛsC!e3_BI,@;ܻ <  !!Xlb!&ـO(zBOB5PU$=I:"ΩiSYRfJ#5pxIRk R;\,m}֐ݦDԺ6D03h @7(@U8̖:C~_w;*Ԍw"6#1_{O}JkG'kY0Î$zz )2J '|zamf+ DI[`S(dB-U`X,?a5YB@1 QP,T6<Dj{fslX ,Q@,%$@}T!GP0!:d%H I C0(d Xud{YY~0JȰa",UQHF0,D0TN"bT$9(dI`XT*$_ gLRXޡ(,F!ykdHS,:XET"O D^դ X*OYO}D+O4'awD{,!҃@غ??OdBނUUr h@kG*ĠrEauo=*ܜmp;0GoΤ 'XZ)sbI AQnk*w,JřbCSPlxxq@7Ε} A@1R "&0 @@R<7%˗whʅdԙ^w-Us#8ǶǴEׇ.UT*/5ٜݝ;{޸_t~nYJֽS laAB_D&}om]= PMe Oo{o2}xGc~`0\Ew4W|?[_oS՜~7P-ߌW.Ϣ<"zDYlh b-2Nq`# E!ĥ<8qT>0Ҷgۣjס5І!0@FM cwӟ/11:@X1QZ& !ojP}~[}nu=+29uK=5xE)J]Q(UBnv.W[ Iz5U0[qi` @zc>ng77 {͔塰e*ytIE1ێboϔS[u^Sy/#*˷|7vpпN_N`j =4=o\&9_֮LŠGOݥpPL '€ "&#?l}V0J3lԬ%( H'G}w~ .951֣?*%A֩DD(+^_[e@uA/=̙XCp MPCpB"R'ne$" h ]q/K69xѼ`#2#09RbAi Ԍ|? (<X^ Y-  {X AF[Ee9D cߪ` F6tK)4,OT Liw|YN&UYt_k?cScQm˪~3 E2KRJu8\'_o4R(107?|bZp2}>kA4w!"d(5n~Y0[mRtc|5*$ԓmv_!`Q$ڡ?s;J\ְd9k0~[Z:7qZYG._eBzTՕOD sZD/ `%D>Aqǥ=~$ SJc\Fz Тlf͟:^8H=*|y'fВSdHPXAdY"A,"("wW{EYN^uEFR.2d5(<߂c)I7.϶+֎n-f>Xy &{td>vOGvKiLM4#= ϏƉ; Ko.,J:Vk̵vsB}ήk4m 83w]N;u.^Ɩ k1k2r`hҸHR-nYRݾF n`YμfEb^ KE"*~Δ3.cs Rxc"0H /gQ-vkQmX2 ""wJ,kim$BnBD;J?ly;?/;dSO)-ZݛT@66u|(Fj@7<ЯZ&,uZX , 轴(cn*+F ڣfsW+T{gO6Sp+vsV|Lc=7vyΖ'ax 6u5?]ɣُq8s~0RtP]`;JD"sTS~+ (vJ +mEuʘAM3b0X(\m,!GYn.}AH#]Тzu0R8F  j%˻1o*6"IkdS'ٍLMba/.t82ٝ%/%вZm; ugNaر4#sce/Lzfm4wJB *uK_~!as$ ͓mz|6^c=׆;+.E'J0~#*"%,_LM_Of閏7!,JńUř PnXL$f8*fVýͥeYFI9>0HHuIťT؈-S?9Fcn\+ r2,VM0υw!]@촓8u Cp)1Ȗh_U&]]"|4yx̢hh{ B#nb:CǛ "u;`"7לK/& B&H‚uC˴ާ ǕVCn^{ċ~Q9A1vZϵj>,8]p%^Mh%e}䠇*h﷽7gVU#4AП*꺪9fYeQJpYwWLq$ZDž)D'ۢkH@_#4`Imרb:%_LJ D%UEدU &+#ScO!ĥE3kBnsyܭn\_@*W;'T{tF[6lqfDRP/ G<K@]&dZ*ovҀio5Ӭ0QԗϡGM <~`(_qKŔ͉}Ru}[=c0)dd\1vVt=8}|e]8\ 2" `=fB!@Ͼg0&P[]uFQP`ڑ6>ʇTgGd?S)ڶE6:+C2Po`XAN`$rRl(k+kd@wj]hG4"2r2˄`ߤ44^ӫV1K;uEKCM=λ^{ wugqcU [L8[Z- yt/ô] 7=2:dĸK0n ?לTqgӇS@  π%d ߕQC'7̢r;t~tNiwa}V5T&_ #,c!!0r'1uB1#^mh &3?Q~ՕIUUSqdmE_i'pp\ܡnua(@\O9 Zu}?gg^ usɤhq0 V>h@K\Ec {zX؍6z=$JЏ01bbx' c @+*RKK q\qٗUnS(\a5VK-kGTY:WR(# {|_b  _E|^/qQ&䢽iFm]]&џwŗIԜL w)jb q4qJ}}0ś(^ a (,Ϧ+Ө% }2CۤY$*LWh1e X ZtB3Tڐ ;CD C$]ԒBeJ??>ҥ%KU;1?NT|HL%;1?05E(|}k*(()N~woWU2Sq,5Y!o?uX4&*m[%K^V~/e3.C}RI$0=!&zC kbz6pf /Ӣ2((*"a gTe\L?2$8[Y@~>yfMa tF7yZdD"? n;-٭KwxH9b>/] Cf?C|x[js9pVT:L)f9:y"2FLDڗ}tVUAfRe9 6[wp~<J"! #/<Ys&zpytWUdl;@%aG"@2i Wzwh q_keM,V业/6쩹i2WlǢW@m^w*<|Q2랸r_xHWܖ(mu~̴Ҭ~o[SUr2VݟX7)k@Z.Ji)e_m  I2{9/z;m/Ar=R64ׂ7{S%)*B\QXC:Уn`n.|/]`Y8_br APBn:u^mسl T.+?YiU9 -t({"2EQ::@X#ܺE-)Yf-gO{5`<U\_MNn)' 'HuvۺghRo?c)>iw0R%wqH EV=PwGw~JC˪1'ۡT@DT@Ph 4PRX)rMvk Az[V|u41SZV_VgۀU/1ozj}S##WQ!] ^L^ /;>S f{_Ty^#^XO 0Wmm8RN3 q`/b_+X&:zO?yxޫu.OB^wS.KoY2O ul4-S&zW&r3%&Gkq/L5lwI?U}B |g-EEy돴K,`-Aj,Ş9^ǏO/N&V,XNJSصMB޺̽+J~31$ހz ?g۳TmnV`Sl7;as {7ԏ^h΀&&l|}JSHugxymqwԝ#_:{]PFaw}yCrw{C^@=y^Bz#‡;yc*ڠP>]P`5@$&W~g#^DoVg`Ŏ9G\O3% f =ӉW+c Ď:=HA)J($EDAzYU~>CKKFb㎆$4 DB,Y|߫Ē[bl cֻnt*Zb˙>iI @ Wxk#^n.3ݲoĜ\O\*$4 k'Nii>֑'̦VC>|&HQdl!ݞ) {.J" E.YEMB!rX6`})P"rj)`RCE ȩ) h6L֭>6d\K$֢pڴ/:)`( 6$m+$XcgSf7f_d8>6{Siz+r<[UOxC}XɀK< 7`rH0R}zWrؿr0q8Ì>@70S"`(UP츶ؿf3zٯ?[^_3Ӛ`°Dijjg) K]Seq;UQ ϜDb0gw~d|&oA`s5B>["1~A&廂Wo/hH4u%b+zf:#rտtMڪhlKKJ׵$zNy\R@-e0_|"{ @aY2EdVoȾ\}鶿#pkϔwo.SqIe,y6v\nMf2$mHm@<%ݫxd$pQ.`HLx #sK %v;%ǟyWRO/Nƈ6J\u3kchL hض$4kU2_x]_5ߗ) ?7ec?<Υ%ߍȶZ vJ9 NsN>JA2taxh~ue$zސq?vjĎ!0І 7TbH=hQ Dq}23jt#& OcܹR"eg2}=h) FĮw[U^/JUL3j hjA@H7a{l#Xk^ #IG?7Gtd 1w@^(cš.Lʕ*X θg\@b<6.P}3b`&nl/#n| q͛Χh4Wm)=֝U?s1t+tߟ''AUiaMD\7_Ԕnboֈzb3qvu}13}w5GD:du}V?Bw-Zj0/uFHKv{˳ЅtHz-[H!5R)H EhǪ4\[/3?<Ay{y7tGsU6PXY$[o8:#m z0'73Fgj>Nײ_cc|i;E)N8^gf|k@ ͆ۜt⏐pCY MA5 x @!;/e@ƒy LZC=O^tˍN$#Cv<^q3{6Rtb^9g(f/m;L<~o2HAEJQW$J.Adbv-hzN#oZC&0/>ZZ͊zxؿ9^W㆜炀 ;f?Jh e[`U,ُqKM^/_N$0u7ظ]槄T؏c="Z2uVew a <+Dn:tW2JS?lw9Jb~C!A<$3"ȠT(2>zC1=53yl{o>^(>\B_ntYwsFDɊPh"$z%+F)&ReoXJXXH~LË)dq0I"琾V n]( `s Z89CRy>zЏh(ӪUќc( (j*B5'BD5Td T@wn8fLD.:eA<%`Ac-rgƵ=4&K±I$tFR;n91T$ (H"MaL9C'><'MS ^Ŋ$t(ǣRL*YsXqd&UfeP,u02L F*^*O?NaljzRy3Κi3Kp_c͗@18 ΄>Vͱ82$eĬ98`'_٫lVVjXcޔ8y">k.ٕdD8W`mZZ7/ MPXs"VjY :f>Z %|rCN]k߸Zi<XEDw'ȰTpC܍;&>} q4XZd%ȅ]Fh|UC=r. IF!*%IiRj hW=~Rw<F4(Xb 7tyVǠl$4 PmGx!B&^^4T]A=n5G]cEN0n =WנKِ01IJjd mk<w]I&x]eE?5 s,%E펾/s<뒨 (};kx>^wm$xaZЂ9LDaĔ/oQ'},m}fۥe7f#ϯTR]lAFY|W@"gug2N.)ɏI,{L^BC#$6T>)-Y;!a2oM,}Gk?ꒂj౜0)m<1( Z^#3#aeiG)].^2+UcDZJyL]dBC{ teG.- ZU"e%2@<*$) K!ԾJ6d0PO`KkL8O}W>wgQaN'xp>/t"^gy6UUp !k`cFYOzb402QECJS.S e(H_=^G~׬ΞOmTڊT1 o8= aN*7t5n$<LsΙLys%E,Ņx/e}K8asWzO+|pjd  Q0 lhh2$M[՝[V$ݮk!{ hY"SV r=Xʹm!GQ)"53VtoW[x\ ?4&0 + uu! 'ᜏ h6ju|}񃐩H): d~=#៹M:JgGbt(7 Bu BmIHX6͙`Nmv(a®kD3pQ.C}5H(EҢ0c ĉWh4_ɘ B9#s|I^;o-Y,WKOəg]>X `IHQU%2I$'f_B=<Ԯ?mERdܸY qDcrrT/H"ʻP8 :]c4 K"{Bos ?\'70y(E*|a!O3ƠP]4SM@M*>0`<RAa߆M{}'s䳹׈+4`;+R L^s9X#T1TXQb1:\ݵ'-&|m9-_Z04 $ E>P& vbz|lˇR TCI##qrZ;gϴ∁"G\@TQ_r`TA@8WS# p56>6 p|o:ЀpIԖJf Zo ke?~5/hy #Lٔ kBx= h*{;[v6\!&t#'<ɻTt$!NI@c9jeB5m|vfߋzw]֩B _=u| /L":8GQM#+]T{(T~m'k6&auO 4Wq{> jbĄʸ'1]ۉwY2[}E;+?˛b!lSR8GpvTᘎYiv VlШDd1Its?9d~k:~%~-3WNj)A嗂4{d(ztŸۜԪ<`ڌ)TP~**.ZZmO3ԭ?K|E IixKGETudNqd0}X U1U~lgCccuPxw,^r^8 _W8ҡ c)kx&P7%{5XyUm{0z# )L1+&SQkPU jAe'xtݴL7P:R@6 ~-~ݓ^n 4Rz|y#x/ɬ8̬{fl8ݠ%,ҫbOѥ _oOLw6|I? @]K*2E,`l~^ 3Uv(4)}]Jjg_>DM@9Fh:w !q&K[%2z5$o=h^MM([^7=`-x]W*pK m2s:HOsRq %w }{y`<>WfZb807e#^#>ߎy xR]b}7$ Tʁ3);2 +ҙ&#l@эw`?ǯA42(F:Ns@H;9٬Uh'&+@wzJ1j!$LR>2k?Pb c* tb_RC^=ˁ B 0@k]xAS*n07'IkQ+2.̴KN1|merQPo[>eùc;3xQ)Xa\Xm`V~!)C% 'H7z}"Q~jsP}.sK [bo87FKiРYE HhXJE`rxOw|LAuuoY5 ]kd-!}46ɺ):P|Z/ %؉ ` vЁ=wGټj0"',Ȁ"B@BUH@DT`HN!w-W`x?H{y@[kƩmz"4\e`,C .fvWxT"9/:m\ԼI? ~71zڞ5cYm}\9l[xFүe.\U$ÎNQ{ : eq<0ViaE2*#[g7r';~ٯQHmÉSn>AY] AȓȣN FLZnT&&N邊sՊ+߯/k@x|7B>1uf'1riHAHςPt ZpCu52d0XDO.u[2wX>ie׻GV_5FgoQ@Id7?zG^G%iʶ9u}wxU UB-kCs ې;2Iiy< ~{M  ķ6<)2/zהQ0{?E̬Bp&mTwR]ҕkX\[ysF@o-02ls f, <+DZ8fQm ퟫh ,^ 2uWa]0z_٪jy)*V);C3_+WChҡٸ΁!nc*8I? X$!HI&Vx= W˼_qF+A{txh t_ω-Z"UիgZ?0xY  r-R BWd@,ȥdJYh\VCFzx؞zӢ/8.{__geQXjo>̺mOfgqvt0Idbk>x@DB08 e71?ì "MIHǮ5LEfY;Ycd ?3 oBZ Bx^.gJۦw5pd4^ =/i>'Uw xVunIs  v-l V@mu١Ƃ qPCoᶟWɀAަڬ\8,s7k|]/}gܘg! ˌq4Y-)|ݶ*}(ry2x,'3UpvstnqLC$rW(N 6H 扠v ]cc7x 6{HapwC0uK!D@?ѣfk=ڐQZ<n~Ly orcnΰ>35б*{b(_y696"܀.fA#9qB @ ҦrfTm%cS> YwŐ뀝0u<󷯓=fmH:=C)l%oN>݉2+A<`Ɋdt,h$/{6-޵.lɝ Y2#ldB~$'NTؐ%`~n1сơ^]{{qsp{o u;m=M*tz|s^Qga7\9g5}7qSt8^4_Zx@7 gRVi.5 XgdD81A-p 嗾'G8B6>4dPuiI)PTAbD@y7DP{?=J OMv_RQz 'ܤ!"Jn_?@VP{~uDA E,1$X,LiVuVLx*F CP1UgV^.(f`CA-l/YIQ0^-\|*Q8| إ$?eTǑ\tzfmE퇙hsҀvL_2WP^K"h~EKEoe JʙeVZu~{D]8:[Cc9qƈ>CVT2b ,1quA1"ae'<A r"bs;Xu%<\j07K/y;vɡ@_MQI+Ѿ¼^ 3mֶ+ o΅FaXMiOn|mXsem1-$,K1ٖ `mOod{ِ~4:J8uQxY+iYz*7kӛ"MkF.dKˉCe{+!^~ [ԜzS1j&N_ omC1E8Yh%;y_K N|=}b+z*:"SRdL8U =JL&-=agHŒJ.d?a#Y:^L7Z"T ̸vevX_uUX٩&rjlޣ+]1Cer> >b޽giǟczyњ+tk!(7#Qs\[;%4S 2[P1`*="-[yD k'xn)PCY]Ɔ<'JC"%V@2<AXՠb1ASa2bDPya%b(9p!]dkзݭRD#,ZrXj2.dYv X`W`̀/2 Pȣ%}YfX8OUhƒ &72275,/~DP4pkSXhK.RsB"a/2UVh6AFݐOaHZ^ 68Ɠ+`N8vjb9ƅ_[Dp zխ2X"N O./;XjV- q*ujReQ[ h Qn{XǑ p`o$"HO VFI $?Lo!!An: 6h:^ $tę('r~\+>H@M;1,Е*w fX1S4=FaGYdjK5\CJu'keSi; 7n brEX͌J#D\S%*"B]I;Nh|g,- `cBG<QLN)mKK8JHeKsMps; X,NUMqv}пǭʑom6Fsx@LIK?vQn?.~g<;X Bm+Z;P>>{U7LԐ(gZ] gYHF( {4316y nb%Mx1;2~E%MLi9\KXVUB#&.%һ ݡGKŃ>gMO2\ /?S]c\DE)ې mVtVy32t0\X\~d~Q$fH$,a4!;\01Db,]16eblP4-f:R5q˘Q>◹ҋM%1uӫ6Raɣw׿d3,$ySafVzS^2%K_ZCJ% } W%,#`ČE5h.E Xb@p3NpbDq>upcXEKT-65)d%hB4kM Rs{cg1hzZ:F=h׌_ 4(&Iw ƴ_]JY[o1»nBSf- u]#ǕjGP`m{"1/ |Erm3dr*9HCF[+M+DB$k5ReF9 =cB7!4j H>/*mfycip;xx"Lu1ʓoB(s+ Qq!`ET$Z!Zyc`* f"7:| w$mkZ2[ʎ FgWtB#G~YhV"ځ W[f0/s/:/4bʃTz˝Ġ۝w" "Yuؒ:K^="B_Ge҆DLRcf,LיZ9iY6KI ^i,LZal^kw03jjȸ3E2 @VIj҈kT p%F?X`F$>}+bN!.ZGn b+9XYGr6/ ۺ֚$:>^r|zgv;-1yuur]-Yb,\٣2Fy6oa]] 4RW>b楯0{)Ł.l巁{pVxG~ceL0xc̩cZk.:Ž;d qIy)jVK Vg[djbaGE} #g= lNvwdo[uv`ĨtfXgti$;mGЮ!+b0@8`6y5!i!Q(!u&" p6cL*0cБpDJ^1`ǓK#Q/X.ҷY q-E`0w_קWk[f3-DB\ N3+5;Vh9ZK"+{"&OEbK^Ŧ˛PܨxbVXfsBs +Fl* /,O';6WrۺcVGbպыljsiF-η"d /jJOw7у F"w=(X='OILZKi1AA' iaM貫*#x~X0͜xG%D,K,IE^P ^qmx=D~R0Np6TL=F@8=udfui}eݠl^Pⱜ F79zF-ϖEe@`5ٿUZ7X-bxx n IGbPը7M%'Dy6+aܰ<TdӔ xoZyY E[[RDǞ[4Hvc=xen ZdМ0A}tf"_@Bl ;/ɲsBaKVZ"&K6&T*Ƃ 畸Z! u 糭kXzJDRxa\\x%w5 JR$lT~k;[w: n@2oC"y $A`d<-ud=Dt7B2@xt MC\D9ZCzH=d+ѕXy~Kkq,67E-{h@a+GSȟ)c1y14by\V)P) zwN޻e'7,oY0Uώp^y*ڰ3Qٙ̎S;B TL8%lVLڵlqk=EVxݞKgpl]ش˽]ʊ(cZdJ\uֿ%<1"16$?аЅb…̈:m0+V4e;+ggaE<դ7'VȓD[%[ q[5](ܼÁZμ\Dc6؞}yqE<[ ${b!>1ug3 +gAz@=/ B7qCXN,QMun$DVw>vA89`m3ea1_K&&E!#Ar% EX TFtYX\a/.y'٭^[Q`CQ bI02C)(A!N k#>1K\iW4 aXF62l3hrz獐эl`סk!ii lS]ZsY|-Jw|MaVgyvPd6sHc< rrx%a%O"njѤD<=2ړܔc^7<ėFżL܈x;eTr5Zȱi@U`ՊdJYU*\ՍEiO="EsiN 9|.Ξ֧+Xe@yrd ,X~ d<'*9SIĨ:"Lu(ā6$!jN #w\'XČCȨgEG\;^e ,hFFSЋO71Ee0qyDȠdm3cmÛjBLTqȪH)bV!рcqPIF5ӫWE=k&xfQ UO X&  #5Kiz4Fe2),ȕ'Hc5 >:0b MtEnuP^ 6N.?'ו3Im;iicgfe4[ 3%/!-RӅhFEE S`@Tj)vࣉL&zYf$kzҨ=Q[)T`\Q4Y)8,6᥃f ,"0(ck01}&FaRXvQ[XḴnZW1ܸyyxH+eFT2U tMh.U1֧9uԈnP8eC0cR6uN-f -/fvĹgg1 P`RI2$v㸩wҲ{1ntNwlw77p%bQ].% 5¥XW-K"!rH|q4}I i"W)I+eC گ{+d;JCC. ǧc !84ɀ9d1D)]Zy2UgjkZa9d X h+~lW/٠AiddF#!!te9/hiH֘ - 2Jj ^Qf2V4.#"i+&u-L2kHu9Xe9z ؿ[KWi`MEP8sa"b3 z2Wa7q*1UܸZ9HPb5+ԪGs1I|"ޛ̧ԧnR6Z1-f^en%Ho[r`U;&}w3_c,hR'~[r+ 8 4$IwÒW1\=vhhQ;Vթ;l6s^-,ႌ1Ș'̥k 67l`:`t|o?@sf.>'j^cZTw)[B5,U܈TG #utsÞ.v%چ- E{/]P0dC_bz*Nk2!CbdíVh̉E\9B啈TŶ;l(;H}֕87s_ƝFCTi2Ǐ< TSJ(ή).yrK'> !a\޼)D9QAe>ɣp/^_wwgdiE%DLȓӔlcFcNPPEY4/';/Ǎ!=& #F**$uL1@jjQ+zh j'7Llb@Etkf-\ӑb<<TmuGoaL W@­laaI\[{د8%U;@f,R|fW{g K&"9^no;mv8!;A& #&(6̜NP1 #@Z+D;ؘKAոM@,br:x[mS&9ËiglzѬ@hɟ BoXbgex!%xtl"O䒰ё^HjS3}@'dǥr/6f݇\Qnwh|JTOu|.uwUÈY0-rCPaa6ĵqA B^\x>s(Cxg/l#H'A&fV"<#>?XAσ*V@#|Ġ:'Hˈ<q!Ef'&f( 00ḳ3 n[QbY OϫJ5ߞf^߃AAwH DuK#BzvvVX-R ѕ+NSd:Km{xu hbgilZj)qX hAM.fvq}eR|o)m }aF-k\K˽Y&w1P`[M%'*Ϋ㦊6=MuW#1c;WJZ5,\NXy9$N}me!۰, QW:b:lɪpN ZƤي)#PCk_eK46K*b[,眬q DrY؉tkw9Kt$3Jup]~P3# j*⽒Kn+qzuc7βĶK.d7 7+q]mتknU@p\9eۤI͗fi$>o~Mッ.)"O6l/{,V;8=fLnɋkj:]bBͶ,'t@v>&6;|X玺 pl臗-w`fS#-1ٸqZsqiKvzaֻOCN0N B\6Ǭћ^}&LCځ j 'XvQOWي*ƅԸ d;xL1D;-_wWSIR/tH,0wQ0?ܟv XfBUTaTU:ZےHKX9\Rd!FQd4&"o4?7*/Ge0x,݁ty{zO^)KZKygn3yr]<*:X9TUr~%ayɾ><` yJUH[I@.A=1_/w9K`DUJGA` x~^u)Asa&$)4KaA[O8պ` ʹ g!FhӯI$HwI PA@e @(:&6 !q-XQfϳ޳feȩD,c{.lJfXA\@Y9nf;I\o{.py sG􉁙?Ld͘ڼI;+C8efz JaIסII)(*ϰdu>^v5oCcR _!'x& <=28&"n;]Ew H;HZݯf-"gl/?/l(on(⎰%74o4®hشr=8d" sC[U[Jڳhsw Xin*九ׇNko!!dEl $ֵy>ap*ծcmnF;VYe|/V[c>=Io2& =1Z}6^A5IZ2nj9&LÖ(1蘃ݯW?<4o/%q櫵'_q?9r;@OJVv& J+/ R''Ms1ڪ!{]j͡~|Ϗ8o:oK?rO'Yu9OS)06?^@=1H5}t1|_GY{ݎ׀AI"{KPcDa^p\QCy,tLdDCC&u>K_3̶R%@PJAtcX2˕ z _E-EbmEս4e̵݁#ԹzE$)`=Q"1J[pIH)~yMd-lkQC"13j}[ukլ%&(H@(>bhbլEA:,yjMqe5+5|\< w@V{?d e$,ʵvo?utgZMrw?$wEBgd Os~g[d'tBs->? 5a1bSk|^Hx'~w}Yy|nu+bFֆ9Xw;fjR:iw?7"!ISպ$s@z)8v.E'FG/M|HҶ-VԠ4n -GUST̃i ))_C ~ wTG=#؟`ƛcc6XPۀF ##s<(V<\ϴiAC?n[x#:Y-OG@XCוRE9}3j?Kg|̢o:wqʅ.JQ2MѪԪrה5O'f*Ŏ+ `d?¸Jw3`Pf#ek0h(ꪶ,#\ @]e,;$Fe zr,H3CcոX "4ɩ~)@i{.cF1u*\+yAOor/[~.9S cԗ uXn['~N Ľu9{f'Z34Ɖt933]߃VvJS4)VyęVEjj;OLD0A##9=;4;qa`k&;\.K v":O|6q$G*~onಚxmq> `FIʼn=4)VY6`o%GO u|HL 3klufPjӾ7?&zVgqюΩL18 pVaH590ĨOq! NU[kױ&*0n2kLڷ(őiDQ"G]"R}1mY3̣Rꘊ/E>W.N'JI: d !}XQо 9:8zكb {&4X &,5cCb0Pq\ 0]pV%蹒._RIF<:NekH{{ /&&.D"JR]du٢ݚ\ኧȔ  df~]??t^=G~gqkQ< rœ-Ċi`u\l2 K8( jNd>>*$챥:A"T)]w-u|f?ťa$'D PaK{`rKR1)JL>R:kֱ7RTQDD J),)Katɑ* $d(8Js(cB1Oas{%){&NNF1d kZsss#?_gPK=߲9cxV.ְ 16W>eDöfbg2S" D`v3:Om,& AW'y zZZ«~vtd?H\c_Z޸Q_oM\YzA^N+Mm*\il{wxœ{Õ ?\-݌QK k̜Gw~2vH+$`^ecju$v~$("0m~uSmܶ `mgZL6 BniH) CKW{:FN. ov#Pj :n_XtWGq| p[ȋ2,(*Y&q %W'vjN/Cy/ᇙjD7lw(ojdg:6;Xse4}nDPEӶyYgwnؠ_|2ӂ')"R}UPu|߯ @WO' K]-uri2p="1)!a#j*4!u~?}#h& [e"HnӁu~s%}6a2RX\etcBvpB"B pbmVvs]߹ęz}x>&cooB۫|EX,V h{F2_3؟A)'x[7+d(;lT8N}G>_vΚ2>Rή^};I;*2U.N萈[p|4 u6gTvϲK7gKm> &c>SЄz B"[K{Rmt9ٷ>Gq0/iw[9:S}[.7!!6%46) /ġB֍(3.-1[T[gŸ?kvs߹cm6eZt.WZĮu0R7Tr E}Tůo'~=-*rwjA6p^4Sz^(l<ρy{/tΊt2]̣a<~}]{qg8y/䁵l)Ш\bn e gs ZgSߨ1t!'+S?h}}o<_5g~?F U/o+1#_һ h:j T6u k IM>VO=;A΢By,ڛoO]R\|%Yygβ}_9iџRm؃y|Z#ׯ Pkթ㫂@DQ&Dž,E[*8(-o M[͕3+@_#aq7pQ~>;26.ei`Fcss., 0F.+;0}*hZ\88xg6}L#? cXݗqxy#!l c\j$;ue{MR@=l7%dvu>.\U + !]x֭9e&) ^!U*R%ALHZg;1gտ|y4?F.' Ϯ\6Xhz4@K/V="s.oIb9#|ptmhMڿ3ːX؃Wk䐌@eQZF |6{I[$f^3yW$ۑZMf4W0vnqCׯ&iiy 4 4%|j9g Lo"H*X)@{?aXiӿ>Ɋy*_/Mq[IG)!),r14`abnVi'"8yzbm ! g ] J$ja+qb%J*:cR% n'Q~ԳPoha ꮢsaݓv"b| -1˜%U2roPFF9<5SxmA NsT@_ ?5a&Jh0*"IgQI9ftTFS(JY?|)D6-HbHSRђ gN^ _fjzXEB"P,,E#PjxBdG"2=kopC7  ~=ypy>, Rwr` ?n4$$h^ܴJEVC&LQҦO@ݏ=@nZ > {5EH2[J ! UZyLD"~>O mӺ~~jhY~[x/2OǾY0DTʹz#͎|o'`=#W.$1.7E/ǟJV̢B&&d߶L,nX\|E,D (2y,: ]c_?ӣ\1Na!O6F'ZT8 ed}G1?g^rWSZ.YFn^(c pZOkR:QGrQc&a{`XE6cW")I kOG_kʑw2!e}|Nk@p|~T5$'_I 'ߠ\D@+syˡsc`5H{e `f&WęiK7ھ`ᵎOXn NLbh0o쮼\> ! b^n~~)*; x0B30M@ r F,knz=6m.dA2mI3; G` 7r\KjRqGjbek!ӰteeO.#v4ޒM1 y<>^5Ku,mߩ٭ n>#"}S }nQ ۘ ;|&{=2 @*D)'ع:^{)&(++ DR_uJh6PUU1́A<%.l"zJb<1oUf=,KM53ks+e߅%KSgn 52`ɡ< UmK* VBӑ&Ҕ;ڍ}Z/"b}"EOq&qԍ@a(iG£_?"DJjE3^&7@AA&3dnHm9W8(H4ypI`J=QmF8|sYk/N3ap$0Ą|؇  TԀ6O߅%>2# 2$OρE2i:7@XU5"& M'g`tG> $[[{t@p1־[yw{}Ҏ (\٫T4lf9F8iМL6@4tU8@QjQOj^~l\nX̲3eE ^ǯz tFhK5s,"pT"Vѣ8[ AiXuy'G3ƠS 8̕Ota9* 6y_1Vã?~~?۶Di O0e P0*VQ]ʈ_9h9ʵTK(iO_='eW#c=\Y"ɵS -cݯ./cUĦS+X!bwUC]bCqG-)]5 jF7u:Nxc}U0Gy (C@۪}vB)P#- vw=cȧT(Q0ԟ3_(:$ S!ֈm?m?ϣ6G{ה]R59Z2 4Ɠ6_g;on!<.DXySgdC7}ՎBK^gիy߰%$a`NV^Ys )T<`8΃~HE)f͛6l٤9s9Є1cP!J3g)JR i:iii)JR)JR)JR)JR)KNs9s)JR)JR)JR)JR)JR)JRc)JR'?GsF/7w}dcT D O 2 J ؀=_Q8TF*%;X$xpř8a/,@R8c9l+,W?,8ia> HyЗaTEJ@1c?w p*_A@_O2;CE?nyk"3,~KH3?Y(X{xI"tv)z$V]\{򸱡Emc)ӤdHJLذhw[ٺva$-Xv1 `R".h.lC:T|uv7չyoy?#Uu/2b z"R Z(z(}flhn@. +LT )e+roS2ɞsov&_t5ˣma'6=^E~unJ4^w34j:O-M ~Xo|UOg(??kZn\sJBu6 bu[8$Dt G~; {:ԅQS+x&킩 +GRjٓeN-﷧GHbW9Bje`c죅OH?0$7F יsmjbWǚŻZ<9wTM6",[?ppҙlӾ?{pw{9Ʉ%썮0 J$$ 5>qj]NmE.W@ns T*: {-`8eYIJK ǶRVOqÓ,,J\ Q+: kds\݌,hv#v\rG zz\Iu<#m0TIk1㱔PT}hʢpvD>KVX`+#4-i)1g㍐kqXVqyM7VU/w$iµ̠c7-dzŮe_^Ty[ 8W*B*6*Q='d~s%/fǧO>z]m6!H9{8!}߸GF!3= #uVÒ<L0p:J6?sʹDVu-jp+_KN, jh Vѷ:V$XII/t }+, [L 2b` "9peV ;EՐpKH=Y'<ռ@īÁo^S0+NʯSG[Ļٯٶ}f2UFj֖,/W}empX`>ϟsK|k p{rpHKi,!#x0.a$RȻKn 1 NVr|.KT,`}15(OVuՐټ.-A1M&2<|fpEBֹGޛ6L/clYyIԅ(jrKb$cdD")|Op qM؝|B'aA4ɐ+g*뻯pg}~~|8`Tqz5< ߪTh DevNGCEĚ1N\*(9]>l TLBad@&c?Aql?MV}0Kc?̥FסfĠ#][0 Xv(x7}r<ylllXϷEAێٹ({](űܼv;P<$ics b_oGZ=fbB8H,xcB MMTDdU .S:zX&ÂqK>-\0VLH2$T5ɡs@$W"H. P !g`= $tn./?GF06Q2MO0c PYAA;>}2 q:ʻXx(B٬(>;.WUu8}M,}j2 a) " _ۨ~\I@Fo)RI#BP0^L7YU'E{L5axscqDQ=uPS P d][vHkSӋ4VQ8}&fܥZ V^7rYXp_[|ȾR,)r CD >-ovұo>/Ly_'vc a}lWg6q?,@$%i9I- ;-&Ҋ1dY˄i]`p#. Foj c$;y7{\Y/iZziHdu[JP+' Y1XapDD`Tzr;S,yᵫAǥ0%"Ӹ(StD; x, U^YtO0 zPD)>p-%Zjg֩Ln+eCЭe2]{hFz 9Gv1AEïћG-?r˦g K2tݯʺov7 uM"f )Wn-c)eРq a/R +)(cl@-ZH- L$(9ckPXZأ>"C0ǭ SԪ(c彠.0RԕnhLq3ŃiA78~jR@f& <*z ✨6*K^UMq3 8 ux9&"mɭCM[}Oٕ}o+ݦfu(1@![IfVe{LXDzj E<: ÌVƇފ۠C]1MH ~qWs\xm $6 7yncCiڤK}ODQӴہ1p!B̹V$\$(Βť]:+ ̱64y-|6 FM*.lcPsnD'(}.toOD<R8Nd{"ʒV@ "R94 P$(B^W^s (lF^_auhLn_(M2`eDc3)mj[Vܸ^9u9F8P;&3h -@lFt; 0aG = nNM:48nhz*%I}^[VbC7u&^bM{|&Pvcd~4BϱqVΛRVX0G~c7Ysˏ,SܪRTnClYI:]Q~DWMQM솆Dz{GZz/:M8 (U&e 1)+5LbyXE'Po^&6N߶I.>6pU~g-N&clŅZf7Wz.2PfEk=PlR7dٝ|= il:WLYn*.>?d8 W>x')jS?b ]V?k݆KWwqpZfʽ]X?3 ޞ+VZ\HO̧&O9 f '6Ŀ&5;]|k|;i)*tdcwuJg [k)_bkRȁ<>jtEFE%5 w0͹k~]՗gs'j]IFVLf"H[L Xb˿RflhW[kb%ƆC2We7UN2ː#ů <./C:Wŋ T@Tѥ,ƅD`NMA$ŝS <N57Ⱥn:e-wjX]TaǔQ1qa (nm; V+҃XmlP31_|>stF>k$YVלX('I_7x'&`UX)}&}5:bGxQz-2~4Vh I6}w$1RkE[ߡdmQ:c*,p|X }%'[nMl(H0"$|42{ &4$ eh$B"HWzN/u(Xò<r`c+DRxh Zwb=5rn@%"2iBc|3[{T3«}U8)ˊ "`a6Ld@ 0i1H#SWK~aSa%N"ѐK&! D"J < vϋ?+q$QI+F-d>f~F 50 }6לvpaÔQ!0)E@_i,\@}CQX`f1%oy=)|axAiWUT?CM]is }?|YZ{'8.WTq nog_jt:=(}U~yQ^gmaL(o&uZf?$\ț$G ~nB|sSsV8.%S*"(KABd_GquV_rO|13!`=P20"Ò!\^x[?K3伶k튘XRF5؆mj3e7_0;NK[`3,#y6i{%1NYw6[I:*JA=u5`,`EuegbA_VaZ؎93ht~AA@w}m^z(gnH8;nE"~'~Cجz_ftl ÙnwqXBRbO<m\n la"2X!zT^|M /~+n7d,6ZGƢ\[TD_,E??K5}~/" s ĶVReR6hu%sO3wސStaх!\N}Zď@R*d6ˊCpU#_9Q^aa gS]Bj'cR$0e]WghdUEJO;>UVt3 Fϔ_. ah|<̜0#s)#>ZI-pv"R=t .|tts0V4C [$ِڈ_Ux};ZR-ħ@8k ",Zt! B?>GRnvN"t D*tT,қ{F?9)\>%V`EL3RyՍ}e N:!C: ฃć&WR9V8JYueMWI\CC7ov~jVd`qrh Π|@2?SI2j!uk@)zYV}_sI=^cHQ*;/Ѳ (c=U)h^'PCP'=!=$9 D\FhH˼=Q\"A1 c*,GVWko4+oHf!5bj>^~'k7[S7B wOu[Ûxyrh(bNQ̿AhqtnRmy-#AvX|W]H2 =y* 䶋$DH w +JvQ3rxL3Dڒ!\>;[mi`=b/qY8 op<|Ae5f-]v|B|tqݓ0_1+X8_i2qjcïNW\pH D@sn']ϥn@"&Q.8_x/! >?߾RGO j?;Oyq1cBW\@ٵZ4r% 4<~~ۅzN(NTszvikTݤ*s_zwmx?e_wPWHg01U_fs>.qG6|6:S GNG_8Iŭԫ[!X:|nK웢lS4{0|0RgϕVa# wΎ蟔x4 ];VEݍwɗDa$Py QR4!L7ND0t`0HG1p-~B$󫟒\ǥbO{n_|I|՝2fZ뗧q9d'wUKoay< ~=1"}K ˿w|HmwaBA" TPc yJl[_R'h|/F`cm* 7PR)bc9WƏ筛k jp{\./m؟YP`}S`C#{z~_bLqCNvH=1-&-yY-wbl& [5זBM3qvdfYMӛb0l\}LbHKhPl&>^$҇& \_Yc $}pEQf(JlġeV0+9Q 1Sgi_>>d.mMw>4fE\Ee]؂DL%ž Gˣ CQ$dn$|-sag1(7Ś3n߶¥j}wvkABo,%h9 : T{#GNw/F/#R6em@jlXԗUЪsp"j |z3//Vk$@㜲T _x.nR:47{ގGvTD;^-=v(~%aoР5 NĊY%+"ACժѮ1 vP!=|~"{l*"#_`# D(HD8 l[?T@M廙[s Bq ~x d@)_rw/kB5/}e)>! ""G ]jȨ{h"pX&H d.xәEmwrz|<<3U'H# %El(x$ r8F:%Oc[_ˏ=L_z-H0({-| ǶyVBURFLބ 1EIc:vO6{_'0ŗkD@F[X7 gEhpE@- 1!j MAC>̎0(c׵xǓ&AۜeeYmSi~='x"Ǖekб {'/2-HL!%[Iǃè Tp7ړ#cG 直ނj~LHhI)ATEO0 ʕFX>-RwǹB[[,076B /V-*ޓ{}H`Lc*O[ܙ+#; и8f}] !YX6ų 6۟} }16jSpt18)\WETcũ d}y9s8Nw-z?OP """h+UC!)F)Q's>?oGV><qA0|A[4 k8 L:OA}9oՃϐćDc5!ľ])pQJ t a} rFLl 98O0pQ`#*Y0 9Oâ=2$k,Qc Y 0zKc3^R{kB+VqE= A/N(YUߦ Cj__dފi5&ݫ7T3o arueGU3Iԇyl8P&DЙ uߍvsV0_˵W X#Q+$X7O^5^7/j̀@[56:iX2iOrRGb.A,&tۓĎ#uƕ =pBU,fյ"1P9Y,`ZrǶ sRĜzXe(d5h;/@x_&@_3x;\T3~c6@|& 3-d . 9PioYUVFnZ> #> 0! &7ʾ_SJW׏7JY,˜sjIL1ڠV.ۄTHg :ٻMHW1S:]9y2w,pC 8=X襊QŧM甹PQmWLz/>h=ʺ:mc{1Pa0X,nQv4 !>ݍ: ׃ЪIFGZ1)C$^t"ۣe$u汆I"z%&=Cqԫ%*rMaaL(kYURn*wk/40Mհ\7$ k#0@H+wMU?bZ>:ݭbWP 3)kMi{s|{ktjfoD>ZpЃj&"DcvWOSꕫ%^ 4pDp-kUZE/ LŽ/q =u~;yMpq _/ZO{.{gY1nkvPO |d0Q|KqEEiozzv>) E,>cx-cDv≠eor kA]_{4xnaOK\# @D@"ɪf~w+>kv/A jWO5 &j63 3ϐJ M ]X']e(ZHØ΀0>Yȉת*y5¼yxt_ln#7y!Y{Jń~"(|誮C-.ŌE JsFi@HF,?  +5EN,։<2mVUxc NyOH?y#.tgA؀Ұ}6 9ųr/4qwXWV qC(73|_sEG>\HP+D(Wxp]eXUBOa/0{#QsSzvXՍ%i"Ad_4@pXpi1np-='7n+r ͹_CpЁceyOIԥ9#&i!(-"Xalt#eӅl#jg|8y`h|\> wp擡@s:5 )٣aBϷH\ 4E,fq/vV9Ǐ;<4Xa&0/u[$`WO)O~ P. vG,ak-|7"_inOB23tI{uh7w.`qKqz\w4|dq^_kF b&fOcQ$ hhɱc, 'q /(Y510KzO@[~{_}LSkR`D +<|~4%J?u2я,<,fuQ]~\-o.ku 0j;&8'`NWc˸ 3eىh T191Dke&!Í}~NbNloztJ17 =򅴅#dT<;H~SpycFDnҖ gR}Yq̍{=# BďNd켵mbƷtsȁrmc21ӥćzG~uWG@!O.|"VrSAb@*\#!=WF!YCoI=zln; @f2cf,dYOKohY;do)ٮyǟc_+DIٳve:p2@lq1L\cbbO.9YK,>ͻ0XXkEkSRP!ķ᧓7c)N: GA=z>dK%iE4c.I,@'ӀD9xU`FFc~* o 2kbϾ{iMraȋ/LZQ`Pnܨ qT/A Z˶DQPfd= [ɐ^;&EéwÏ|V)nf}+V4u'`cEpCx <,^Clc)Bu;t2FәY{>;A3\dIL>& ϙk 4FH$`%+1Ԡ ([Fz}_98L볅рBui>@]_sE=[LհGQŸ; H9e'NkJQ[EsMӫgJq!NѲp VN@԰˞fSh&Mldy>N] cmeȚ↖y'jӁxX[E=|P9 0r !F:cXA Z aM*/(SͬLKGkNf 0on:)e+f,exYaEaWfe᣿>kX6w@xYo͊^HMlжF@tPlDA/!mBiu'9I,ŵz[lS_.9ńٽk7Fl&?*׾Y3?FpSCƪ0P`.jAo,8"`aA܏zud"%dg{J(Lt'SՆMz"\! ڪQ蔯d<eמ uedE|An"Qqމvrqy\r]<0Xo1I.Ə0יO66aG2* 9t_E:c.@R4W|f)v!;-^Ї\a˕XLP{O6g4皡, p8I_PF3Zne4;F<7(gJ8 puc =o h(<xJ|5)L_,o0 LVTH} %gq`JjeοzȐb~H:]Mtgj^""~]|-691v#)o3>u)3Hv|cRw4R,Q%Ra^Jl}H9<uxN]*?4~ miѴ2l/-Oj \2ItEADЯmhTςDZnTX GYj&a'?efjYיz ҢۖV An5 ~5kt|2(asw}n8z{o~R _iX|ÀF=X=oB0CuNXr-k,|_= 4@\Y&`LL)PU-c"(-dRVdd)THBH~$0!!9 ۠!l?jkSjʼn7ʶ&d'ƴ~P{ 3W7C6(c;A(C٧fimJHvQAm_Jw:e5 ;2 ҬgM`MW"/(@@HhBc5$ z75v_AAF3Vlt eo،'-q^^l1UU;0`a맊ëN 4qq8>yjc$FC1/,$qE"(b Lxu~ 4:Z/xVKpf6g0lzcrY6.bB܄eo-?oo>WcwPFjtV8D7A ''+{F0\-qNGS|g8ΎA "Fu%msd"fj8MYMSJ g 0$HF'99)-jKiY<_`s_oaD^m}73[iEZns=ǻo'q>[=Y֬Ym $%/2CZ`h"V ӘL"cmxSnn-byq Z'O@})K)$.WnX3˘ ['G e;/_mZW 'kHp׾_7?wۂo^Qa}70@0h=M}HbF޴c9N_` ^r WfzuvrhT]y @rq((u C@"7SY!t>3y!!"t*ӍKgb-=tP|c 2t"mG·LTk74b8e5QƼo{t?]AZ.0or *.9w>^5N-O hQ'Jx^ $:L K&,U@:ɐJRkb?pxC%}7[`OqN+^UC }~%v|I,5ՂR"mg?0v' {7xeg_[( d Ek\*Xлcx}g<_-̟saFHD y_/\3PAsg~ճ: `}U;o߶I_/?/ U2~'HnFͿWFV<Q3uE"|U@ KW jVK Iكo ZH@{…Hhʮ5j }"]* "?@|3pDF lcAbF*QQ**%˄37Y&-*6آ8mצDUwM F6؇mkEn[Uϔ 89PMqN>),kjIIB*;;gy*m=ӽD wԾlUf#ۀAE /H/Ru\}sY/GǠwq7T6;_p&P,XEua{kXC T̈n Dxka8IyK};}~£@; .Sn>Uee#@k Px7=@d`Gm*Iq1`I'g,C;O?G. #!A6h]L`"@s'Z}&BEӴ"(H P Ҹ²u?+jcf+J~mGqAosSҐB_q3^TWtb]*2ԉҙ=mVT6>g'U+VWc0ZZvQWySOgv3e, jA p2o/v6laO19`{HxRt7[N7{a}ͿV\P~xJHm!H[z8L|]w6  beYjuߦEw}G|ۘ$]5I&5?!w~S|& A v2b [hW={ .M W\Th"4Ns"i B{j>ϐO&QƉ~vDhN??[3 mշ[7uc7pgu qq,Hq8ڦV ;kuJ IjĤ0EE2@@@D0@vHHzS"#7!$ yNcC҄@3+un]Úyך49qljj5UkAO/5y%v08c!tWg_i}^tVrqީB ; Ȅ!.%5JhD4o. Y(渼h @8r!4Nd~\ܫ~?Z(.XC6B^%2SJax^#O:j"L;VuwOYZ*2'%i_)x,jG_tRfeSj()S/M1[ٶ,ye۴^ DjU!W}5cJv_gȆ,2.yGaމԲvXk[ͮ[wMRI$ Ġ H?:Ojd1 ) MI:f' B@IJJ"`(O$+^~6/CKY;,9bnS kqY+|;oGA K>MO gV?Vȳu.A']:I^ѐ؟ &D4@y@#>21&#c$kf5x~{}wOdgN~;ADE"ň+UPA"X" b DHHbd$AUV(+d"YEHȬD*HTEX P`**+*~,#FE*D`*EQDcF $b F+,F0b((1AQXDE$UEX ,QYQET UEQEEEF* +sP A4p?;I^lDHء G. |cОg|HOl/;%\T΍}-ZaN#8 #=%ԩl ,؁`/E !RQ0ИKb npϭ&wޙ&8"3`;GU]cdd_' _lq8c%7ynY2f*W׾=aggZH?JsFEV6bH P`e84*?[ΕPF7h ]aþ4**clmQC,= _L0.C 6uä"V`K w\rU\.R墖esbX3hb*ˊ6!T+˃)]tcm^YxaDυ3 QSt0#bh>k>-;}rXMc#cJn"݉WF1p5 {5{z2@`i3 YG-:PH\J,UT;j8%V\Sѹ"S]]'(H=dn񍪠OوwL삹b ͰJzv`;m Tz W†6#Xb a>?{UהUA)nU-6LH)U#MRWi`8Xg Ym{67G̣a+?%9=6n.k5ŵk8?UչkεD1pRԺG\8:J"8+N?F0pe3^LgEID% zU%\I[-7kK呙M "MGʸH=|QW TI(O!3Á AolYNo5|8Kg־|:=IW$XAA[MI)qbrb VG8;М5.&LwH26ꔕu]OvA'$ /(4 3t` WXƁx4g:6Q> $w Lr=m]ΑVؽ=@X}&NrlAJ5Gy[m6$mͿgX3A ?p}+-q.[cH(V5 ~F;e%I!ydžKQ9:P+b:lūb{g%E,SKSMRj;GaU"^{PƋ{׏bx]j6VzBу(Gjb@+8ޤM 1r@bô @Ö.ڛݞs,Ca*tr0ӊ`8d?Z ;gILjcZb1n;LnN|6kX$Daco 5SvxvM8 E1w"Gvg=0(8݈ ME薖oQd !YF&eΣ6_´nDpHD@pR,gdGÕ!姓E 3 /;}'G]#Aȍ-ՕrccS֝{͓'A!ZM]`9`|ozF hA "` xH+cZH]'ûN0cTJafK'P/Ywr0xxmqN/+AunZL *gOI/VicO48bGZr쒢M^Z +EqVPc!FC*<(jaNrۛv5 \k!8!~Dt-mU?b"a[;Զn?*)VqPN6e @}6&k~hxֽ0P[y{yuk磇1 xv5X#V̪ Ͽ`V,^ +,UWR rJ$r>MB 5H_ uZS "~~}?i94)h)_q(H*QE$ύ]$fJg~ >nP<9#=ߑϷ8}1hlP^f9y ^`! ?f$p3~i]v]1 +7ԹZJK v@@ F-`r?}~gI.,Z7Cׯ]uցf"[,=TX={G~y@Ax(+XLlL{l{M{+ry~iL  pQխ˯RZ\H!b@l!5J  Z6᝜Т|ގ&^Vď~H|\*[7:e<@w.}}3C 45CSXWAL~#W Vsfǵ^k#Qg33_zqk( ,`?GqokùmJ&bǂ / B>q NVv0EFGTqҡcMˎZgbr3 "&~<-2ֆM:)~E:`@]vMWE-!K M_ pJCn IdeFt YɈ_H H\vr'r(g}*]pP_4Q%Sm1+(1Sm5-BxO-GDyiHڪ[E-b sϞUzIY5"iF\Jjw׵ccۈ"Db[Ar]ݿhNjX83K2)LYauŀdYR2 MЇ} }Oљ [)0EB @kN`',0`Sjf|&:8ۭj0& 8@"[ XP& "Lo5yPo0D mBT>")9YbiT KTؕhtZBtM0L{ġʨB{kU L8+̍RikUtԮ.E(#A;׵kt j=F%hBȗ rP[Yi(8=KzGkVfy2l(^5N7 d>5 WpMJ3 80A`h caq|+aT=PyT )R- -Zelm'+Xh iLcb k  $ "yXd10
    nl$%6>א`NM58PgSd%3<}*,(Q{MV3 9B Rm䬨aC4ڂCvI܀)AfB yP=w *Kw|DyaPBQe|g͇9J3s=vDq33ƫf\&uΈ$:ymDǬ'c8KfP%@Qo 8A ,lǛ},|nw$t SùsK^b+*j[9oLF2ӷqļF`4dH DDK!O:,TOR$K1"V0!đ@!*@(BPdqj ;mPm@SP@@(:|,NJ޹4U*',1H*۶ fQ[]q7ᙍPy%dLa(]@WdKP"΋)zAglĸD!Br #`* N"`+RnYk +Ƌ(,&1o]ĭ8 tl3bh5 `U!`ʧ*5U@#I D_ NmbQguh&NԁK1BQdsҠFFZMWY,Yo榳P3p-wL#1 b6 v,_}1U E35j]qbdi8Zt0l4H׬@T_u Zc  5DnIT(I7VmS"L!&B4=+e :ustJ2sf $Z9;QQ)oZUXڶy%ާXTaެдòELV#U%zP ZVU4ijRvn[R4xjFfg}RQ&R'f,سhkoʝbA)h;XSWl4HH +1G?P.Ͱ hBLDDmD8?g\qv`f_ 13]ùmNH]A0Ȣ3ڷpy1LFӳQ'1QA0/؋N`FIAf1ZAFGMzxNw**cذ^N3D %D 5c}{b–Pui;CMXዠl,Hoss[!d 8c)5!ʨ0ІDcm.F 3=&2W*u=Kռ<`ʌmb*"mlvBF7L(H1ixCt^  KV` %=:0Ӓbr PW$<;x<JpQAYQTQEeq2Q,3ƭ:Չ b#NZ!¬t gE"lP,)Ƒ[h+(Yc dMXj.K0XG7haʼn u).gNkPvNY| h6+i9;b;;":#fG똰~q ?u*Wc;!!#Dq(gSCGY8ErKE04ycRPS 'P¬ DTx6|a ؒm5TW~ 7t^1j LZnR˃NxR.=Xxn+vI& <'f\iV4Iu'xs,bȄ|v!?Gt H ܘDmDnvl>^y';vyfzj,&ueH%!H Y&PmϢ"Qonڃ Pѡ)nsp?뇽$;Z&X| f8l `fϘ1(вcma0 pL"iKh1Rw %l˷~]c@e4E|yѠοCL,/Ғv< Gu?d򚒺BI#˅kcFX7i"8͝Aۼm0vdmDq~)Vmo>goٜ?zEEHRVg}x"T PUHPPQHly>υ|2y|`_UƶX5J{k&>Ν[AEڕwo@8 OH) $1eLƆ32I'B@P ,P'S3, .%m@OSsO\&Aիn}Eã*h@>a8%8+VWԒG5g}$jdx*j~2:-w{lfaN2\ P" ?K&Jd]6N;ݵ2ڜ<@~wl3\Pe75Y:Ԩ= P{zΑQ[Y"97#q`Ӗ[h$r\{emv2#B) d%YWXضfU;14GwX\mŲʚ"c?._g{1Ȋcםsƌ4gp8)\ I22}Vqk8v5TCҹo_Cv6ɔ4鈋<giU5M݇bdž'E.0XAY"[;tZl96!ˊt6iթ{|m<7b +$OP$v %^dLg=tGe^(@g瀻]lV5>(A(׬ʏ'S^t xo ˞Mʋpg_- I\cHWjo"pTGj+*ʽd3ljDˎ;Ҩ:P: YD btL܏ۃ$!~ ][6oCOqRE^+I4Eh,8Ċ!zI &nk7d'Fܳ%Q<&nj2t.,dOM^hw82zއ&]Qw /zwVFQ6q(vuT L$0ߺƑ>Q]oJ.-UVW8.ryRT؏IYO5IeqwNr:ꧡXrӼ8Nwra#X0c/FpȌ@ y7VnZVR6N-uTQ`l9 JD F AՆ[R})SNhd7< 6S .ۣnk`bO1;faeIncֵEYEv2\Ss'ID@n,:ًF"R\Rp$%&HJ0KHj~:l}Zq}k>%u.1պipSQUˑj}?yXEfYH-,?!R>\2#9gXbq)QTsU\2G$CTsmEI!2DD'խ>*J*t6<*a*\^>]iЉI+_>Y*q|fn@ 3U冸wN"OmEo)"Y]S*Z%cV޻0R1868|Gm]a!(&p=Ň;dzeɳ<*@U{DQ%r/= Z)& ]։XLj!I&Zba&fSn =K(ޜ+J"W=Ttpu;ON%R^ҕ9(~}esO7r"Q%+%JT&v(6[.iW3, N@)D(TC5RgpL1޴}P ((2H X`n+%I &vPT40O,|jpKBIv8m}VZEPvх¶,z,B?4lkhc.^8LwEGupMaR3 K^K7kz³fJ4k]ג/ub%6dkkrU YBӷFLEkfv" .js/dɏ=ytYůgϩ儡1CzQ;vgbCɔ%M//]Z 023joe91bE+z<42nt'.kvm+ ]nf Lc}6DzY^\q;5kHp-⬜9~-^z_RX}~:Q_OR,q =8`I%عQ&:ASmuVSmgJrR_B  G"-OLui>No{8>Dž}0MK⹀;Kp~U;uO1lBXnK^vcrz+^xűXa;tp3g] ! 2$!-Ze 2⢅e I <8]L쪜{SN`(90 Bڷ¦?, [ /66v&iS!3{Uk јҼ@= a,ĴŴ'@)az7r_vM۷(I趩ۭͭmM;< `v g:1㬶~3kP>Zn*m!Wv&CSȋil{ Uj<,2nF2n|=Ny]|i^ gA:Ʊ]"ր}r <Ը:"t@*Ck:#$%~ގ7_*L$Le\"MHp| n~:SK䴷֗yYj(aCkcޭpSQV|gm1 DGMj7]=%f J 1~6BF'HDNj(/f)Ɉ W0&B5-ݢz.Np/"It.- עWؚ0I;j6i˃R4@Be۫0JbQ-0l3L"l%B~UI`wZ#9G r4= )Tl:881q&nhu HDQ1i)!b#yt_} zaS1Rc)(Xipq"_m*6Ͷz\ŇN0?"'ţk[` eGnjDUSn/+-iva_bJt 6ŀ"4aFt "#H]T$4Pq4W`:!X9X=K,[Wa>"Ռz3{Gr`7SM 5F(^Yb]U9d 1߸AzҔHv<: K׵c.v_ eCd#tBB1m.1b+o.-F??mr9* [AoJ+ϝWugyM%#-MS%֠j mY쮢M '3 hi  B觽1&'If' qehor%߳??wq7yeL:=X k˳/ey8XAKbII@JIq#}E@8EHh^ıZ7Aaӻuq;/ۖ £yr1+yie8B6FF;} QsA?Sdan8dZac.e' {Qk*9J)3'架 hge|J-yܸ֗ jiyY)yCj5@w0D/$AM^Wv>n]#ٴaMT:\.6{pQ.>/}o5wK{m'l0v0&E t'ĥEm4 6qT>ϗQ1NNrᴙ\j2r&&Bdzu(H wueΚ.<}f?iLLj>x92$d2iI3F*v?b' J?C9X1ZJrh`Ȫ Ec,QD`(ETg(+"E XbcA$X YdbA" VA A`$byeIIЁP0aXV**U)yjxrсэ2" ` Qds?lS ysfY4B)0@ exM6&C'I4 0Cj ?ProqVq\x\}._3I0aVa@PuE,(,9(齖{e?ѠcWlyۺ-hilZv{Tm|q휆`;D0&$P'%Ή</Ğ臝ymo6*UfHhw.P5E, ulJR.& %Ɲ08tnZ _w@U8'Oē_jbsDd5Ϙgksré7!U.AP,2'"Ŕ3ڢ^TE!큇l|bu^w\R^#|!nJƎ[Gŏ?߲Q&L! !瑈a 8f0Tq1ISRn6*T÷PMTC)X6V2cYZ~mˆ׼Ef:Z s%A80!= [nfCL FCz7`ù^}H_Nl~# QpFmj24K90!v-Soh0XFAq#~v⯲P< Cp[#C"Б%CA1 !/X8cYÇ^蹂^ۢuj44bc !<퐎C I򖿻r\]If n]ifH/Ny~a_AC ' $B#Ay p5nشFDF}[k?Eaّ< þm{زPgJa/%l! . Ag>5<)ɣ}E@G/ɶxᝀGk>AcΗG{'$?:J (v4SQ7PAgztoN7mj6á%hR$*S1JV_ͫ_ÀO_?iڌOwC.S2a q8lƆ ,yB5+-~V[h40;'j>;|~s)Ni kcYE%\L/$W%rӚ.BM@^gotLE&TPL+Iƅj)0hӜvSPLn*y(-ѡyeuq+]lz)dƖ]UU(pjV*OĠQD$_LHS$KT`uf"}~2ȪvjAGL_72>0FJU?P<}ogX7i4h2ɴޚ>ԏvzIvxj:^=-$msDt՗u_ )\kJ Ւj=34m덟z;`2PȱEPd,A HX)`(Ab((ED"hk7vu3e>S]*fPq f`gYN ikG8|D Ww/﷚5xNjÝ]y)+TW$uR6q~srgD#?vG2-rE}QDW XjBu+y;q-M}։8R ̦ eOS9ݿ t(J8s'вDg|Dy$ ܎=7"LH@N;J$J* /_$y2Qa &qQ-LKU4Zf$D(&eK}D>rGi=cd' ,{R\īJ)QIa y=5|J`SVOA.VW9CYGOn)dY9G[ ƙ^.Apΐ-V{YF2O ǰBrWTw+x^΋kvvB;(LA&^TϿ=oI O~[jߩ VE $Ig$h΍A ߩj>OC~j! \ؾM1xȕ&z|>O)!]YmnBY4!Xv; "5˅΋dc_Z;v+d!7Sr8(##z'w#.B8O@jX77s1}#~ 7#@|jc@P(*uQH$A!ڦo-Mnq+8:ݵ?)6xe8z{EwvQ0 }N}=;K8mGla0* iB~Vݣb+B9pAQDu+I X(jx8 R~w]`uIu& )AI2 `oH,Ri!Njc%^ѤĮ\ʈF"%h2c+10C30FFeA`kf+]4Mʏ)9hnPou<|vD8s6(ER ٔOx>^MCҩ K?e.WIeX&Шu>+LǵMR I?X%bǝ'Xt3y/Yai.0RԄ߭eqCQDCꍶa7es =8V=ZlBhas(RbP,U\jFe[\hTfPdcY*ĶņĭKn* # )K,4=~}7~<73%7~qxԏMIiG0F@%AH ;lܠ|Cʼn+rI#E[}u~sNϰ;˩'ق\RAb lZc?-yۉˋߤjd [c2iIF5uYf +\_5S3P]cyJ%ṷ79z4`-!H0@ 6r}_{s99;= Wlz7U:֞* ?.D/vjbO_uU>fNG'նt%u9wGLj \(#KxAL+P%r ]ByJcjB:ͶOЋ^%*LXO.O_DkEYZPr6 <4Dx,s港#2Qs}Ro'<g3`q/`ʤ)}d7 \8zx7 lE` luawa..yn75yqS2cj+yEK`(-RitBT:c[)Zjxz8Ӫ^+{L)_`zSXB7L3R!s8L"a=87u%g%>˕酕C_ғ?wvsg1HginϤ AdHLest_帴,E ska!ZѰ~W>M`h{߇}ɪ-) >7/EAԖ~ |=oggzdGY(v\F)MF9&uz{L诇yhTفN1ZShC@ p^.}R׈1_ bJ\*W͋*pm.D5g"3ke޳esƜ:fXsM`D3ftyoזD-% 9qܶwMBZPiT MD7.nU7̊.vs9P엢}}t:a.#Gw47kLqF9H>=H;mUnr\sL;_tݏள Do=nt4sW %ч>7OwzxRu PV9{iF ֌H䄘q7q| u0GnjXvw- }>)>hX$*8(w|XvN&FP` 9yd~Om.aMJwH*Ņ c(QBAL- 3ؿ?,D|XGlV,"ʶQUw*L ɉ0;UH%)ML g6S.Lܱë(8eApٌZ(`(zbc^Z8yjqRˆie:&![^5Kq1FJ=UX{g{62/4{j*he@OJ~ @Nk,qDҽz6;璑("x '9Xtu8@%ZȨ Q~]Bj|BA)BВ|n!&ba26vI0D9\!3ʀI-V" BF# d%JdYEQFJB ~c~yɭ͙ђ$k'y/8p5_ v"3`Vu2Ǟ4yz  4d#WWS%q<3Zt6:ib=]_`$#'c Ι` ĉV;tyʊ H@dFe""`Ι4j`cb8(Q[f -ꛤ1cc&9@X@1a x|j6_µ7n%UAF+L$QnM1TSs錓~fӓR Jr]I< |֌70Y"(B!fMH AEI?_d1ēv߃jHqYȊE$b"d`,U yd)hjO`~_m AbZ*?Y~7?ߵ;0?`߭exҺ4JG;.eATYGG CQ 2NR/l@)U:TR䬅W/r׸cggkX&QU&dϨYIQNR=1?I:u'My&~ ~йZMRPa#.dXۖh"7;nA;'h䣉0(c| މ W{[_Cøij?3}h}/]wGj7g?kC:%tB\[YKB%?NS;~ -Y/tRGiă &XQ2aoi6Q.Kew?X6vuwM%#oO~ p8C6[_n9I s ;);|v0Bx8ZmT_AW9ͱQcyUA6'lƭ"DlWbXwOl\:=Vp;okW#( &Lr!%7Oߦ_EoF!0/!:b*(\Nt"1yi)P\ֻ HJ-}/M : N5)pyG&Ww.JL<*ak*m6#nj+ww9&[caݑ| u:V_iK;?O'Ďׄ]feOp(6;DPǸ9~`.c_,;},Z*b 8B*/> G}LsÐ wq.\X@bq(0*9PJQY0֖y<@S#"fKO\,'@a '5QҺ=n*/4vgz?SZtH%(.%'F )T܋f>wyUٕ6(i(TQ7-J0"y(%DXp7%@H%h%c >&jGlϢl9];WTße략߉ʧ#`)yGoK>{n]~Q G n:Q \*,P4t$70Z Fa.m$6LѾ5(~euS *` JJb@v)nN:(ZAL D̔]kamjsf9(#x*8f! uQ""Bd(H@g} ǧxwEFB9o^h _?k%Xw:_f빖cݔ94pL0Td>KOha@0 )OM0gUI C>ZfD 22:)H_@ֳRʒLT1~ d$kÀ" $sM_m. '5tiޑc!RŧL½gE{}>e@voUc})J11cőckYRGߠ,&P ӬIַErIv[lzo2AfE{6QҐ1dфQnF ~.'Ou Ipp{_g-,ݢ#d~WҐ s>Jq̳}ݓa3xfX.HEԃ`os+s 8 0ET ^no^NZiEe-4v#_md/8S X<-Cr"1~K{WANZy.żKi_ Z+Q'+jTp K0VWSHs3#Pid#-밀?N7j*f5)gYKmiR8'O)8{젗)KN+ݔ2!5y-3c._oz>L@,DlA{J{[:'FaD Kq SCr3 0І o6 |1Wrpi~k$ŵZn1PBj&Y1xG["lX<4G{OQp-Yr"(5XŁ; Nø6;kR&J PuWO*)!oP$B F]>շ释ײEAf6a+sasLo0 [ (=V(p+*ST &>_'ơ C<kQ]7z/O5 P"TH(GW',׹ϴ27'~vlc"11E@X,(,"ER)I4uZAbEjt.Ȥ%@2# F\(kaHQDw;Oڠ-7s n֌D'U:?֭7fl"IYMd-sWGEڸG۹xHbG5-"[{E:OX&j#rO},ZڧuGg#-K;^ʪmww|JߓK߶fꝂ"K@/7^ pĽ!j02\WDօ5`w l:LY] ,786K\\mϾ7^SN?@5b9[I]c0J5ivH&uU `Z>v7.[u_IR\Z6ZWk$`sA, A)0pps1s*7z_&Ц,)/7~qt9-9v1܋Ƞ,&Rĉ>SL{w"ňQ nE$ kt 07v,t=j]x^;Kt[:oļX6(7clwqӑbMg?uYcg:)% `ڬt8A-L*˸>:-`B΂Ę0dyE,.fUH4 j W &CM\$Ϝfm!%vvi:,F7a)A4؋@k5U<] /K6fEܘTpQkX^OY V0bWX ~=@1H/`Qm`%ɀx,IVh0ń-҄hI %O3"NG%>s&`O\@\~Xy[?hhٖUˍ# ?=i-W#נl%+PScU:"`0XF4Mg3 T_k-B"!! 0ť7T EAH"IWp he32j%4(mDdGQ줗 tGVa$Lz{1ymmE EFBH{"b4?}+{wï2ԫ&dXZrF?Ca~"d Dǝ:,.K~F{h;x]^ KiLP%VǗsm˭pw;a5>xc}dE0S@InڲekIn&8Ʋ ٚŕjouwĝ`%#rg ߟT$&wMern$W|1[mGY1s$/A2E99q} y񷥂-]YO]=iaݭ A-bvq>ˡynTAFlЇkyѳh$Q?Sc.ZOֳЁo~ -}7r:}5qik`}gLmS-X8bv7qeX?H_gDȲDǃR{}.Kp$zfa\aq;{" hC[Z=6&J@@&0s0}K8jx-+V혲Z>#d} uS04-q}kVӳZ!F`meSEm)p"í v%Hxf3[twVj rLsh˦k+rNdK;''o?jH1],6sG0cGSݶcJ6%oL8\:scn]tl!.W62~Ygm]NbGӰ5!{Cn@$*@l$<ΣؠP8v4#!"#RĒDgI}yIeٍ2_IG1\f" ߁F_ZǑropbp.+$m̹n10C1xh jV| [.MbQܱ7Z\c[[-Dy³lsE?LY1.rzPm|6:n>l';"V6#[ 0}?9+Л_bbm}1  MY9 yX,CXK2_{>ǵ7txHf`sYVD1Bkc3\}:Jv+ǭAS0ј_)ix]r5~V ߋ)FQiW!5"#9ĺY&kWw~ʍRb=;J8(6V@LË,5t(a-S@loG},'RXw'=rZiR̋C5-*6A5$bCP$q" Mu4ঌ CWXP`5<ͩE̪DLZkbp.TҤ;9__EjPD0BcdS=UYDF+˳@!V=`P"rN|Qh#~)t'*D a)A¸uܿˬ[~p^qo:BgimwM09foAjl>;3@OC٭.A @(Kbd.q+Jnز*w@lfYs#׋K8ҵhP0y_7 m!Q}<Ϯe!(dEX% PBrL $*Yu؋ӕ̎9MߔXʢTU|ol?ǿI3!Xⱟm玫  7! [13H'Ax=ކephaE_$cD0xީp41Zw$e&j 7;XGO+%uҚͻ&1+keo/bv .@ 16}_yT|E7QN, z @V҉%6]M ܶXbJ(E&lWy,CaitńNc%s.e_垂e:/ܪDkp]qur83/2b3GnGb8Z5Ȁ~ܲbW";3G}'* @S7O,%EེO~ M0A^t96pT5NWUP_!>W?: VG D7EU,,UPFgW~វ$l6*#IdX)u|6F1bEPTdTAE,(/= ~͓SWUB p^~d#"S?QOuPDoh>V HJ IqZ0m$[_N Q(`o;%\{+_Ŵ;Ԣ A9s+={\Q~itI@6c^ChUg5X~n1 CNP{pF/&Y̡F,9!l)[.?q̆rЬ3pq?:%~ejWx'X⍈/{w-WwJZ| +"bʶUpnR[`?Y!JxE~4C(J]"ws-~S_3%gi}t~m=M⯸ wEwpc8 6..w]'[ۺW\k8r2wrL!:LH[XH"\;Ԗ:@#XY{ J-؃ivُk?C%K1_>~ʢ ;+o\D&6BQ}TPwֿA~zBlGyǘ!v!C#8%1%$<aиsux6r?Ǎɲ%u@u@0Qy8x"˦yΥ-cǕԚ`=xV[T8߄2'#bga!Xe*Kҿ93j'܀'Ÿe (r b$RQ+n6X1KPAz[bmLNy}ÒemD#pk-S^b )*hr%/ݝMv Sʘ٥U4OWu?6l;LN~c,Ѓb '7߸TC{EG(W*%8@Y__UZviZ*bĵٹJ ġP]V-8\KNSfGmW8ꉏyHwXfY/!qWZO]ބYD:BW? ˸|7Pѱ(_MNSZG1W$^CE*򘠐zkuEƲbI@boA["Y%D* ~۟ى7ow.V' B# Z'gTץTZ?S(yJkN`@XZ,^OOu럱ó9H^Dy6M_Z@ BG8 N+}~g޿apo_٪>(OK4Օ_W7W  -ԪZaH jwBh]7gσ`Jd,AX@"$_+U#; l]L'7]uvׄryDLR@nN@,ս^ݟdQ}_)`fFZ-A&dMy vƿ<B:tc埈{dVmVB0iYIsЫ4A.ٮjteU%s~Ad0xߣߺMH L~IaX'Ry-3CX/V(1X"0 k12mK`&Gó ܠ;_w3=<8WGG9Mbf͕pOVL@xLrQ|vgaw{' t~]i z:EQ؁ qOd[}fB['̊P 9|K?w~ IepsVHkʡ,ܨ$|RGi@_'n"D+v,ZV1$f$A$w:iʴа x]HbM4umeyw ~z6"gqRe/ ?D<"$$G{m7p FAH(zn)vZߟ<fDDde?o"3r\ϝzRF.D-ũfZaYy0" Zдl&u4׶DyEJ{1~iV2&K`0=OQ hbg2TPdD 'GMHā+EnHaEF'Wo:E x W} [gyYd.c5py|_( f.B)XC{~Ƨ ?s5wvWhO3IHئA1G4&1{8"Z7pS DdUlqHQbcT.f\ 'bPCpIؔi*A>CCPW'yQz$Z8<3@eFth'Jѱ{[9 ~]H|ds>i!)G(@^cp~Tt\9gI !x]p?SgaRb6Fݛx-? ?ԌIh[1jd_Xi 䉣1 -tx_ܰYS_Y].&P4RwgwG%j-͉bTkQ{!@dOw\v)\ S^+mzʥFkbKRrͬ~EQ+CҋZ񽵾4MkvÀlbG glm'CeKrDMN񸳀6)I!Biޜ=܂W8={ XgpIl  M %ny-^: >DBQpI0T@0{-IEĘRv>W/KoXJ,Jj/6=[vT.;%sBE }WYIǝf@{GtlmQ!MrQ2*q(rVpGx?|xfH7?GW*NY B''4arF%ByXFk#7s<ݽ BD2HDdtCͽeVq{˞]3!jg^zMߜqϱ*\)yE' *;] };%O}ѩEj[57@ox&1c|j3@1H6tL/ŵ7e"~JPJ+t׳rK/nqnϊ妇/"O>{+7:5hR[.ۏǺ;L'+G!yDP1-e> l< a'  (拻%pLXѣAI^Ri=S+0#[G2'e`) Gb\h,2$}ǒk_е@Tda6 ԅd<sNAEm?@IhXѯa z { hM@M0.I {w{'{adD-tz5:@).͓d،1qRp4G0"a|#,b7nVo[׷`t݅uwh?7t2m0e RE fGLW+MezjEIJy$!`(o3xHa LH6P&PiKluB ~ d\. 1a Gʨ|\Up/ˮDI}oa 0q`~ˮ UpcB b;+]fVlߤ'O`=(jD{?o%նSSe59%aG^_ި7(){:bb^l2a> M@ۍ vNhW倝! b#;hU.DCL6[-eo_dl[,M@D E'WݢYȿ}5djtq@a#u\GWK}i<#8wfb<_m2Iy8A| Hڹ}oTs[PZd+"G< VvȆ@oX1B0X@Lc ={Idں{^Ph+R )LpZsdE/*HBu0H;zX~Xu<4 j /^Ѡn< brgævQZ =̐ăUdl MmC bvf5ߣ|=}WXE҃>[HHt̢ O{>O>sNߓ7Z.% `d*Ֆփ?hTe(B}--Pp$?1رToyaQ'֦]*Ohq T :P5zLkC.TKKt(֑?YNyd򧊉/GnG]C/q)G-Ok2KqT"*$9iewV}¤Y?8!KTdTf 0UB^$ˬS%S+ã&V c^=LjHf[qJTZb:R Dj$}ɽgP_kq+6T.[T?$.1C螉'N˪tx.-.ۨ{JwvV^Wz&…3ݗA ۅ}BVN('ĩqYXDkW rװ*H܎+LO9nK]w6_PS/MDMkjcp%j?Err?}&˾rY}x˲iGzT+ńQm4QwҏGIahEz 5IPU6^z"NAJ9T FNUWy\Id*? N 9.\Q/cĻ*Y;l6zos||OF%x'9Š'kЁ~?k(Rۮ=u;wf} 5^~'ͮ+cށ/)~'ӠǢ8ݷƗ5СnNǞYi$3'm_`i)"* gG\\Y9 7jr!KK'LG(:$U>%DZ~/ RE]@,7z?1`]h[CB$ 5bJ. X~(!]?[z(  ^e.K!GBq $BȐKW )Mݢup,sB\Ⱦ"+gtl/sxU=i, QTeCs ɖZp5S{,n˭unӫAQ hB'_iEγH:? Q!ձW%vRIHr& LVbz+ޚǕm%۫%[1t'2yxs^Xg7MV3MMYyG.GQ3jeW3M!GiVM5&zZ ! Elj6BXj Zu#|Lz)J@|+TQ:(Hu/ΥTh>e؊8OS"?%+yc(}O\"9N?Ҕn9)̇ >Wٹ `:p\ `ƾ=GF?28i 79C=mx(ƂǞI8٢3i.&O{OxR}?-)|9Pe3vqFb`bcYn-#M 3Om;O&YG"s6(#l |ԙ? mTӝJ1c֬f^fi2{N&ޚDZg/5OhW$!(wqPhL[GGWm& 1-LMq{\֎v聐$& D( X`ifst-a%X+K7b5d .Vͭ !H5(8 02 /$ CK#LԆJB;?l` hv0&-<fM QReJĦlXKBGqDj71c:X>~V,˾"+ke~/^/B60NzC:{$W=l҈tK}:+DY=#+DTdy6WC2(]Cq/?Ց!n;{b qU,%V)[NP>%ag4Y(# s n=37{/!O}9p7D|؝BDEhԌ_5sk1( UpzPrP Kr=)f!]9]xK*튆zos4rV|^:xFqo7LY]Pw7L -ULY8,li3-"H"!?]b@)a 0goѶAtSi(0 p0usc л#|<2je} C)( ߓ.ef瓒)OzZ4ױ'*wUN ת7[{X>3~5*@˥hw?rNAgZn$֯b^mܗC»m#XQ*PY؝xb79lE$u>s[0p%3 >v(9$4Hk"_m" +R9 0RދԐITHOi L;!&82p+ۘʧl"Fi MWlS"nhUW"eO̍g~rYG)Y1RKx’䖰; "Q?FK;g]HМzv F>E)Lm:%E)wdFTvvH;fqLd4=.’RpN`)O9mO]9b j-4TQjZh I {w y7.m`)ߎ\.lsiKQ:ۻk:-r;s,[7+\1VfˎDJ)ssb9DRn})@{{gv3&3 jc_0?rjÑ`eC{+4A'.I E,N;iap1͋?d򧠋 [(F0``5磐Iq3f"zf劺SGeBntۊQ! ђۻ;+])k^x5۾=~e/W^VsRLujqP@VO )WxUlѣLPa?@^˦i1 =Hfo1@^/PIb$W+긚:wb9` P˭'vJtmV][LmmYo:$0.jщ,&g٧{Xj<1m:j"w64mxAP63JVR2TH3Zq8zpw}󔾴sI;{ӭkk mҖ p\uU6ˊ`:wA|J=]8ϖ%/'~U[_Mnp`ZG ^][z:=Ui[[5(@Ј"-b̘XuXπ|.dL贗MR`/#,J) 42N%8Ȭ6W'a&oC{JcdU_.z˖_pMtu&(j;8Jnl=,3 tJa @zIA_r?Mqm2F~3KVw/?ԥY%E C H$BO(a

    @/ 7ᴎ\ Rƥk&$,8:%ɨwݽ#.F Ad1S  ]uW/`维_}m+dZ֦pqABg82>&w5`(o+_[3;Q(_Wg4nk>W/܏"Kk pv͏@7.zc/! IbD<>3`M(wKLq'{渽 k*QD[qWĀc$:!5rwQxcoQG0q/vp6 6dn %R DlmWlҏ;9b+!)B<}]f]ٳ}#܈t36Ӷ Vk7stOcTZ2=eo,{o[o/xĐo<_Yp.@Š-kRLu5"`"uJVg/֔ЯߖƋ ٰӲ )QB]EۑZIH7oO-y/(2įNs>3^Ro߼} _e\m)l˯ú-h wD8 1K"@Hj}]l|]cw? 9eb={.*kk $^x4DQtʤ)ɧog{y+i^.OZ?QJSr6E;r/|g4~!:@3^o=`o}:/ϻ9xVSm|AJ NHb~Ç33CS C,Ead\C slWI^]ퟂockE?p۽7fA..5v[ܯlOoxX/?V<TtD!>ĀQ'h88MiWHnR{Y{$7+}d,s]#̌ь e@>`"GSM"?M9%Oض膂 JMR/.9^P1 utBfcI5~J%AxఀԿyLa3cbză*fE* %GIJ{X&UϹ/i]_>gwsrL&5D,x([ .Q16SWZo㝯q*V(Ɇcww!~_>!n9q9N5^{0aɼ!aC_ dqnp,Z!ek̀EŊX+KB"@g[F < 5)J}<]\|}<{mhnc_TeQK/udf(%,ƂO0KP`b%;q meqãͤ򈞫Ϯz?}_@pnFI&8BdO]Y~b.b79ih07s}7,5(rH `(LOUS-jnUW,\ǻao {)$-Ij1f "N{m]ϷN) Sbk 4-m8He)Y2;ܚ>u;Vʜj'ac/aĦ[9 3xx7+ͣV7FV\D~;L.z| Vӟm1Z<%N.ΰk ep7A7!2'.g\xә 8ˈ3'/(g }$a߸GX4IKS}ntSO*0?)q򿽨A澏4ǩu`/9`Џ 9"FH$7vú5f)o|)rL2r Y!-nʥ\Ĺ%Cc]ufZ43fFU LڟlSIs}^e_5-dz+n< f$F?*(Q9;Z]NX),W0RC2> F3?3_y{/axP0-~/b]!_AWJa\"!}PtG:?Ʒ#/+~0銃uK&f {bp1!licGK'[}[N1AU872`])voRF>U;eũ=y:29Bѵ* DaBt rD$c^,XWn3|oK^O.g[ȭ^MtƇ_`]q[gKL;iDT=Z~4j]k*dS8.HZ(v" ,-I-PdZz?u60սpw_j1 vXpe2>Ԟӗp-{C#'o4E+ˢ~4xx}fr?b[;D0 h;>EIik~y(* O6$ѰkTOGq-C xQ|x05)Pj2N05LnZ}[[~}Ki@"ο#J^ g?q $N5UpbTɀC0ڴGWe D2)I نߨ[{j4V9^}˄Ѹ~~LIA&Q֮u1fcGc.;Ϻ @H)?N/'wm/1 9EW23dZmG C?! !>E 8!dQDY*IA*Tc#X bEbV ( TB$(~3!7U!rc_.hDz-h(;ۼL6JUc罻n*ɢ/s(nЯ-Sp=`QlXwN+ߢ\x33Qud:Wҩ1Y߃Obq2 -)$ĘCzQeF/=;zJ=s;6#1ym$DAe tZzX,D_´7l!*DҔ Яr[+ufzi:dpԔNӽo]-W](='KLʍ-O.k0 ֮q5><KWZI:5NA- J)AIN)9)+q-+?DlJ/n`\elLf+bkNTʜ%bvB|EZXտޫ.-7l(b8arŴ7_/of ><??o[s<pAl^_n҃8"$H@<)MpŎSF)V6N7?ߡ!I;]1EˀBsZ704].;}LkP[ .f#65[)żL{ S"mP_?D]CYHJ8HEeQ\惮rkauXecLBjY#$$eJc;z<ݚJn={4Eᇞ _9(UO3Pߵ~>\ǽlxŞ2>1dP-҉P[=ѺgOeg1E6Za/@s|| 'vGEiN 0|J  쒩!\w;ԓⰛYtVJNWtFd"4a~7:Li1$LA-r{njwgCWxL[2fFLVjw Le^GgK\`FyN+vTN3do74)%?]204u>2>i}e闩;)Hx %bׄϐ!(Ycp2//C*Gg$-M,@W. @ˣ$u" ie JkP.=K_W~/ o\y;^3]Oq~\??aݮy&Fc3BZ{S!V~+k%$7f|]Gүe#;ڹ+#=dG0=GXX"1o[m2!2lS؇BVQ<GX[5"0"?Ŏmi@?I2lHJ*CdV1=.`x0 364UF'/#&E Sȸќ{Ysf>6~S $yK}~]8^ 2ErO1Q]Y/9q3kUYW~4 nAR5KʃsɐWe.S4I'Jud(2B}Ju9 ?C˭J~vIWm?g585R7-'}^rezԚN?^SSۺ8;rQ[D+0TdH^ri%\< MwAk':@Q[VzmP]*VejԂ FR #P6'A7L,!!F`N=s%}j`|~K`˥:Ouq=.ZA1[߷J uW}3w/o103 pZ,RM^jעbzUYzu?F#{RNoi8F)fE܆&wЮvN `=pvz{MaqJW  9ڳlRҰJ{ 2PE=E[FSb[9SJp6C:`]U!F5^H{}zF&"V%^_ZSW }˕ .n#Y~{e9`e yujLLp$!L"`*BA˅ s&f&zrs; ߷:TT{Et=C@eRitO2|o}O _/'{{pmPjo1‹IE0HV`B3ghĝ|׮A` @A Oߥi~h&;a7e㱒>" QD:?@!(1luQL9OAb2z؝OWun F_V#5_As&#K:,_~LNUHkMib-^jYHZ|96t& "/~M5Bm"b{FmP3xkFfTlFk:躍g6"voRY5,Q1w\EROa2ežeₙX<7-X_@f;23Jji c=Nz3Va$yĤŢMf̳(ѣNYT^{L8MnR-,k6w TFUiex3~Ƽu/_fdW _" Kό[}>K9/w 4P"'}dppˢ0AA vƍ35$ ;&sV~/0_ QݵNOgP4^w|nzRRT @ѣ[iQN֔P!*ߗKh\٘+ZVg?tP KZQ=W 37B"JԞ l$.GLocixƕݺpCY%KWVZc^p2|-'}yd,֯~}2ʿ˯p&bv;V吴Ãn`Z"KTR4_AEE6Mi ҉ ?CsƆvg̓&ӳj"A K̂s:Ytd gꎼ})IsTS\q puIZ!{~}-W$[7[K'2eW6"4}k讘yᜧWf2Jv^Tzz*e`}h 7Sv^azBf:L1{ A„QIfEELTBٶ?goKDKbD0K&=Fk/zI@;]_ccy׸󾻦. BIڇ,I4ʶێb6+Z diRcnKG`KgA0y<9hQ;|TxZW);]}N5 inM4 d((L;OȟIBpAlѡ Y!ȡu q(M1Q1>{O[M4F ʠ"NBZaXLǩhNv2G|Aʾ;t9[ E;*B9 2&ljDثH! \l#=v37:MvZXaTmn|еvkSWFZTST%a6CET%D|ʒEW`*(j؊T3 tVW z틍Eܭ.<,U3Xd "N=GHW=1 ȺbDTR$Q #'Pj=`8>_QSo:-aC34e󘴯M;Ƚ32/'5VvmapO& `a3?eG+(yBaʼnkGo2d[xM\ K,MIC Õѳ9%,GP9`"Ȕ<Xڹ]¢d@H"XV7ov'}oSP8P6Hf` 0kǡi7r VД24  ̩z}5 )D01\t1#ű)J\y0W.k7P&8gA.UuMB + c`$4[S< l1ˆD 6/PA45 4وȸ\Lzim¨<=_ʁfvaX@[elt>Wzk"U;.{HQzFz LԴe2o_J0|\"GRhb,F |3#ѡl4\š>f9ƒI+/-"-W{7fT^ xvi;|KVmg$qq;F 0@"-[6AvS⠭L8#B onJ. $![A^CncS&|Iz"QKL95JbJ,Se2[qJE.;9Ǻn6kES ?`1Ti0g嘤РA3307U`W!_8#h\ ȗZZQh-hu|'态Dm_ qG- 2q#BGO-Bq_a``|&P{:*3f3Ȋr\6pK%/4NmDrwFvw^rX3$[0fm.\_>Õ%=--{ӼXl;<łqx=nU3#Hgi3i z*b-āc7>x!'#1Qb3W}kk}cԩgy3g,ndď@KsY$49}&D]!𕵽yÖqCԔ0͚km~Z!(8i{1gu^SΠD -y$LlXPܪ/_j'%~LDl|c*0vȪOƦb`l5G򶥼YD ^1^=ƜlZzdq5-jϨtϕ9[mVVxy:X(%P<4QPDtJ,f,z(e=0ش8PjDcǒyP/vu>|0tA/RPtBzT ͵$*gҷo߮xr3*-5һYMKQD1ᒓ&a?`<aF=}%_qAU5#)R>+؄d}ZV,y[_అn?qBaBD(Q;U.&HOdrAq`u&\K<]ȿrMM|/`㇦kZ;h0K=.tkU>C\p 6@P8^kQu~`LK4p< 0(XXf\$Ymݩ\:Nd07Edw5^/\֐KxqXx]q By;ފa?w=Eěko E=q]f.1iP:@ҢH??0콫$#)Fx[GNC*_{axZ QOh4{|m:ֲ`0GgFe{g?=׶{t?);~ۥc)q8^|d⿄~1\~YXvrJ9#Ovw1E\Qo]O%zu&ZMO9s~_uΰ;8ygɟӧF93_NFׅt gBbu~72~^ ֈCk1:] a|${ R NP ez𾻱8~xJu6U.kg:-{ 'm%\*kXTJH~4*%fD1y-o-|m* |'>-LwVfvn2t0o=~!&f#ļ۱ӾrgxN咗uGG;f'Վ CYt K OMki8m"LƣL^A\ĀR}.܎< hz:S  #uPrSQR1Tʭ~Wj&DZ˧U7݉4,oaW ܧac:o*RmWMܐ,D0Ԃ흯ތQ#/k%ϔ:::|t # M{79⦝f_?G)9v,)R}o{͉|#-zm^`#nցJ,`C+mBTۚh ߈P:Tž-벢 Ч; {aˮM[Tcb3yŌ]Qa]8ڳ ԴW'뮠e-kK7V<}ݫ6+c &lQd~4b<DIo >c`fgrilarXi~6Sf#"yf]^RM7D$ߝvĊ_=?;-dWzwvݪsL7Q;9Z&te< 3U׺j, MQUWTlh2$gUC8Cء~t:Yk@Dsw]@}3#3]攩(wTk8pL)-PkN+p|;!U̇9W_Req+o/3)εe_:|g.PI:կ6xU‚߭^|x~&{Hb.hm5t{xʯ+T̼Oev5_+~{7R#s%@ t: "lR *'P;k&?Y0sG5g<vu w_c7anj F +~q0SD߈$L`y/`ܹ[ <*,d*"%dGfDǪwXбP, c=9~t@}?3?Zf^z?qֱR8p3Oq *t@ S"{>D϶ޓ{y~ҔV(|fکn7PCɎvmJ R=CX&M"nK}!g!3U٪Jv`%|7pE>[KuJ*rgrcOC}CoԐp֯OsVZPg`X(cv(6nm=4|ڵīy*8:{UћyܔWRwL]un!:Z\-#ߥÙOv>a}n%.+\ٸ0( @cPMk>U~G"d=`-Ϸ0ji֍';LeH B`Y{G2q=o3$#s57J D599c#šDf"TQ@* C._~>7{U_g<1__ 5}L1 fr)A><8ܹ )#:t"C$q3Y]9i2] ۥiM5e&kea[UW?tiƻ 'FOk)Ş}Mw]ݦP!`ߊ[`{ʄ'=,/Q]bW4~nCz O ٞX;!%E|.'9~qmq&-%7tV5Y vgq5qt.517S7X+{$Ϳ9Pég̪^K|Y]{fA&B0ǛzmzL;~2SȪG!rZĠyr=|E1QMfdĨlR%,11pC, x[m{}u}d9~P,ҝyٿ,:|;}<&}C]6Q0ms1ܚ~>-}tkljt)zg'EK92oJuIR^d6b\ҭYp)ӦYCH>eŷJvݬ4sp]m\ne - !G!aj~õ7H[ͽ :n͍:4T=odH0:fȡgP7U9;N@DZSVM?:g*~ڕbY%i4ѪGst04g\L]D&HB#j@2w~mOY4indZZdnj޶:έ]n}ʬ9Y4g,n5 m>bȕfE =@ `c)d2%Q8ɯ{X譒8,[>#π$0'ϨMb35oX/^S^D`3ZFr7E/ Ey+M* Q34ˆ$xA5A}?^bu*JѣC~;Ӣn'*>sc;<D7+i&^v,_sZDx9.`=8YVa.nEmݩ (E_jg3cG@∡rJ\}\\8?k{?iuDcH {":PvN2D\r~C`Bd,Hq  S,9^p0s $x_{/E IGdS"il'#/FʍR ]Ej-IF\(6ZMwa ^-{_B歶*7(C{+EfY_Wo}$Pjvĩn*9\cgDOeEF>TE߅^ƙҙ9e[8]nyw~yPVhx:jm ` ^Og*^.ݧ"LZv}~Gϲwԯ1F~4TѬQ"(1egc67IPɡ^ @r rÈIq7[WõM>hY?q4:d۳hzpn}^fa#Z4Ȣ*˕W7>>7"ǛAjzquMjuB$xӰsT NCL/N)60-]ghԏ.Bj<@0ak6G@F#z7iP@T- 4}~$=M?[ jT|K1= /nLΦ3/Yz|5P @@io[M>s;k`ww +NǨR)E.w ~/~d,,?S_~ ՞\^-Ţ d6v)}4 1"'Po}Q&1d߯il0fQU auakZY*p)Brg8~f{Zz`dSSu ./1Oҭ_%^)eg&Ʉ=f +;ks<]s8#hj_6Ҧx> cfԶ5dea3Hv~ ׌e/go5 O%];8@')z llZ a:Zp'ḧ Fp8q  T0bO܉ʞwuXyt]&F:K&ZQ?c;֍!-:dW"Zp_D(rvne#^R(%MpzdA~ BG1?"hG tH!5KZ^sSFI4| Ax;?/mn;) #ގ}"ezږu5"NMӸuf6>ѳ}22wm7[[,0h{NcwjEg03TzEXBhy\y8tTenME1]{57>~88;>>uU&% }[~A"~}ʠߓw:/s?wfR@2HKI  Ă)h B+0,\ =՝;W%V'm? )yߔi[٫#IbK[wӘADQV& ϐlNLUmuzyY  :5p wdʶmewiu߭|pvpﺭ#6c.hbn9qa u #[DC6Yhf\@{jԿtId>j%>b+^@mn]!/UVEb-O5zBbF#Y~8j"h,7n2isߝ_%rS@Y4-S2JJQC)kFǺ41%;4=kn+GJex GDEܨ+/nBnЫ/j_>)o󶡦q1q1cm0SZgV;~0ǫ fB^%_Jd/LhBb0e\&D۴FPV"$'[R.iLw4v'd0Ck{ ?݌+>sJggyhZuߗ7P֓RҎhփ-*}+ ϸڡdF' ;Ek5:<6FFeƮk.1Ά`V8۹6{}mqFI( ek6iNF*ǾJ2fo}x1,>KzINwZ;vꑡ[yLy7iΗtZ+g !OD姌q1`QK?>3z:EYHˡ l.^ P5 D|;7JG/c"DT]5/rr(( 襋qHEв=}&Bш}*Ğ4X24i74߮RygS/þÅ4sj=f&mzCbs*p~ZDۂGQÍ6:ׁg+*qlM|ڗ9Ɇȸ̉)]qLC 4I:5q/x|o# })j5a6as5HQnxz*Q5.oiZ)]cӕH~Vt,Lv/&tNI#rcu% wo?t}kVN5%$fw_lXNflk!#䈚AA7p6*.+OT;h-Rl" 4f~TKƬ\=:j81pհ#iN$Au %6lU9 Y+uJ^\ :psM#YT%{f)*m'u>5FOf& , zs=iW%)ܳ*L+@ :kn(i+ЫnP?ڒK |54ĸDE%.ږqՑ"ܶԙv!GUWCh8K/=I$[f.,qx"m280M$9CfAd-!6ůހe5_mXQ zc>kkr%pSr 4TޒA>)_r#x e LIj%nE6N(+U0Diҵ )Ld -}2a4͜[R( (KNM߯SC 9xϢZo&D&qK󦸈5ɔXy[9Y+}Lc_j85wp¶=Z3Hk-7⦊;Dt*:EZ=W~Aњ!Bt)btV@9Ϩ aфdʤ䁈JS84NS& :‡!MlIBƸfpA\:.;[.fŷuWB(uvNگ}QE]66kjL̏57} (,&V2H)d}V feP65qT}v<D ؏QDs{{4٧lm,fhgy؟o"cp/{V/FѵK<V,nOO<0n]z^2Eғ4 5OAAkaw4|t~L]27_%P~+*p vH|Z*1 8"48;{$nwsym}֟@wsؒ|a`jNRNfaצɍ#5v:xH|-ϔsf*_ӗlEހ{Gj'9p! <# 9z;N2_獬%^3dtb`W[L>d_nŲ+wIB?BxB̟VB*^kk``#i Z>ؙ7!q7=ZofWWЌ u}l("+Oq{N$$y~0֥g-uc~Gtw~,|M^e^ ƭ%6~k÷x wY֞{+EIeDScov'ⱥ^)BNM]zc(4 Yᕩk+B_<ңKw ~amCTw h ϕ ՞H?P |Ilj"p~L J=jsΟK1Țq7MG/~<|i{4ڀߧG zru$R[3C-Ed7}6Kw;!};M7!> 6Sygr]gpе_-g7X\4câ ;b?Rht/kdg#Mt9Em}h=i%eLQwQ-ǷZmo3wk(}}K$? i_zZ+IpZ{~ֻ̚">~ duέuߛ!0djAF܏ y<㚯ğon{h%`5+^Ͷ'K{0bb;AE{ 域Wv~3/JDq ި@=Qb_[kOShUag;l,΀sqdbcm֒=6P#<@~7#Ȝ[&L*[<إs WT*-ܫ8=#M<鷯e{>T^<>RuILvQ2|p0>WjBMQ/^&d›)--GaϜ٭8 )3GDmXhSjN/1wsڣv}: g%E6Q}g0ߟgAPEçthi%L9t>B03.SŨu?3/Qw(S!e:ꒁޑ+D{bj?>!!̊h] w=O0ԟ%s5FX。0FuF/V84< _˩ބ fofB9Q}$\4k& !* S(kAE,?)@@&3[})b02䳀͇qr->R"4laSQGOdnLˠX@/--!f yb|GS*$,wK-MGƔ7! R(mb\VD@Nw=H9΁Ũݻ'|JpN];aIR2h[P9-5t0Q6ύ$3e WHӑ.=DfQ`D ;[ d]iž˥*7^O0'\GQWHTEb\~9E9%-FLdVGג9jιN+뙬hb5]zƵ# ?) t;/6c]Fz\5c%G[IG8HoמY.o;.l0uEppBV|%oU4EMlgqYrfʃqZ3k>\BEJ@9&side* lY#l9omѾMv,zbq:k"ylmu0 |/~vWT-ܬ#$D,,ݒlU8Tn+߭4Щ"sY7/07ㅲC8rv3]n; 72M~NfC=[6RgWұ.rf:ˮƾcYO]:CFNo- \kPc'HCBS! @C_`@HA,O9RwrDLjCr$mA"$_W"! _d鵱/̴G[N=VQXK1?g]=۫/ċs,nr Tm*Uj3s6pP}-iklc> nBC?OmC#cg?n`(3?nH{ƍugf8xw=}p0 oّȁ^ M :t *_70v/Z#"j~o߬S&TplF!COzG·{u I;k)EҟaYѭ(zл"{`޻Jugԑ i)Gr(/9hG:v*)_30lde |ڹ~M ^&'ѭ'h~ x (,~{ bl<7Cf<X[ d` N5{>@8})Gt!lc.[婱+V4h!X]l}m3'Q$z[WkĴkZIziUP՝`YxL.8vsq,LPަ) F&&M3↳QԱ~OdtyӀf,F;I]+V4P 0Zxɢ"J<$b^N' c3I0 XHLᘳ78'-mcx%@d8hYKI4;?41~quW:FrS/B(:rpAM8BNCl.co` ^F4{(G:d}3r859WNI0*ux6fz_T/.|=_"zô`+OvQmI5B :Yi"j"S MSt:M"JD(tOr^hr Q-W?l67=get*LU:e!x~,+Oӛ3P\mR{[m\u :S؂Jw7a~s|)CÅu sN\JP6KItTRD5 ( @! Թg5h7m.']y`5Eߪs)1{E>>x8.}+!$#=2^ue6q ֓> 1KUgֳlQA+ 8>yV쁙vEޗ~јu¿0ByW ['/b n%pT:"v;Neԩd=mn^40͖ T:^Hg.6dFVb9d/{^"$FMR0탹vV6x*H B__jo90k e".r% Y?.O\%636gć}0^\(8[ 3=MzAL8=Ȧ"'+ӢTh i! EnZs_[$ň`v$.k:{/Gǵ@R[A0C=灣ت{q^lMmͻ6 1ǸV9"S.jq`2t60qM5ՇT>C ~=0XK)T2Ix2}5 jC:ӧ2s#;/`Wֵ4^g!E^-VN}Rcx$F6)_/A `URu0#6#ml̳2nNtY6ˆ"pqtQT[Ҏ31ih|{evx887$d TRF5,n"efm/|3-X8]G6*-gpYnψ#IIGA,/-^ДuܯĂv~3hC[ Kbo#tTDS[Z3 --*eݪ UP J`a{u"V= ~C[KnRfTs\ e“Nϯ|zt31MXs`ƺ# )EIbqڭ@:&MJH 0\H#HB`\7Ԯ_Y5na w"(٫cZm.Vcz[u,*7JJjE oKf&0zꛫV@ S05Z`!-h#G.> $U3֑ DT( !/j!p2ۜωK{iFgx?8{ MCOT`8ǭ$+͘nR!ɔCf s} F=owXʥwϷRƿYPzކvnsOK"}WPq-%g~loUc?N-?T8z?~ wT͆^i$؋3-E6j-Vt$Zj}x:;=Q}}}Aegw׵_\4OgP-Kԫ˝r? lFϳlaUE}sI= y ,Zyoe6ѩӻu[f%.IMFR&uYe7,{㬟R`QJ1#ik_̯roWIh%%rSS?,*]&š\kxGrZ=S60$k5 S<}>vٷƶC1SyR anlv@5[(;yْy bEXGږ. i$E,xM;MJ b'QP^ÊJjX>&2O hn#f뻻˚Z#JqosvV[/=tj_CA_}籷^ݯY]ޛOoz4箟m޴ms{hA)TYAu};ɾvնS3_{枲S2mmudd%k [f59;b(ŒJEj@@hp(( @: @֟mP [ H P4TM5%J+`%B*’ Q$ @)l ->N垚npMf>޼}:ҵW#_yTD%B> wn{nz>OwwhzfI*( n}ڷ\b@gusnt މoUwnt}G B hER[MgCv}ϭ=={Nw6 i{FHD|"=GpemvPޡUP&ͳ@T([jI/v7P ,o= {;fCRuE#Gw6/Dv[Td3wAյ%yR|'nwow}wܖw{XsMG] sˏ6HIB㷬Fr<ؙ״A}Λo;g^]s ]k @9tq{up5qUTz^s}(h*݀_|Ϸn<۹SY8fǡ^&[zm;ׁܨvwglN﮴:h5x=[/Uӱ8ͳ3f{p9z={{ZQE72#r9ѧ{άRSvh.zi!jkn#os%YuXۧ]t妀4@:3pw5 2d`L ɡ&0MObdɨ54 @i440LL)M4B`jf#L2i3Ai &MɵA44ИM)4'fi"y'C45<&&<~TI?Ҟ145=H4B4 &#4b1&&&Ҟ L5=14L&4 O)OL M4e'ꟚjڧOMD4򁪢3™żG LP.H$#o_m{W'kG|e]B)QH7 ~sy2,W6]fSvIHpu`?QtW@R$;]oܵw󡠶x'\XvRXT)ȣOA9ڣyM$>~8rQLrcu9ˌO}_7G'qnM޾U#[_IdH Y֣zЏC\KƺCX]{۸ܔvEt1]O"YieJ杗E:Jcݑ}oE<Pe8O_UTe0-_j&Nsa&Frȕ؝7(`6Vn=r.xF(FF0.)Bw̓M4$OՑXsLĆWr䁮;pMAwkԞ>KYg+s.3DHði8( Ot|t@b@ mfk}*#=cSHȢAO-iŸj =XNn9kE+n$d:JG(&JAYO$oO\^ja _K[#RUX@E`AumEXo5U s`+=jlM %*Tf~*,=HpF,)a33]Wlp?{˙lPrs "s1F^r8XUE)R%"*f.]3S:m :# Btn$\ZL4^]{m=B31zBB@jmE:PC1Jh0^M݃D^ 02iV5x1ND;\ VHSQ cxL$0Bk,?gV<לX3VCiQ0i_Gur*S#‹-fY%(vDcתf{lwœiE9aqA^5O\t"[nVHBCI=j*&uGN%Ϧ'_R u]pVߪ] 6LZVI;ua]&Y n5#P4sv\[f 6oñ9HJiuұ7t81 Hh%u^g^H9SěćQ믊61|tS;G驑+%"<8xLT;UϻQ~\pZtbuGHbK(<=0^X}/1ïxP9iWOewwC'Ardb.&nsqG9|l W|h./{_Yi[?P+T"i0Ķe_ &I,*:Ne-'he6v^<)-BEo1v;8\f?3TR^9q64v͂Z!\zp5gf0$+C ,ዱZ]Z#bSv*#Cn6,Qp(!z0s,k/|;W։R,,ANt~5)ݬܱ/k xō_"Z 81`+~I΅۷Bc p@;Ks-dQͲYh|zrTqLRuu^I+P9 j2ۤ؟BV={| {$jx<%IG4\vȭ'aS~;tl 52BY/ܷW5Bzg^ Opz[HcGugԎ6Ӑ@GxZ1P-%0OA/Ls~Sa7z,n?@ k gJ9`ӄ~M%%$0 v+>%nxb=2AFKArYߢҡsl%O\}mh`K[od2I:_-Jyp5V7a-ٹ:x(YX󆐍D`y |k&ܰ=f |O S{{JznkNN +2 _Xnewl'BF!@w}M ~0vM)zlAwExg>.TB})yp<`}$(2@ - ȇqSD\"zCы2P% Qrd?P_ronvM{[NrQbQYwlD6emb:u#(Q*DI?X~ UM#>a#]UT9" !8q ȅqkeoNc@4wp aM!a\\ !a^A+:"A|M +Y_!CW_=0K{"A|A}u^`"ۛ%MÆ?=N* DR "-wh> x쎥^IZy9k2m.V=.ys媫ƥ/Atߦ9q DFd.| [wL`sso{CP.Д+1U##ߟUaY51uN'hk6rӅnOgNɵ?`5 ߠ#u4z~=`S6R}Bx41|ƦwuPqPWzPI0xu?* h!kV Χ[;ӌr8\Q֢qwE: CzPH<. bR9mF?:7 Pr5IYI[;qtÚzd% 0 y]8CqnyIa va}p2e,+Z%,_9,}N.R i_] Vj1)#KKeƫKӵˈ%hTa/G?ֱ{FfZylW:oi"(]l?iїXw\z<9zCFRv?~鶥HWz h[^XcPZ6;SƼ&4.>:~=>p 7ezOz+ ,tv Se{+QmՏӃ+c kغb-֜t{ c9 (.+c|Ĝ-u;{>n[ZwLWNfAIh 7ƥr7L/u^;I5sQ#e1m=$J$v کD'EJ?Goǯq*7Ylt=l4zP%uC()v|mCĻ G+ٲL+gGGю#<~N+Pu|۱{ L^-[ C@q:&SYtJIl-L~WcmZJa:s;\v|`-Tm C|S6Bpx_m@@m8Y;˱sn+CdRޟx3]|$$qOT?0z2}ALIj[k|mظ){V[nKɀ+>rBE(lk.-^/j\M8IZ1 %!,:ᓦaLmPec.Jբ} S66rIgţBtd[}>\݄qmRkOؠ3zw( tGn]d =8 Cw3&kR- =_lvW^t^l r]@ќ sdJDAH+'wv!>Φ[NHlu!=ww;h 2@--9L ^jv%o/M>AMBT,Jz[;E̷͞Gs6\Uj"%OM jÌ6uU[~vQԛ]zm\R-ǿYs񅒇nȀ 1aTg^qcilmٰ\/k6ca&yXgA(UxS'v@Z;slNJblns˝~J2u->+~3SU; Ҳ:c4u[ǟuhrٛpP 1Nw]C$gSޫz%ˆ= :{7.ٜ9-.mQ.7.$ eXwh֢R-n~ pY3~ʺ'4;S ,C&mT:2ק*k 2M Y?F.[I5N6 w_)dxN;78Abm"qNæ3)eO)Tktrri*bK 56n9)3 VjE `-R~[OgGz t8M rT?rM`DywK·bvK+dEłAz\ZY/b#wZJ^(fzg|@㘝>v;tI_&_X˙"u#^U# _O~54\oUAjⓩƱ{j5dETcm_fW{+cgYRjff:+xڑ;ۜ ugw7yMy=M&㻼];KS༼^#2:*\[v`EЬk:LKobl }*v'^){2-qH }n}H3FR$h:5qOsؾq-7z( ̵N!>v EpWya Wan3@{M  'Ћ .<#ֲ0 Zu94y6Ȼd%SJ\o:z’ 0H=:ٱ]NF6t@،4=23þac4򼐆8b'oLհRNDnwqʍo?+8~31e6!@$ n5eM08!bHM>m-, 4i{m)%2o? 3R.yٜ2I]KGTCIj.#XG[iw H|'ēqG7kbHC`J${i? ^OmQ?enSyGț+ֻ=@i6Mg Q}^ IÀ)j~s#_28kɢl C7't`Z4V >m߭sc>o$uyq0u燌Tەƛ֞ůF˳Nm~:ItOp^ `6|X ۪xHi*!0'QmiU^oQpqk DXF /u `"O6w2x-1΀Z'U[Оؑ7mr20YʴwE)0,C T!$]r(-&j߭rgV nBɱATJ_+n7$ev7>FQR8F"05EDnGBK{ߢģLʺO^CMzWAh_?A+F|˕U*Cn,Y54"!ɋX/HIqw {@VI!.U/x ӡ2`-݈.T(k:.P}Tf|A;aUF:(YV Q aIn@`vIcmnINѮw5A2!s䒌"A$j37OK?߂yk-%Euusc[qbѸQskN"P Ivt~==3K wHȇ0.e(H|F&{VLjBJkLa!NPˌZ<̚zFr8ҏB(G?8>,w!I(Q[A/u<'!EHr.)Q9rg@`TT]Q_iF W LB;sԞ$(0 F[{hkuWGu~7G)WU}TŸʀ{zH. 02\#o+E_cyIaes( 6I㰮9A!~S5ϧphpClm\~l^z +X93^Iyw U!4|, gZLVݎG3Fn x$Ԇ4d/X1QXV|.!fG#Ԏ;TA2Qwh:~:%{NL Y>mR뗽r\Z'( @S-O4%E>p㾔8kF7K*o=Ee(o9,M\bYnEwCaSc;15-07@8H&= js0er#|V).y%AR)wrjȥG^Ou1jut솂Vaߖ*ߡSg&Q3f%^)4m -4᩼:k0^4 yMS~u;mv`ͼ\{M]XVeU(ψ!4H%=&@#΄I1TQWZ1}m<.űNM%PI'%旋EQ)`buݼ/:I'k2<27bkiul^9Y9`.鷈E`ENǾ|w=<G 22IKOFxR'̄6g/$H-/TOK{Pڳ]/?)_CS8;c+Uzi<>7nLgy2TbJDqlr ܵIy5˃XMrMv$#=UDz-fu#;brSc<.wPؿtpbuN=X$Rٚz0֓ԕ\16ʴ5-MW*xCіJ?f?\. !,F\[ůhW>QkǙj^oH+ k B=ZQOp^,m]ַ뱮3,gȖ'qQvB<yŠWhguRNh` ;/.EAsT@;UUz| +jN^'wq˷On~bRƩt[XRيS$/D)T?T$=16mQ6fΆAj'zbocDOH, jBCwx:~U=:R f^8/=5Vv3s( ep;(]ׇPڸah"I.-?+9H]O=@'J| jo " ,pk >Jd9† y`h1W~9tFhEǛj&xziK^'h|`q[I{0Ā{x!x~Ui дBCcH /Af8E>=iyRνڿ_w*O8K5nP%yi$w92 O qd}A2ѝ,@L%ƺ/D^ @Qnu7շMjRAw~bƭu* "!ƝLP>mcL:*otG^lrUp('u^\yLn(ғ Ր%c5jԙB7$C{nwM;/G,I ,UٓPs&D)k4[w0-VF×daK 0g5iƶ 8 H5KHŠfK*h@٩Ń[A?㹃0b2I\!M]ϴOL6ݼ(A-rc&⿖dF]ɠ-}xv^эXϕs~ ó (!ilFJyj+R}HY]Ti"MߋȁYZ%""}í.iyVh!YUA ,J1un  3rW#k`PGZ.$jT2HLs)5aMc &Hd$:LTB#8a'9xR Jz"{]2_GH/~ZkDT)Rk(j ˃3ctx՘2SP >SѮ'UFcGFx(̹eF4G:`H񗿴s~T%Mte$Z9j% ъy*U,"%9P7sI~o} ޸rS f{2YyP3ed>-!fsC3T` mMڔoO{ _+@DbpII{{RMzL8%L *Ԭ{9q|qLDHHjQl "rPKlx\\# 7_x4K3(ܭwJz|x{O^(I,AC-5]K: EOy~۩)̲;ڋ?=DpNq[>^R3|>bKG~ea&' 83S`yv[0愂76CGVj2T_0gڔB8a;&J n,XiPs߆կߖ&UnH n 1:5T)^w_}2(ٌ t* L=̮y#0noʫn©<}T{h N+t64#QbUV7vOV-xڍ-뱦%f;P~]~Ϳuok~1 FpS:[~Sp1Osys3] ?zU"7vzN&)o|[ki믡'c" 1t  nMo=_@ LIa^'8(f+ ըޤ(3赚pqXiRFge($f<aF W kO {hjꄞopيY" ؀aJXGH\Y f%zi^ܼ[;leRK ˱X$HmC:.lSA7lcCwI76WAr WRePSYuD˷u6,tS(REs߮Zy`7R3QQtZ|Xflu Mո[(&"i3GP0jg$YWʤ.$usICG;)R/ c$qgi,3ɋKUWZqD25 ejqz;~Oow@'^[8!f !h'ck|lvVGEw$^΅Frό@Op7:Hh{fr-*e%)[$jE }A`LA##ҬÀ>XEB z0T' uFN!x$9 @@"#x ?yQ;J~MsFXxbqzc]Q?Iѹys1Y Vq_=0@R·ogf [ qd0'0PT`.s Gp<2TεE-T8b`Ë-' 85e\tnW׾6'^ Ov};4|)[M;l2#uF-3ɗF} 2^8\Bϔ1bS?دY7!=o(Žbu"+mQk)i $>Sj+ήyȅ&txiS+XOLJ` -s2przK=`Ŀ?(*l9L5mJp P5?a^-09:'aP.v$,;0vȪ0XY<9 -ZZ0Mrcq0`,I@ʭzx\`H(p+1bW&iCH%(xI:` XΩ˳4&c6$v:Qimvn$6>Aڬo]Տk F0J? o IUC B2 5>tl֘#zP]g㇭\$G-NS}8s~[x^.;6,cgwGeHsȽ|i[:-YKLMbhgw P[pF')ZxF٫qhb hoߟ0[w3il_Sh߁e?H5#O1. ްi7jeoL'&л.ݟ{?ZS^Q k} ~}Qqm6yts5^i-cld~s9Naܿ8NqA-%1#twqNUOvw7f޷Cwq>f*^d 3_a5&ʸl@/V[~Ne7bB4mxHK,\.!QGm1N}UFҖŸek}PY1_vnsv]Jypg^;-.4jOM>B#EGB?=QRm iiv[a41SͭWLfC΍ =$w|'*klpX~n"WK^GrISwxk|ϓoFQA]O7ǛV aw SC.28(vWms1Ƹ9rudJ@GBdD1?ö2GDK%S;$ZBr*R. S4yM4p(WraI\H F`\U>Ws:=_'a'NQM6J!@ۃ nY?cGzrdzXm&5Q-MEXV5֋Y44k&2wHH,; V{gV`C8s;x[tC&=_W>$c"(cm1AƣUfBgc'cl}']0=AQ+Ϸ'ac۲dK0м)Snr#M ;mfp."_:QRvM hcbomCgI<=Mw26;{"3F -AxҀDE쮹`U@>,۽!|$95Vѹt"zUܰ8MhDψ; Hl&<;]'$+1Y? ue QO"mW ~(JYdC d,pDۜ@`C Lw@(\Pɫ8W;(ڜ 42b4 Lg`'@bcm 0jڝq$|t }BL;4 6_gr)2ʰ=e/o+±<Wy؛oˍX/u+L ]N5 *=nՄ|BiFm9("Ô h9L0}A_wuiA6]71YF|yz4~>IPA=*2MD0`A"*8vdP[5“8pᑈq3&EMS *5ÕdkLr A^M ^?f}qp-%wubh`,Yy XƢ01iPd0mxWo25WkXkG+hIVjhs3܄PЯp%-tk`$6.F4 x {Ba'zDb|*{% )9/+4Bh) SձXU-E26̓w/ʮ%}cows4 _0zW/tuc9dzuMpi}r9Vyzt_IhTBs a2B+ޒ/qUÄ찈W>ݜ &l9WUDgCJfR6/&nO9+dFr4vq}K"cE%ږD9) (ݵû/pTI5e"P @7!>T jS \_ki&A`NsΠ@Q|WM[!٬#8R2pu}@qFum>gGPL}xݞ/ݍz{$1 A@BQ$|DU>Rsϝ 8͟E*UCעhCH'7 ".q8@p't[Ze 2ᯭU\ۉ$HMi0cnDs+"W˼:6}7 h'(\7Z У #"pu8Mim2C68/q"N7C @?08*^BC(B bRr?f?zcV5R DA@7+W} }n&ھZ.!kCIAP(SPb^H);+4.&.ǿN{fvzYZ~+K>ΆN?77_\ -Wv㴶}rnhf-ıYZy˄ѻ.ofl 2)*rph *q PMfWƉ3<ӌ1 :\$46Q'ɳI%_;\*]XD瀝'4C/_a{1h /}?m6f+~=W,,6CAaM亮6 Q(=kSiLaq+U*ױ:` XJ]J2hٹAkʑwC@-hnI@?U?" ~QIX@ `*lsqV[{inf̮w}:ke1e3@7{WkhQh*wreL1~;5xx\`1BŰ_s 1843G,{6g6KW}TqtG)DQc}s"Pj9}; l2Trcט~"g0\o%{8u4&5).C9y Ŭ FZώZ|F^2ƷwA]߿TŽ9/d$> 3d| V%MrlZS-1YxObg> 2~5m s=]} h>ug]=Ո+'t/Kr12z O[GuH~zCT^]N>WrYP!͛H/8j^- gE<8V}NI #*l2GJPPqb!C3SE o@:9:9$eB`9l]'u~vtHGE|?Ў2&HF ڕy];":.+ɓ*\DD'` U6Rh|fܬ?uݍ$juR}Mhi{nÉh nYȣIyaEMc3'0rbeP6j~`övvv4rimH}VBVx?Dr>w*UԈw5(}`S~ ebpFѰ;;LFl>\6س]xۤn7`T{s_6{h\n\YVH)k*I4 gOWސlR uʳ6ld4Dy37.0W&:6-eÝj𜮫F<p'WI:{zۿ*aVČa ĎfSvKծLJ8N39EAE\+QTpR$>G͜@aQ:we*efx8/>i:RAZ?5EM%"d EB<#]>1 S%hבr#2"^:'u#z',CViuh@Y=2DǗDNݕ_%ài}"JKf܆bQon&93\w9&S5*?!̸3z =-I}_{̥~!F[0/{hD Ѕ(&g[5:,Gyxע:QFA潇!%m#[a߰~nQGGg;q: f'(7MVЙLaci_טfcevoh)-9v e5_K3˖H oٝoB.f2bO{&o`4c9-'GTmvZ x|YqkR~sնr\cFdBOv$2y'ܠ[F/9!hN @WVw[tP61N>l};]uw0Prw`x+xJhCkc#@+55,@Vg^lFV7iU%f6z'uy$#C"I"=1Ǐ~u ?!2/Üz[#h i!>R`Po(?lAZ`mK$g%tfSoRs`b D^ 7{!T6j[Clmf]~io""⽈oj%o9 W?6橥@ӌs1.]7wr ~@k [聢FV=+bތx-5@#`=%"\d6P=b"#{ x<-n9@\~l~R5{;KPifozߧݜ㳖'$o~Pj2lO`a1y+;F b3;9,vj-Ha%H #߮?0/vy/gݍm 3b0vu="cѽq+m ""1mmo"We81>ELW`@]j u5u{d_.ꀳ4.ODm$Zfs,;U+XpM'gc^Z#5cMxb@e.ۇs 햔yh!E &"*WR ,#ߦ#;7"MM[;|}B۷"8s3*\'){F yڛ%+a2Ûyk+iăVd1uѸ}2{U<ӌ_x{I^|.퓚hu"Ǘ0+֠EQ;`.4M:ezY]s`htVf0ЎX=6~.&z\ {v2DF1sP|]̹D{ӥUx[5/d=|Q 7+n |FGxDLN-L*N-(+X\Zk|*t#Qw1c}}GF70 icjxtX} Λ %ϱ6XNaU\W*"mqba݉LX? %Y޶уa/==yW(1 kڠסѧ_6s-oJ5]bXf >Ьh*ؗ6 zQŤw5lv8vmCVоb#K5IdpL,zŪS1i iړhʠw9Px8Lp,`'{+[+X4e Gu1*(BnW8 i]m ,?)JM1@@X"4 EAS-ζ̝>̯ƔdOQf[3ˌqn{PM6 so V7OLpPg|""'ld4:l, âlBFo4;ܬjs  I~fz t=*h[`,<S6wuw]hg$KDW֋qפk"># egiװ~qwkG/+^h2[KV`+0a6; |t?Kkh yueQACa[1;g|Fj&Zb"[&7x6Nmp7PP˻OՖZ :T3N3Uc]K]ߏ Rc m9jUU8{mg@i| 2_7cAew LMx;T=&w1 Lŋ_D_v(h""'s9z:7\FQY[YUx5[]\ޢ u1oCa3Y`GBc.ge.|qP3*tdɤrzMwߤ$=㎒\}Z 8hB.~8hc(G] r\Yok&X9.TTS'a} VD8O36W˅m^$ CH HCO>Xm$Ci!abl_(d1敚?U,86:ȎQdytu7SpG‘AsNI|)y4k@};,ڞ9K Ll^1^3ea*׍1oYQs`e~ܗF5L ly'3tπmlw^n~NFf2in! 6w;\7 xhFt$:TZJS܆aq`2̉KxoǸ w)`űRZ['fyYtZ13S/>gmoga.b/H[fMzw#kxa0(Cƌu37,JZuQj9v`s-*k|ijznO!,mxCHnS<<~'d&uA@ $.ׂ)492`^4@/|h a90rDq6y uD,LV#tɜV&xjK+=$hӕe[P3p.+|Zl[2?]9nZ`Z)5> Uv5SǥkwjEhYU3xlӮ>#DWy!rHF /$\`#tml\,Kّ)/{5w4'CvMfj0e_;e^%cfllY ~+m˻YFNU!#Un53t()5!,2T6]e׶dF~6qCםR3WƬsf,ٞ3r2H㫈z/tCՃ"sԹ9zPhX9=-4ۛ[ekHB;w( ꦑK^LHRf.`"*.o47#r'uh]67=1|Rپiso^zJ[e םo@uޥDbMpCAݸopDz s" Y)s"S-`yc"Ŷq JE\|U =A ȟ/t8Xd1!6mɣJ9#;V-^j*oN:84UN.ǯDfҠ. ԆE gg7+KoЙ{"^~5mծۧH}i|c &$3m3۷X'1 W>M; >Hf{,³QO`4 СƋ&U2P(YA*"b=󶻛 126z-W@vxqk;5Wнzhȁ:yvd1=Z/gج6x,0*1mpɺDyf SzT2ԞVo'ƺ7#4{K(|֚\& E|'9呄>-S,h8"y1-m'rb:A)?~R3mMk5y4^^HRnӰm6܄6#H(۹):(est\Ҋ:tph}|hwW==LJ$tmi=  !d"R* LoոP#֞>\[ns04wz;_$!H"ڮi$Ǎ(*cq$;-SGm.n JDˣ]:yV_pY"Ux K&(`M V:㖻v['3@W&lY6%|×Oƶ3Cyyn Ξ2s"u]bYm )]DWR̥aXjÍnL-YåH@.dJYv2B UsM J{A/j` Q*eRtUeq{e]k98J5 yo0Mx ld;IrlAjaJ$xU屭|* ?{W4y/Mv''՛W^ut)#'Kh̚cqS<6E@{wyOT&ME/'?sE7>I!?s<<1v) _%Ɛ_O.Xj3K,3d 7m<2&rIP%zN|XahH CZ$bOp:y3GNmMesi Fji>,nI63'd+ƾiNbN]oǖTmvY;RTdCRVLAC2XoNNOJ*Tǁw4'"r =se}˭#A>SpH|b}*"4;fM6 hۜ Zl:-F)2x\b bt|’1JEH\ $‡>qEōSC^i2 \RDާDT_xĺ迅9_;UKٔa 5&7]" R(4wFٜx_uF"*4?1BDK7MC*z-+äM.h]{GV0cw3=(,*+}B~@<%Cw;j.ȈNӚ5)FD-{첕G@#3"pFXF)iRGx|9[gko;7׹( k5*!jS1oX1rh :xsonCt=!SF?[^>X )cg0怀X:;deԀD@q{_%ƛz>є|+XR>{j4H*Yu #*SSٞ wK_)"ÜDxlgjF<+7w2htg#EF=p`$G<J۠Zʉ,W6x2{'; ..-+]U=Q}Y|}O 79"!t7~PPGӧMAmؤ>|!x!rz;i9ծX=p3'LJIgVNw8H>8 ޭdOqBJI[ :*U?0۴F!@I`,UfЋ :ޓAGcVt^ 3\6etź3O{L \`E~W{͹%K Yb44"3R:(!uObj`h*tTZ)T / WU\mVYEH+F"O'Jjj[4t<6O%6xpônN}\k!pvA` =BwQJeP#VW[]J4HHP6i'`ܫ?Z+p7 v6\@$$- Yw惠4t[xˊ4&u깑C2.Hzg[뒟K?"U۰=Le#!p,%ύƙee9$O#| 'y7qt8Ro2չ9`rپ( &N(q _MHj'є li̫3*;'80gFM`qǙR?IW#W4-i:ީ\$F낇R~N[+]WB4eE9cq~V}Lwݥ3f̞/ .%' ؤɽyeyL^kƽP̤nJA+d/SVYqq0ц{/;6 Е~wfPA=x{ìW\ &ju W 'NhAjCOPdV-H='2cM!zҹs~}ZSy>/WgdMB'C γaByRrl^s"aBFCvbæ Ƶ4>mRmnyǨt'Bۨ>F[Akm!]fə4ޟ~"j!5T"I>]h7`:k-.[:<kCNBxGԩEd&Ň8yl<9F;wq\@|c<쑣BcEjBpI-p^u7nω&bIyυ?Wٶ<;0(>bJm—CߋشUÖ8b!{#0 AdE:u<߶Z5@8>;;zRc -I%\ժ"ns_m.Ḥ!ֿ^^'hkHո豚5dQ\6+X&v1a,b.e@zNߦ[+ð~γ^yU6 j"b I/ٰ s5K0gU9Xg9>2$!ƋFpmllp5mrDn{;m |ζ ǭR+TRodI+*, ˠYZnϚyAǛ2YuQ&E5K`EFP` 4գhN;U`/UhY"jD4bRV(W%muˎL0apYblVx\Le\n=b2QB!'(ͺB8iPhA"'ͨw?q4MMm&}:X[?ƻfk5Uɰ^P嗨`h֦QEZ7H-fOŃAr]V %繕B ~Yͫ^z }*NFdl.U(KE4!.UT[=WuvqmlL,v;Y"_#f,Tw*AbIRv+iV۽me{ŰKE +kUQγ[I*joͶMxو!\GmmpEmŶ==Ⱥc gݮr FH2Z9~,YWOZcݧlXaBY]l0]B SBu#>28{D ޿65T@vàެ;g<9̝""@FGVESx{#θsjj]eM%d*'pߐOg<Qxʈ/@ɩ(􏰧@\(tϩjPLkI4g7YK#ʝr`3[3;6Nj _i\ǘs#ߔjo9W[pԈH: 2;ܪ^^mQy«X|Q1"^L;fҥmsIRBL`GP`q.#&Ǹ׭-=:;^ό g0-u0dÄ=#GFғ ڔ~n%arvT21zLi~Ӑ2ּ7;kc)uz6#ӌ]hS/XsoxTᬏRSYޱC}  0g 1~U,u}]7[9QK,},[4pj!;cpm|ݤP s{LqWK?Ue89@b;~CY-$86k4pHOss1 Z/5T᪑K;]w^r.HFM6y70ouT&a$ t<߀xB@ˣǯo.y{dd-amN\ag|MYNHhFޱc@Ovz_9n`Šތznr9l)/ 5"1PwIIQݛ(ڎ1-ux h{O4@Xz5ɔ`e@=ʳ\poqtHDfԃD[8g޴+ +49 Akإ'@ ET[j<6H˂@$+hmrfpsGFyFCطD{ ,LJYxv \ EC9.Fm8ǨRtoD̔*iP6 Q@ع80SXAA$ں6аAXe pH r%FE]giC^d);HgGBZJe翳BDhZz\40#X#rb=% QꕳɀlFD! U$4 I%0B4֢ɋ5,Uo2 2! 6B@JފB1,Hw粀BAsHI>\5L(@途k|nX#0 MduQYɚ5$$X`!(@Va6,6EV(Yb,0$iCHHE^Zv @IHTrEH@4V]4LHEgv!VA(p XM lH)bI;} M$^ZXC@[bH I hXK*lR+ @\& Tƒ m*5BUU5X\VJ1ș[*&/:zDJL JH!+LV wLBG`0Wj'LIDj%LB1'48z\H)0@شI7^RВs!$ק|sI,}4z_'`o6JMn-&M!XQRIm#_.!$"HG ,YK R4[i`J@TāiLB^{ /mG*t{GDِi&xYgY|P[ [I[=F&盥|¼Yh*47fL3!Iΰ2)eۦ>,#d.Rd Iq/f˘$ W:K԰$Zi°B!?XJܯ{^3żӜ )ZЁ!an9$]ST=Z?\="Æg#~͗ XH$:nLyTBhr~\ZW4Ol6qyn+ Ha@UݾE5!CW b:]u 3vSS̾ bX3" 59+[R:(Zݲ=KT^2&ǿ@h⥩T?HaӲBks;壷E]zz+,: D&7RЄPd1#!-&TZ[mUm]6֣UkŪھ] @F{^N}I 4O%Q`61 k][ka ʻ70,VBB@jM[k4z6MS4]= w(-)trC!2S+0 KI^=K0hXKعPkc.7kxٮQ)ƝB1.I $XDLuE$d93n<[,WCX!,坋y@$=I؂7*^h&/;Ozmu؀B_뷤e mS`*J/Wޤ50JE!mwWzVIFƢ6+r75+m |{߲oɭ|P1!f1DL1 1oy7ko}-KsVmYw~\Wi8. Trjr[jۼ$q3B:LD=L,I $u- C V4&AU2 }׾9Ul('iV:}@H p4ǵ*Z)6*Wk7CFidNiP2fA&^D:?FDӆ5C+1 BKܰ3gk[!sb iI)f>-\-B+5lZ*T9HA0"L FҨ$ܨŐWո@$a${ؙknj diA!A'tZ(Gaƾ2^ &EȑؿY؋,4 Ya&%&HEA8J&K%߅%n=&6w Jdo{h\qym%, %<aιx|ߍo0H2~Rl<>M}bh"JeLIC6Rf25%DEmF5l3j5$/d,9FxM6Nc Dd&dFƈ$#?!zFL׻\_4^VX1^Ut`h ҫ^U_3 0B6P[^C,\0ʤ B1̈JUFTRm67:b{+{2ئXX4QbvTVv A`2[50|l.oN"Jdlk&f&31 d"4B5_m-yz%l4֪hPjJgv^{Boډ: * ڔc@kIE ;̇U pIPe2B؊6 0^q+kB` $ qgei_mo#1h#F!)1cDb)6ɶ tG`fmda|{|oLfEyn6)4ZH0$X+cFlmqFCXnd0+k" asCbKZ3JlWt6d@$.S{x,scAwn| 3MN%ײMh t׿]srLQPڅ 4 P5_pKɚ^oiW](k87ZM6n/km5K۪Q^7E#lliՑB\&>1;,Rӽk= &hلF%E&&=Uk'Ӏ؛@ tSF$mNA~vq&q"/rxjДkjH6P[lMhWu~ZMqÍ36gҵ2bQ6,cX6WQ 2Ȍ6ЯSimb,chmM@jHigZh#t@k%]%9օkkLl6PWdqЮS!o j K3k4P{g[}{"3l\!/h&s<'FAiXlxx ⾵/^"U_d"IK:$cFޮjJXͤj+QmFQlcIhMQTQb*J^sNv[=~&o 0ZlFn` F-Gf&hx6h@p6K'T4D4؉h\9 3J,jKm6R_ t܅eI$`䶒*s׀%[S8̯h/t;d.w/޻C bJݦ飯X`‰tz]] :DLB̓Tf, 6ƛLiRYb+y z #gtYRn2aBѭbE1`$˒@7'KqO2 nU UjYP,x.X@$.!y >%"wym{سN Q$6꽞bM&$HOoW}_:@HGџջߺ, {S.I6(Yoi̸3Fç#r.e`@cIbMʼ泮ç])Qce{b3PIλJ} %#4  R&U4@r j}UߴUkmmo& _A ?łB?r@d6*,I!PĒ,&PЖ(.~ϫ\bާ7M&mI1 6wU4I]Cis US Baz!i6aFbƊ,ԱKbآ䡂B BZH$#mڵ#kj]5o- Ӱ A G|i#/B(kSGhKxIH+4$WE-$!hoט4Fٿȭ,->!֒(~ID*IĎ<ߙAާm㇋ƞsԻk-_VU^iZ$M(b5a/@(`!l>K^Y+0H4X$iM_#I;fWSj2HH6A#bAЄ$Uk^V mmoKkxkF5L4cRRl%*đCVZmZ)PVm^e WmznkV6ŵ#a] $2Ў$Hb g_Q=e]P1XHK|I 4m$ B<6b!&#PI#x!ƕzm%5mFUjn|EqV~{LEI@~ƽBB=G-5v~`!!h[6H@m{5-my2 6 GbIwM a u" n2 Ef 6-QnL oߓOZI @00At0ʆ"MqZ3\-˙}^h^餄Ybhz&,F>KܳeXhI%hX$y5Z[Zj5oڵFV2֫ڛeGvc0eCC L>wlBF @8-Ł-BBlQ@3~АuxZ&k{ Vff䐌ZI\"!iY  -iXn|@C@WS_]1 GZaI(si!k\Xo⯮^-o$Rm  ׈1"$ؒ_@I6%3 a挃a_{ݧtzs.*z:3e zTHm c@1&chihe׷S2-1!c@E` tAӴ>q Z%JShraĒ>P4dP 6"$5hK3ۍg[4v #iJ >s t  dÊCI  H#R @ ZbY56,D4_D V_A]iZCI0jش%>+,+ۄBbTe@MjJYVmkxΉ IbD-ZSi%z΄6kFzl%v~wXޅP2$âp>wˠqttްEU*I`^h ." [B1+'y M^;櫻pm~Y l[_hG#X[ra1J-Wm}ž(iiY4#kݢFSW&hs#f–w5J9)صCM@L'wIj֠BE 4[llHzZCBXJ5`. BlA6F,+$M+JhV;A8f1eY sVLi$ M7xΤb^jmsB$Ќ[j>& /W}VmV6a`vlYڰ5f|6[`v*1jJeMb#KckY\i-{&ԘUZj֋}USAl`gI2: b'?IaXRLja tQ[펯Y"'S.wWĤpm/7L%;"x)62e~Po\'=u`þt}*v=\4O1b |􆯫p<VXZ4:h3e`ۑ 띾ˆqѬd1fwɴۧ=V 2A:EGg$g|Qƕ@>Ý侟?Lh6ٱFY+6Ƣ1;<;'p Ʃ(u^YWDbu4NBnm׿b|1(`/*Qaj9+q,ú#܆C!?i, o"_Vh>4;k MA]e~)|!V yJzCv;Uvz1 WHi*``mN] X(C}A9ΥuJ\1h7^^<އ{Q8A|tk rB@+JUX@^&41B#ZR>ie?qcښx??}\ y#PR oPhb1Xƛ5o`Ɍ쁉. P'DK{N>>+cӾ2 x"ބO_j=.F>~C&Qg!"H\K3>Gy9t?LC$ZC!8)$x VH}c1t¼CCG*D*KKW;i.V66Kr*D& znR4L׳}y{1L޵y䄨l:wnhr>ɖ7:[ (`(w~0`ARʾeC-1D^5/U/8.h}4sNMI54?|։G=SyҴas[Kb!G}aZC'nugm}q1aRF0(gr􈵷oqcyqiGUld}̎cr{={ s^1Qc&UEE@M4b]'J~o5?ㇰ»,B9 cnxwH›~ЈIϑ4鲯׻E X`sq4 x[[zJ\*nGi"$=#9tnsg>jpq%?`r}/'R>EANԣy  .q*+9{]hS:2%t ~J #usŪÃ{2WȄ >  ن9y4sJ?M iM~%)0 {PyQQk%uu?|gYaChP t\zK,mvee"m+( WbrSRi}c[UVzTE?*J& #zGwl RJW}G7沮 6tjbwSoa獛3=O^-ml0lUYh 5a"!\ rkCe6\Pt7#t DȈyy 쯟BoL#A0B{d}5c3}m୫U醱.xҝ/N@r):/}}HnCF҄m bC}t5Pz.?kgVm& ؛QZŬk3m{u-+M(iH(%i/7Wq[޿&|b PakY H˨1(HA a{H JH,BGfH5 WS+}EA2s`~G\'ծkZPPN$zqІ\2݁ctϢhv50jP?Cusw<>( :S3縝ⰇfL2ٹ2xF­Ҹ+Deꐩn; ]  FgBfI'0ٵWeStrua/-G2潸Jy鷸=Ɗv,\]lq@Vp*Aѓ)-Ozp0{xl6ȃ6`Q@;ؾ{sي^uh2%ܙ?ֈ#PY8^%yS}F(FoRxTbPG|α7>hgkG؛tFnNOrRjbPBI=N]C&3}Ugǰ{ 5zͻ-I9xp\10"vmZ_ś'bÅ٨ciRh;[YxT752˱{uXכ[,9;[aԯί"d)^͓ngmp%>Fh +u.+Q+Ag0!B+uȂ͔)aػ9PG)*_M 1z*PnRŕ]?C݃ z n`2f^kaL/H1d#pD9_׃$ޕ vWJL1ra9(t OxE붸{qW-;%]Fetlx=lW_u[TNMpy7&0:"X^.#%pG}-YK.=ďoX`cǞqw`íH\U"07A\PU! 'ܶjtBBxwŖnx; [̀B5sSA&f-I;*a -' lȶFyQ .w5F{M赉@xq߷sLJi iwbU,0^Wܒ '1k_BpcppCޒX^҉L!ӷF!Eö#SVI5q]vRܮrsfɓnrm276VP]>*AN)k6zm˱8QM Ȗ(XNeJgB2"ӒNjA^[:UuY,H )dm>v7c\j~z̓-+$|ktIze޺cO E2_69ZC}Av,Ih,~ ;6QLH4 -ƶix+?NVd4>ҭy6UN3/b6ʍ:v]cov#N olej7%{# O!.c 0{C&Un ey$MQW­N c_;,5IDmQ!&76B^,z 4lWP & )Wzωݔu􇪙]?Ic}?!GgfPxh.wt}@ 00> $B(^Ùr"/!_?XB*I*eKQf'\_$sQČ-MhON'ٍm ȓaNU0f]%zM+U!hh7WȾV"ůO/a;/a4-ZBH& / `X;^>r}bI,o[sv]C6Y$6jZa%YоؙGJk(Xev>R I/u$#z 4KQ 5q&q`HltA/n&floJa!aac7IJVQ$-~1o{t? %P|שkdm-m]J]sM .Rp!P65QTYҸU\Th۸b^ A b<~^Ś,3pX!gU"m\FŻZVګiLb 2p[Y3k0 - >=Dv*$( LKa&IhB\E,i$,A4w߰?Cb'ԭWRUykm#?X}7m 1;K@!yb&qk{.n0Z9\nk{WonQHhSi$V!E oFU{*־ko:Eoꮚ/JZmW vV0^En?c_R]5j-U2AKbGa Xm$Y/:{?$Xe5Q hIId=frl $ K6L1%a'Љ^ +HZL'f+$M4Lh}"l_1?+Kwp !Ĵk? Ev~zomwf$\~9ws|Jw%wr?]G<Զ~PﴱM'+(6y5Wpo|o?wrYX]`ܩ[C{#btv^_f}45"AP H HI_J֍:5Țժ5*Gr.&EKst)9*j y2.,4DP=(GWKC/d6~5uL[&b5?zxG(4rsNjhxY>aO+zxiҏ̯;_!ƞ_%]y|wR=zy5JINmEz 56rØ'ef _gRwY^[hlbOB sɈ7.d,[&4%UշmW>XߦVF$b$ 95 [^@$ M48{ZSi//?50 A _U Mb4&H$!F`1BI%CmkVC:nO9 ci,v؀ 0 3 $4$%[J~LRi /{ kb(fHsЉ[%` Cژ:ʼO yGtdhڗ3ynO9rS dڟ7V}l"Q, bR<㏀)wVRUH(yQAX: ~gp_leRѴ֙(̏+1'~,!: }\Lr*#*0J:PRX-ke@ɐ K\muQH~a6fG rB,Lde!gvj$,z$Bi/]^aTfz~bBXThg`CU4=t1"/y̩!.0JBBQi$6.Gl~7bo lPpd46@陲)`dlmi#1 R`i-dv|~C^3of@%hbbU4X M_ 6#a6b#贄KoexrB̔${dK^W?=Wkz߬@oqMT3LƤFb"ctjL#R?P] ;wHHveĒB,<׊v#G=Iakp_YE'{vE͜]Qzy|V% Q|*3{b=u~`TeZVנ)ˣJ䨞8eL_#ozJZ$C6) cwV k8@:E[x$7OjN4B%"=u%Gh]~y7пNd6o67c m/QS6P1<(bXLOux^իOnCGfVJ{Pۃqg)5y$3k6l!~WO'=яx*nH._riɕ {R[Kw q}ނe~%18 ;'9?-P4?!H'gdɿ/bţ=6KO?Hב&׻erd0]_QÎ,tֵ7R:Y $~ZyD΄a(f%2R̔Mk>ե ә Q/z)6jo&iB ,āa=CH yf}0 ,9Uw;&ڛ>Fa4ZOI>SKR;f%CYɍ{BдZi>{vrz@-&sxd4oKҀ).u5ap; 綵Fz֓p-=/_H<4;jڹ+=ĉaY8+wzi=c<@z 3U\TF"$iG64$+Z?h6 1q1d@qFB&MIm BF3QvuWiVyZmhPyymk1 6wЌϹͿ;[p?n$o|!A JI GhI.ɇtbH1t[WwEt'mY g]j},Ȅ1/}YoBNʎmzjUGƊ*Xy8DmZmzV7' te w GN#b tD0H #q>]1;S^[-dⵎ̶%1I~vhdS,힆A.%kxې~ c`Q#YI${jYL߱]}L1[q6y]'g5-)CE?b1rlghjڀgju7]nN /\G̊BD_Xv &*|:oi$yu)3L=wtgo_g<$6A6afH:,L̶I*eςB8p&]-t;۬Cc~5nDSW|?!:{Z*ZešZq)ۯӨMЉWgy+9QRdl͠!Ū ' 7M6Ѳػr GζVCcf*IQSQ'5AJ KIUSe?\埁Ҕ:`)!&烽ãvؚ@v1KÄKe 6Cq@t-34wj`|4;k3H `%4 sಝV_wfl5n#AzU juq5l8#̮0Lr⍃eTbqd'q CT 2BB}X:m#p 79#f2 ۵ nJN95%G ʤͭ+d eHA[&ʐΑڬw.J[}\4 7VwD,9)ldt @U c꼩,_b0R^QoӇԕ߯],v}E8,sTKJ!$a?UʓV0"e(^~dN}?ͪs W.}у'ߜ/8jAF4G CIVwK'W>?Ɵv80_%Q+]~wN Kٵ;Vg%BYy%'?ѹv}0#/H.,)dHR?-&/ASI n2!-U7-=D y/ĠBwݤ0SZ ZM+>tiJdu9(a$4Q>wq$0hсtfF6Ggv[/ʡBK0Y#;ąs H! yiCgw@.3֬DT&ᐭ%v?ϹU:5u8oHe"덨RH.2mAWbSv缢+$`lIޥXA)"uG(uLⶮصI13$ЀkX .~A+RuiRM\cKqvfٵ˯ۋb60EbϧeML|JRn `3 ʫ w2C l`9/ކHJI,x'QTd/B]R>AH9ӯ- g/WM㊥ =fitt1ͣMD1B!8 k֕!Ś>*A-.ZEx%ͳE)`xc wx ;o>+ &q5Da`.L$5{wp9ɭ_]s.9yպ|4IwHD0$-WﰬH5s(f Wv:c,;:8غv(gxОon{/{?U@d(u}^;Fv9mE}?[ugM zJXr$)LB~$z~$iu/KzR Y Z@tўe\caYa1ޮSfB0E&I1 S 5<B:&} &u/G (6 ? + U͡1lbw]ךɡ_v,BHgVl؄`(L1mW|ܻ_ww-L?zs;v!sZhĒ>YK@fH oD a^Wx:@,F1iw/]\kzb޽&7B# sBLNRt܍pu ͌^~bXzFu@&+|VWkZmkVͤ@6[H= `|>A_&BdGL4 "Z?*HLlZ غ/pnu?3 2 X@0A&h1yj!!#Z!v_|ܷ_>gle;'n}7L@Ff D##Y %|awk" Rc>ÿ7D1m d;2 r>nBHܾI %H?:~MFC7Aе^دy<.squn-In@1cqCRuaD-km{kzM?^+B15x|6v\͑~Lq}˻8# c'4Ghh)ky0Vo$.|pGCV&IfrѰ@\i,uϲkmn×b̓UĹpfXQo^[lԿaj=h `Zh y%'֛,Vr')#(@EtGRqz;ߤsϜ! T^X`MZ=Xʾa:7m.v:-l.g=I\q:>FGS@B QA Cd-xloj+5F',5fԘ1ù"nۖ@`.޳7*oIb1"[#8 S$>ݢqI"BRi'H" ?F;^HB9~e\3Hjн0 .iNޭI@aɡ$ԍ;uFメ}sN;|/~^ee=Kb!#~bHh~~#}{7kb켴H|D$lm4GG%Ǥfx P`~T9|%™I1!b@.dahy.ϦYҰ]I ^1 ZSg4_a?[ *2H`$À8Ƅb6$&z7'?$)|HE`oNz`R1TZa 2[[{7ZZJH4+]Tmװ{Fzm)ji gvg"Z2tGp* k{z}7o{e[}PC`!w \.r5:;Af~ @66jqZ f1! ؃ļ~_GGqI}-(ٸȅ|˫ CHany/":p2vxi(# w9hd~e˧wn+~ % YjsI 9 ?B.VF鐻IݧF?g:u-K6ɛlZzhKg_;NdH`Po_a4C&_:1' xMU_ve~?|r2} PrLoT]_FGXEҷZ.#L4CRd$v]ؓzKvYsӿ"#QZ:؅ӯ'Ivl,? }K@ dXs1?)o q&/э%eϵzʋ-n%NGy&8>7x9ܻۀݐ$M r=gCAY ֱ>KҐƝkjl%`ɏ۝ա ?d~NWxZf?ʙlbV@".n$ئ~;E|h\#f+Y?㒀]w@%kX Of5G#-5Jb}]4aSx7Rfe0eD8YYLHay{"5s"\ C;R,?,HԑK3S bZ]" 8$i}4-;1rz'|iYu>/rqV?mQ$1K06b,z~ Kլ~}B t -2*t:=\ˮd 4@FqV`(HDAʟ1"z߫" m66 r1!TqiХ!}RB+wy45W,  &@}~J8m %$z$M8=I|~XE;cN7w0ibY_wti=[H c VKHr\ \6 X}+h勵F&(8-8}=dqcԲ`v[57-}Uզ~qͤSfBE >[obo +;+w<_sMr|̾ǢmcԾ7gX.,iCHs{"`vHEH9y )@4 %!Q,Elٍm9Iˠ0/Ж I @Jff5FO뜘 WU#ڿ]tFק`)~؁6Y֜^;^Rb/.KⵦbGh>zlאXbҰ/V'~s*z8yqO T7|W [cD aS#EM'ٱAɻxHZPXLE.ESZb,2lTih&ˬ>R`Zq`ʬ7a:|nxX\[Ξ-*,e!cRpˣT8Q@`-C"! WWw:I𤛈%-2ѫB[6Y]m|?t|`|}~ Y􎜬*7~[ SZ.KY(DNF?XKn/?/裱sL )W\{EiRr2"A 9^pKoM?@,.ru`dtWU}|p&;4Y=A/V|իF F TgWXc}lBV¦讅|K+ʻ#pesS 43(MJ9EpHxBgB1?d{ǂ.=Tˏl,X 0TnKUIEC>yNmm+1'SGb6 aMQ*~28A҆ BĘMӴ:rؔEg'}ۡbѪM!RDd hEs,b@$/@ H".Zz` 6J0B$$ UELKL4NTXALXd8,xJer 3MGJLY3ʡ/v`/oa e- 0ǹni"7;ݥ`G^tsi Ŏy*2,H IlVtܾ_* 97{1VQ|\rtKN 4aN xM:(8zXAY6 BQM#m/p~=kh 2!עAx]659D֟%QJGYNL bŇ}%_uoLq%:~ ?L(;}&<(#{.2Δ|o:|h7eZ|G _L-ѿegךT32_Cɝ<|?pXs㕺3+Z7zMۣ v&+/i,2Vh~Zii,U1kZ˦@z(֏O{Ò1Nݵ.N܎׹LtWV jS`cmRaAA;nR Jp*}k.@c:O@]Q- *N SHtDF(pl䚬ywY3ىC{e}Ιpbp`Ou$O`{(u c( C!ݗڞshpKɌSZ},+ɊW]'8O->`F~Ə? X$j\H(4]kҼyy̛܍t$%r gp )3@, n n뭮\m\gD%d@g !yIn]]7mwqQ+b.UAÝ\E;I2T)A`!ԛK}s4ۧEu8]v[d] #WQu+⎥)ق J$9I3$SDE7&rT30IDA,d0q[t..p]Muz(YH0EQ>$&`T4ġ̇A l2qF\H5\\oYӧ4UqN9zsbn;]%Ӝst㮷#\qJs(t]sqˮWM]]Kb<:ǧ× J""AL8hST&vNu۝kc1<ZoUۭr[rDJwR%$ᠲ8p{u7m5ETո\#c&n .djHkV%$ Ϗ!oE|[8{{-=S]w,1h1'hc5 TZK<֘ԚOs!Ii&ЏolW:X˄y Z20L,a56 ]f&m!"R݆B1:S8mLo_Xxtv/9y6Omߥ}cm|Z.q@k\®1 (PC{I(W`1V`lHP6ؕ4ȓtaNE@D!SSEMP5&M8+@`B! `]P$BKl<~[U]l.LZD!"(DosǗ&(K<9or99+ǮtۥjK)6UiWY[y;]J-yd%p$LH,vӗȤD9 AF ̘5!]bW^׀s]|%%s"4n.^^t'+mnҕIlj6M4;|)÷F"km7((eЍ]㔟tªm?F嶱 h ,+?K3ޝYʗԉWtWvF~yAqUMe/Avgl0<$K:úEx=k%1gSl=^4~wrkIhKqcKѿ ;;ζE? dzԚ+i#%y\QU PQDCɊsf PE Ֆ*RP `YLFo餅ܴ&_y_Zۥї&x#^]BٴT$xEr X,l`(i Gim6]9JN+it(Kgd+ 9H/Z@ZyN6ޗ["Az,:lVBJ^񓘆XJLBSH^.,r?;?SoA48^RP4*@S(38GKqj,+#aS4?sJФ ֯y\k1-n#q5=+Wj;\& } ue5+xn>pI)sc;ׁS#QkJIzl;fvy -}lroclԨ,p`L=ĂY< @^DkON3:|'Tyאth]cgOG6 9~O7̇05]Շ'A~s)s! JCL.@Icr9肖rͿ&QtY$q[:s#sʔfUtJ?<˷&RG~7P(c5t)쯭^+ɐ# BM >J7Mf-"Vi%;K bv̍x'yI[UZf GAi>Mx/ ,ʙ5HzRQC%8:w{42DPmK9&D"2q}\Lg<2ƒbosdJCB{g'=+%X=Ɍ iI.κSneuH(w#Nm[Ж9yVQ.@b#<@BD8 9˖3GϾ`X]E7NMsG,3#]w5Κ 4斛]fLJRJgoqZ#XHԒ38eh9#(gs|ŽI(BeB -V٤S~ \iC]4C\nOٱ%i5a 1` x <? 5vH5BҧC S6ZVw4mNgܱc :aiI ~q+XgLs"}+LyVJ)>|tMsZ&%}G28"ٹt!Z ~}pgyo+lNlګ;y3ˈ”{]v"z&r8FA"!&םv?0mRO8iGaAyM" [dd)&GD|.ö|: 󒺽V 9R%"M>"ya&ͪO%bp}F9gqJ#u|kiXftZEv!@}{2dw0x/5n%8ax~q%W-b*"M12=o?'0\NwSw.mik.7xg)}q3] 2!Dd._xkh٤Y- A0݀ `r!< Gb@lmy57Ɍ Ak01X@ cbH h5wq|Ьye=fZ?Ϛ.ƿ?u^WΔ~<\t1Vy=g_A.H ˣLnO3էIJR"dN&HP _m=Mmg !?Q0ߝj?%Uڄt}R9ʙ Pc,xU쿾/SMu\Ց 齝&q{ Z%[F /BHG3wmʹT<@s z G 9g|jz|ąB︓D4$cHGM@FCB@fCI s^sM|oO7R=\u/X T&6h%i%x#mӨPjغ*(ݜc4/m}ݭ#A^ʣj=4F3 t-ts@Sƭ ʭ`Xv Irr@Ԟ dq<ťrVzb'SR4NG9bлdtIg .Ą D(ʢ15%*+lեdΪչtA{Z,CPOckP[<ӥ$xJ|Ck i@pC4^5I-HЀzGKo_mQ&Zp, j]Wmb-mO{J? G4 "F(*MhcI==s*sa!6TѸhFm2~mPhH sdA,(YgGƍVk$:C$w_ϖa@#u^l`-Dod_%z _}U{XQu|m3$9v, vr"mZ>ʧmLc~TKϠ #6N`oC;u+783ߖyNaٴ7sZv/sa3fsSfŞՅ Kb5v%ci%^iyY^HEOĢF#P+~a䐁fں&T̤AtY$ r:9_*Nf4{)p2c 3'`[a:CƇq/y؇ꮓʥIFrmjX=lߎՈQnc!6Lͥ%yJXkTTZKؠH$/BOQ:vt1I:)4 »vh uHyշ-x<\fnޯ۷[pjodDG p4"Tx6=wf\1J]DuՄ$jEb18P<^*C7_uy&-?ɽVr4r5d$)%uqUT rtsͻ 10æZN)^P?~۴OJ^y U]y YCspS4r ǔNzmRd6g{?w]-Rˑ7atqhd%W S32u%~ L!]ljRVsJ괥IXDqe=% S !,Ne~!v'\>jal[93Gzօ8B;~FsCƷpm ID E^PjaSLv aCʪWВ=3 ^_"XV`]0mh;A%i }^BH-5#E6`BMB  ݤmB䩀3BU={B7=`6M\CY갸4/igpw-ٲHkm :$)y6ɊTsr<^k̟Y2رcΝr%ߠ1zm0ԚL楏'@smmKx\+U$Y\y. "e+wL7 gO<˧Ѫ+t*v{?1Y bGW!&[VQM5|U1 _m bޕlp;ޒaM/-W,2ч7+m}WWit7hp!fu_r9pB]u_,~MhGsI|k@s;= ԕXӨ.^d{֝:) xEeӟ2Կ 7ܴ7S`H`[nڇnLBnקu'#-CȟIad'1h4=0ۻF vvuwcySѡ6qcp[}iq|e{=i>48crlrX{ ˱dr-=wG/n(ƤƤ&9Lq! ]5<vM$2yL3Ūңߌ;y!ή .?$CM;]_/sw1 >zkߙd-’5L3DCK”Ͼ݌ab?SI8?5iz4^?3Ь})/+>ZBL&= P% $`/Z昗r u]`K [C9ׇ c:!| a{^wNP`˴1z4;G}U-!@N{UF 7JrR`&ImAEݸ TPǠSqR-Nb n֟="k  ;Q#mڿrUD0Y Bak7Ay^xo(y/YU74xwU$ؐmDtpӛN#ʍK۹V*>)G7/j(9Ȥ4Q!*;QQO%ZOoq{BⴍM#!ڳi w zogjϟϏa-.@j(g KƁ KBs"I2 pƄ+RABp㘏bDFwޫE([C&v59BW8/F:_>g://2s -A +PE?~\OM}+āN<vA#͗,[Zxhn猰\rlj1~?(n7S.Bg- (QOrB7EŻ"50zWF'JPB 7m>K`$!N`@u4"?&E8DRGO!_ Tp0\Ɩ5LR]ѻoV佫3°W#1#vc Ƚw)@O}|OyQ17dאd,k6~{ǥƩ+n1V^RM!?pJZ)/m߬f| {ngb\UXv6"Ŭ`8@h%)žAc'bПEd[&e 9 J v/ӠTYJ/(lbJ }r)l2 dإжI.mdԦ^p­Cqur)׊ &N5LPDz>SF;Gjӟv34lޥ?읹sت$ 6Pr M~ֹZ(V&il[H i#DHPk{Y_-/>ŗ>FEศn%ɰu̻Gu(W;McU2>akx)^3\3!@B%Jq# !8j-%us22xwE"fAwJ,5ECScjN(1\DWl'7DfG uxK9OJ'Wq ,pxu+ d)#X1SpuqrZS$ܹ8s)0Ő"#cFwbkFt& 59VAbCIcϓ|ǽ9rBJ7ʢ G2fb@;V5 ETcn{`ې,}uC78HBʡVR3SHd fWfGZ7>r@.FCXY ʹO%X ޭ "zakǞysY}eKiznjQ-9+SLuJi: M+lT{ߖZ1¶عF05rsN\PӅ+}1< ǩ g2s;M]M/En&#Iin۰^V%d3YPhh]XBLiY*0ev5ߥ}#>l11 ]GBA }FJ Dԝ}8.ș!pԖޯ;j<\M)5<1J | ES&]+~p q֡JfVv MEncQ`WucF*Ml$!mfDj328ձMh>b-FӔUŅWQ!|^no}AξE9T̯Khz -In4kZ:ku\8c&dɐKjYaօaNVd֥//K@'(?{ӭlX#y1p)7sbB{j3W"!7AK%Ej<)ڽ9vݒg.53ܑSN**,g=:1[dbkypm!19+vtHBZQ%c~7KOHƬY ,\3SƾaiE5m@O: 97}?b#PbtݎZDRsMՑu#g5 -Vu9y@\ ݔ'%YbNJlF~WQgiqKeD8cE~RZXۖYoY= XKPfo,Gq8-umd0!rQO9\OEO6^q`A qoP){z <[h-$8$ OS_>0&x 4D;D)D_Pnaa8C%\Oyeʝt]&Z3.f24.Zr,~)/u;hxT(GQutB&J+2/`] x'FOd+ -jˌXo3xܽ&H]rXn'yUH:'ʪ8}{Ujj.Z_~-#| nŸ@RgHicYj;CB#Ovdh+Cs-IO^RBZ)ղ.ꆏ[;;<_HZ#1F>bZ2D]џNthub0~g@}-#$In?`.^L ^y_[IP>A/e1XF"e'i> S>T\̎f䐌&}".0. !<&~MR_z200\V4n4, }ާ;6=*auSyEoQQo᳑ZY`DU%HFDsbm(q_!w}y?R~8o!h;ܥ0{ {T.ίXl5ocBbQ-"X^%D8N$y^ ۊK9*{_J5^o*n!:ʉA#iK#pg[ mvly6 i! qw1jhtHvy&=Qu[9R!A4Ą%Ev@~I^5}"2,!n1 ((f.@|2Cy摼`xܨ$a,>Aʳa.޼˦c<0r"b~-.xA*Z'*֛gW3mrE.e+5*8Gh“" G`gB]5EM&̆/͍%35{Y)$S$-L#*X~8kpg16U{̎k^3*&m[W[WPiٟ- H:6t!eVG1hLV؆LoL4j\NVdvm~D-=:>ƛm)jdH9w,t-Zb%I8,6 "i l۬a٩6ibV{tn m*nu˦bL[>ek-xlz_iy*L?&x2+[NcY9gQ{ݽޣwUX ?'e(K~VJ$L7О^_NniIRI=~8 iQ褅8~ʊ-HDĴjk/Pll=$sPЖXfߙvfvmvU9NO~vv)ѡ^*M{d+ϋ&uy+b[_W{}d][wC%> ~K0f&?%$3EqY^ `NGxhĔQ,EP7:Haj:yVY۟m#wxD}|W}R+Sm9FN}vX #4[͌]Hm3-iqĕ%MGUhόb` Z$ƨa:F1Ŀkoq4(`~R {#y߶?*K?o+Hޱw]Oҽ_d{ c (}b=k JGT[ΌG+[utw'/Z/yV[޶)#X֧s= FlcEZxϙ٫7qŽݑnEVkdibכ-"NVz2IlCzenge(hPPGehjF:sgfW֟UWoݢ[TG{R:> g|;ɳ>fV~wG?GBYa`; Ǭd6tv׵!:if+ GF𫚳3ćn(Xzm#g|^8q?$sݝ~&X|Vҷut0׻{݈+x&55+`X19 E9E|wVYZ8.;}^lA]}^GSysan 6uJK>rhڗS.uV~^>"bE1F󮔘x̖_}dv5ѠYv7P.$cRsMSTFR͕#_(M(mJK-OEQJSZ5)&^2L봒R&pNuIeS08/1t[ sqz\> *?4 $ uM2cNW₈$>B8GThOCS6e=cK;bLpqLt/526G lwT e)z_RJ!u!'!}gRU=ZL4ş}ޟs8\dyL'E^ )clR(_YLGC040̏c};?ѫB<6_#;/Lw75G܉&]gyndn)ρ,f/{֫|u/q9XQ>;.LG{uQv?nut#WT'o )^Ȓj(}Ϩフ}uOB谷BYCA\5.Isg{H#%gk=gc-W-q'kF ;K};1jey#)[@z[ K刨WTg,B G0_2~[j<OջЄ<.cxoxqz9e\x"Ea,W? ZR>ISNnK=- k_jnd<<61_l~Tпe#f˴<uA>JZ&_mP陨5|W>D;ޒ<A*MÁrϱr:,_dwnt9sJT{ K\ rJGCGykuч> Ff=2W_0a{V!(GKT1*@!F{>zWEl @1cЬ|)D!x fjvwnwRbi938;gY[}[ mfX;2m;.Ohi: ylN]^/GO9s$m _u ',=36Ytf;*FUea3yY疌1ݔj;5|dcd9ƹRsh|JxoQZQ#̔5Z.j/g S ( aaΔQBw x+p|}$D6 #wzb%-M *Gm@6 ucEw0RBUhp[| }ip `-%aFKԌUr]CBä-`INkRGa6l0c#-ڭ%?0npTJMq}\ugP{}LYDe]Kw83F>WyFؠ|g+VC2uqYTl:YQ?cZI -I<{õ3_kB=BgOޠ0F9Ⱦ8+!6l8n (⿯B7E :V46 fP1s)}\YH9Ϸ/ZSh]IK=X}` 4B07Φgˋu(%噶H'",? uz?]Iåԫ/ y/_Cil *9HdpOY*x! Y{_"XvP;Ԗ`lC9˞H x<~zݯwγ/NœW%q'ޡ>F9f릖YXc6WЧ 7k 1 8k\^Br>A΋\c߼Km.NiX@|s p ?)IR$/?m֭wO ?}b5Bqkl&Noa Wvgr} Bۿ='Ešj341rQ#)ɓ)GY'&6%]dw&ÂndZrXGQd׵reJW'r{{H7Qah`Khc1Xf ! _3x#4*ؼS{M-acf$r>m mLDt☈i !餩r/24" ٮlaVEZ*,?ʈ"NRD #xK_\-ط#>k/;\Os ú-?AfjTCg9Fz3㚥9/au`"~ KW]-C i˼搆Y]W&^ℝl_Vw\Eڣjt=ܙrɓn=m{<5J! ufgڴѬz{tCL6̻%st.AXv*/?7YFޥM WVXpV]r@N=nDY?80zZwmdjY>mbAr.@ `q4HWi} SHp*l\Y@$Ba\S|r)ޮͶ M%d wio˟q摑/* 䎱yR@(Ճ55,lRXN.wwdRXv}8tی?-;cbݛ+K+15< z#`,e!B5F;pF&J҄$2dyɅͲh`{R!QkڬDf+T2p GKJ T1Pڿs]5`o}W;qs[&AAw@TH;UxtYՍH(02)yU‘pNM/WSmuh.Z%A0 #"eBHsRkVsqq+")鋈#U-kмl^ WqoȜ`WH^*'$hpkMK~001 >Z]!SeHkX:/XEmZbiՕ!Y0h[/reCZ|72 0Z Dݒd11qDf5pH"2%/G;oEvf=Ǩ %rI[rճNP63SHv͜"Y9"|Ⱥk% PqTPy5Jq[>2zk>֭oMfH**T`'Ȋ Ғ%*+0>"I#yֳs8~EK?OcsnbO3KZW/7%xUvF)O'}*F: -C~ /6MleiYS|oth7DZ:%^9}ƞ?vYz .S{ rf4!VEwRσ6)c.%P^_'gTy<&7o9x@q~id,rp"NxpRWDqBz g6rʞĞ&5mt3^8{Mֹk]-SL.jX8=,ch)D?=wHDZ \,lsb`@b 523;&jju1=aJ_S ֈڶ֥rZm"זl[to㛑Y4<ʛ":qZ:Ʊ 2I8\Dw=AsW!T{8O,#2ց,H! l*Jv|̹1ns[d*ʊrE\Zk `P%U'K=ػ.&C]cfEwU]!yJZUg%BTp}o]<4Gz\=*ϕA_zBhH\Vw@m("ܧ3xIJ0[E&V& ]Ͼ`b9/Hý)׋&VqQPEIo)ÀX>=!r^Z(mǁ=Ѝ}_PBlԩgMx34u\S`rȂa=F)VuZ2"M$3X #hs5u.ڸht2GGk4 o_ҖѨW|?x@vpF1+$4btlhz9+/]GxԓMѸ@deMq"Q91+zB P3EXȣ;!r"oP+S| [~+9?yԙx ԑ<d_| '?k*O@^Z5(UdpbDa[MqGn%4<9HHv}HBJ:x6 l1Z{vѤhдڰsnj3cEWE!,֤C8vP٬ Hl$;&B"P_N(vlͤ 8wmL\B)3.hn_y8& jA _.H,\Ֆ|v0:aaD vOc<@Ϡ;LuЃKӯڽ!ح!*vyS: >uژ2< n4pARx +Z1^j7T0Zj(8v&>__Fpda~:KߣO*(f೏8 8^Dϩasmx1ٞ2NJqXg@pRX¤±l_S9[*g֫?|cm $kxsW_~3θe넵j+lVNIc9y~4Vr6d}|j dF3AR5?4ބ6ٶtBAwyJd&7] zpD*{~וB]' !%|klmj=\`}э\9@MscQ8rѧ7!Üs7zua1‹Is}u yqMX ;<"Ii:V.<&砅\Oj}C?F|,'׹ZMO}H (HALQ!2f+ti=ѴLsl3Ka=v-#1LL{ O]@CZV pbHa&*t~믿2_~35#Zr<>g&S7y/ɔ߄J~*ɼ-,!]HgLM%ө:_pq;4qvr#e2"ɣ4w˩{ߜ5nf0x߅^ 3+劇j,"Ewc"f ka+6T3!*:Qm Nͤ\70bI2A7LI`y2"':J~/h@jsH Ԃ*d^%emhlz?J{,^h;hM-ާ_F7Q<Ǽi~Ļ}<5dm~'FS6 )IS-!(q1Ў֦tz74Vfv7;ɵ'MR Uʭ^ ?R_B&Yrl?*Avr|8 {'w'4,l((0NI 8lW:]wU ?IK 7">ԈZkc z.1O#ja@ g'GៈUgˡOq;qE[/b$ 9HiWN` f{GpHIB)C[OYo1 ?"Vռ drT<6˺8}G<w ; .$cN̆r>A*YE5TK>?/"B>9Iè+}gN<4]HuWo欔б͖;u[by k 4r.} 8[ ~jv%곎X].1eW X00(Lz`oQrt@GQ s|^}+ B!7sz5!@\ t91qxd1ەL{ Mg i8Iȼoݗ`H%I I`k׿ZH2L\n2OExe=EX)Id'",5hUeONJpH CE*/&! 7.nAZS1MhW uIJmKI ^M|-(pqr\vv⬑puܮe&-dʃh3;8jjA3: #[ Kh6B2dT LRrgBKYS>KةY| ä4nm1?xx3*O4yWMf1ԌȜh\ 'n3D:&#'otBLiopݾ%[iڭĭ oEGwl *ҡx}-TH7Kf9RP)젶ӎAGVhT}ƊV݀gWZ|FPkHBit$ख+lbD 5 'm3˥d 5б F(Pq 4`\8dfYoQs`|4И}l p5)*5X"Xp!) tWZ9`CraOC) )t,TzO&, 6B? q>DNuG82$`kKZ (,9XԌ%ld<B}Du ]|w]_?/'YJ&i-~-+@x@ J,) F_VÜ{*a (W|D_Ww~b򤚐_S MbƮpY q[̟!8'q4<@ĠU;$ڮEʹHt<\\G@/FM* xuHP ɽnG?V+Tyw>kfpV:ɥ: k_]a2Trh$q[pϏehO9_ Xy,sW&BSN]ɴ-m jlZW .mhDqb&ءU09[ %R d4[#ex3vPMqa0LMn$_Yjlv%Y4c3ST1>S֩o}.42f.ٶ N[Pгm$c8xcSYFڏ BkӸK)>L~zr}@} %@܄ߕJ&eԧm<\H.IzGsDmWr 4!%q֐o23"T>3qcn{ji~ 4>L~1m8^m7J^&1\R]L#JLGuc`J-wcQMn˒$]LH& L tQR 5 m; Dmօ跹 yfҴf)O"e*e-hH8qQ-LsJzXʮbR 6B8B-nJFE3eHp8+$R:ǯ&JS#-vQzuxӀ0tHRAOHSe5d ү`i:!e<ʴN+ƍ,-|xAt@(ukpz,ﳃ{OJыmHhN4{®ՠ ']i3D!|?UKDH~ p|sqEٴ W%%I a]&>rH7&;)J8xL9i8U"\gсafU ^{߯L0ia }ڭ7PJ)v ^E+-)&с6ܳ4  ~Mf _%K"ִSL S6KɻUq.^GC@`C/d(4c~ap@L^5G㣲nvNiX=A\\\/7dadZ@zvcgPzx3i\7]9,]Rcy9R]pS䣐d9]c.}X -YС۳ŨPœ"u&2.S\[PmEtM) 3ۚQ/D]"VRRN)G,AL[_0FXb(a_|Rr H AjsGoTR`Go2t*p*ODb E@zVqi))$]]/[׬ Es6JsQĠ0pi J07jyi櫫û5Lv e,Bb2qk(̈S~ihJa<]PJ8E-ġ^-d}ú`~a4  Uw)a|V Jj-rzh}?GNƞME4Ⱍ̦pܐy.ذ!NpvtqJuG` kP1>MT\:"f]_M!Vb\ccrm,DR$ ?"p<~;'vo# q&.v[sKxSTo䝒*N 5kMʗ<.uR2+|G^QmR&&Ah m`{b1?9j35² Hg=@ʬ8Y5XGc\\^RV".t/n ʡA~VQ/7S+hZ6@X:a oWH"qEj罅Oo >ЙmcfV;D#/s.+GP]@~bʕ'@Ysy \pf_HXcom8 搒wfؾ 6kd(|R k.$/[y~h>2 ږeI H7vjSyOth[V69~F*H+3fZqia\c.=P1㓜•&^52'ElvpHb ̈U…9rN 7>j' X̷'1@!{g^ې6ZG,eAk||f-J `ص C˾ƲF4;ӊs|E!Dilyt[8 woGQ($Y@%Gh φXbh%(AffZsdΰ3Ì,k+ z\Tk[ȏWqZ2(d KUWg0%z]ǒ, WwNC~˙EbT?qsrhҰIVsx(64{ JmQGnoâ`BbК5y3@%_ަI6Sj!lbji}?UT4:D"Gftpx/ -q[4+ZPG!́` ytp/3/.A՜(ЋgE A"TP[D]@-ǬiPx*(~Ӆj|UnR)2ptqt L]!@T6nkӉPqO~*ӼNB rHtoa',ȔL;$|}oEA:^m}]էV}uO(W *e7mstc K5L -v4Z#u\ :_׊3QbaS|kˀkmfbkV?&sI ?L'Pmo D6W1f;GE٦#`l7q[]ʣsY?.H)=UCB*aK\kZ[U99wJXwCo8ۜaM66&t .n1Pc.+`uᤪ7[eH+Ew /._G?QdO&OնtYЎ]!jpcEPs#f].@+_q;#S/utguIɰK~O-q/9`F^s=PV́{bOdXl2@vstB RWxO( B4-lTb}VF^<t0fΙdF&leO%ƏrHp*P^]x]&2ؒ |yz7* ǭӱF\zvF'% Hf`,΅lm mf4ӠI+Įc>7Ec+.}!($?b=i15KdI.LƗ0r:1͵kr&WvThsak. dzoN(ьD. 9I!X"xdՅ !gXe8Gg/=؛u U*.dF$cQr@z=e9.m߈oN@$.?ГOOhjoN0(n/oD `7ʼ&t+HE[`& ldG%WEN6AOt܆Z6 4 sfH,2`\qy~ Lz`<ğfjNkꆃ= YgD$0&āN'DA *+;Іq~ a7z٩tz^ mg-?''U#RJ#7:X.&_/BKp Ǎ_У,S>NҚ= Y}gB~}6^`-81k jZe 8m, dHD{aP"z K<-wXAH%3hv?\ްplyOYw-Q ED̦zcP۟Kt]H# M_: 9:gZ=,~7(WTa;'ŹBLF7d-̌p``*5z&bb}zAJ(@k须i4{ŗ[azq|ޮ(;jhwܯZ5-~x N&5\nT/A5f@Ց? ѯ@gf,:S/! r[ᘩNb)¿jq]J0 @Ρ>rwIܬ׮ƞ:~뽚'қ Ȍ#G,IqDߪ~lؤ?I5P^uI躏GŻ d) 1% :5'fMH3ø)\4 p>IR۱G7rr~DMU䲹7W-zPX%.;&{$\ANU ]0(5=/ħ~IrgT,|cZqed]O8ȅk2ZBWyJpJq!BBa; RywVDJ͋ <Aat뀅)զ&ys #hʳ8:GsM%O[KeR}A-轷uQY4Ë'I#'P̈-6@ ސ~}?a\n\3)C`ɑЪ;w$C1kɹhpH LK9y"6T'qԩI׉gt̀W"r$G;)+j cCW}`pI=lVJ-u_D.uQ `S2QZI֠%M^])8t#.֥cwgvғ0AM=ZUw|5H-_y%z{YzEI3ẻW(CuJB;\a^R !r0FPH%~˛~guśc88Iw;3҃rx,Y 9T?іQ?FV&:w3W|Oٞ]1[UKhw4rdq!B;}lDZu,PF͘ TEO=5L[68imyib e߮ohTn۔ڇUDA6~q3#nL#Ryձ,gS%J֟R׼EAs[Ō=O+ZbʝqAS+e>ʕ:X+/a:8 nĊ%JIKN,gX4^F=?K2}4sM$`wކ^#[>s+|jF9-/ibӣ :bGB*lut8r ӢUc7_Vi8뫕eaq$hgq^փdSe@c''2(gtZjt5o]H9ٵNryݠ4%.e|S!:[PO9>yǙ1@ Walf,V嘅zp2ͫmKL@XYeZhoM^pa-ŁEbaf,%uAs߬^Q08Ҍ:ZUj1K~dPRKt tp/}I, %7 {T*H:Ac^C¢)G $f”={.,ӣe!>~7 ]-MVӨꤗ&fd Du>'ֱr@Zxq#3?,+Aa7[jGt`6 {2k_#8ː92X{S\W8ǿ)ES$:5 <Ve!ΤUN/؈Z! _2 69kܪρQ_&^ 5Wj j̓N] c^w_xC ZzCj'e‘w_e'] IȞ,jڵ.(]&0ótMgJjӋT%ffD䓝K| MWT2A}>(Y_8}c$ =NJލD 8|"@/M1O-^7#3}}vUU ȕcR02MӀ4h=!@ @ƴ*_} 66|)ꅆZq MmqO$CӞ`ˍ)%N9rm#?6$7nX !y QO+6kX]m6l`th/ Ѩᮜw*IQ9^ڛk{(ęUŶ Cw_C¼<elv cu񚽖/Y넠(?BSn1>ƈ@YP_ʎEo&9ecgDvk?++¦8$+^m:Er&LeԷ]pddtʻ{jj3B/M[]ANGX %UY)?!2aC DЌ\KDF><ZO*0N_ka^ 3DrE WIrѓwhA+I:y1\h046yԅV6:8 KKgKMj%':9ouhPs}B: G*=Di5GC~ y:?m^ dOƘ/9 k0,K5uX ?e9:z!{x/XelƏ%–"L]@Ĵy}t$fqO&CKݽL+x調F'yXθc.bd]+spP>jL"9b{A\ZejK2fBEbR.o%sʃSB+?ɼ $.@߰;i+'y)9|hD l~ìw8ozM4r{#WYcd)[SuD6k? 8W-TsaC3 z%מ+mz,l֊;ɤXr ȩ:گfc ,Diٵsʝ C%gN64bݰo0U)IoG# P T3֧, ]WrЏZe7b."YpT,TWqﰹۤzcX)XS+׽ƀmΫٰOV#'Y1NE'[ ⢤4ʨf;]u8j2F0 N]x&8)(2̺ SHc 1S wv-~{{clQY6%3]Cj ~B o.x) 4{t$m]j"z5޴ṩu|_ x=2pH+ׯ9t?.!&\uOhk3+ ֬^ 67d*GbЪ,;qRbZU1WBҌ0yԔxE[1ޗr:y3YG(N-SUyE[!<}AKH"QTKNrpoQUj\%cfiPW/D~3T>gW7JR$bE^A\}%oiJ0U!2OFd+&9/ɖ_ղ=5IY7ߝnt*(dʐd(tqBL&hz>_Ґ KHhrA;msG3\>_MP%)RMaB)>/01zLsC@6rq/= SpV(Ȗoٿv8>#!=T݀nE,i%TCHIkk.31mqXw4`?e1Ϟlfلo  %X/參r$~QvDL1!-^4gC'<) Yiϟx.N h";(sTū!JA k0`Dr3B\uFO~&s8 ^F,)ykx[:GzAJc(&V||>dj?5pQ|轞+.a܋QEhg/wբ"PAa]y ;Wp𬫪ďevzr01&MDYzQEmr|ݿcBpjYf -f7`ǀ Yu\~O<#f$W/<]:$H,Sm `>\a75 L5exf~;Rs"Y%'R?vpƱ%C*=d:P blձ%AoӢ@/R% [_Rm&nwT=LNQ#7> * `<|$Z"&nI2$,G Zܸk=_; XNoZr'9=Cӿq!랄v´E${ՠUuT*1w0 x*j/OuɲSP 7+m-N'9(yV\aDOSLqj܊̢ۉ/]W5<:?=xuJpط<&-/+ll6[٣i"$+@ȭ;AB qd Hҁ_ݟ.]v;)p2u*^dӅ==U)[V> 5{YEGYVbϴ9.2 2 XRCݓQeG[/4ΎG4n!(۰jAAf*#~%Oܯ[mE/E[PؖR?lʹkكbUG]82@a|s;z޶VЇjj ].>JǸdU ;A)U`?t\>؛H1k-UvY+ &EK|PM;;ΌEp,bBf$#*JV$('C9+S((-B*mP:`]4nIk^=s@4ev)e~9Z#cu&z[ 639JS÷jۿ]oi&݌%xܥ 1?0|-V^Oص]1Ořy +dmCYB6Y'|]zE[C-} SVgS襤7c*Buxnr+TOz yRlht5A =²y)1j~um^5k薞Q`d(v7q`8YcVDΆ A yYDoE+0EqF7* zNA-mcA=#c%XdTDCID3(OP9/aDrhdTqj =u.! 7h/Mk$:x)2;i@`^+;c *[*JGN&x4bE;[7הw}DEHfTEjbp~_`_}= h^]@#\7ꐞtNV4uBޡ.ۋn[B荧OZ ir4EWIp-@*8wN%'{R!AFtٲ[7ev$`Vx!7vv7$dDx_%hk4S*](qGRC9QmkqIi飲'ę-wvғ6p5]Cw# QsJ|}LCW&u0Ul}ø*/ PF7%r 9]_#1%gaC{C mT{~ &ռt:];KҩmP@O ?Y^L{``n`ΓA`}*{,hpD?pA8DMQUVF= + ׏Lt LTA bRDC[`Z=U_!}>ogSd<8:G_苤ɦā)BO2\ ^'n;KEI =Bb:/p" ! XH"Z߉hz\oB A,dȢٛf=pRYfVI2L6Z=)0H kJbJ^W*{(b@<.`sfdvE[A?ێ3&6: f͵ފS[3 +"H?u w~9!@pǺ5[U'B90< E0 ŗ[e՚YU%%f*2~i +O' 96cz!/ fig /ISwHiDvWqH>$gp!U@)Qq([J7x".SD xj26kfZs?_ *4 !O\4VFXDE<<N@2(t)/U\ݵLx3kٶZn&'x/YL#5gP"ZڝS'3S;p T #akO\Y;h"]+3Q`M!Lh)@=Tv M 3ϷΗN𠌣dθm۪1W=:#xe׌3L[3O iJzq1}o|e v㵎Q/u8CxTVq73-yBf#<>B'DDuO'jq6f \KX*wF ~= 3E[Ќ"o;0NXRҋ@5}7@J,CTSp]0i[ !ʓ,<$k%=<]x%BWmUMPedBuCfxML1%} 7c )d,)o2(k*J'e.mx%#$|dO8%dۖzɾuL|n#XPoƪ',HCp;v} RZ m Xɾ~b{HA=7U[Q).UzӖ_9: q-c?uՂy~P QКF1fۢxN#ɺNd%[ AA}ϻv}հU5 q+Ĝ:O߱x(sS~{t`:Ohd%o񰩮GT j8ďeb"Bn_(50 m IBῚ`8ףh,|BnLgT@&fw" {NfF[I˃kū&j%y =j}E93Lq[Z=ʱ< 1{;udX19<,yV-}Š\=Mb4+Y;ǧh\(+F4%!oCe6BZwE'I v/Gi'9 dVFA]N0Xwˣ`3uR2+pey'V;Chv y|<^H"0_1u}}:PM sKl-Vs3j %{ 9QȨ< fڱ4Y:o1T\lo-93:gAY14 *7N9H _dG ԛ "R#~s@TʨŎ1fT~\Mv8ֺBi0\|g~'#Ȕ;O -z~'n@FҮ-}6ViҦ"?4XK~OqC6jf{# UdHa%[=3ŸdPVPL!l0˳r;N7/=ٳ/ KJi'sx(DNߐ6)8,map5o,k=))exq?L4z)蜏/]Ϊ3:[2^C (c=:m#LCFjh֧m[ylR/By~/E)ީz^ ܢ%.63v˫y?5wNU/l  wp9.e@M8[ X2,2۝%T[Xߡ8m6GF0-   Ň˃?Ö50xJރ[cȧEғkycxQ^*49h&,)]V?!+Έ.}&ae0D%‡FPd?d6>CuC,6_fؓ-syծ2ߙ&G'|^ vbsTW$r#I1,LӜY2=͖f2R異 \Q3Z~oXZYϬi4x(84i+S#Igt  ~?,^O/hgnĞ66jw[ nޜm{|Z[րVu=|H@Oh缷_ *mc1!w.X_eԸ"Y UǺnI`/R_Xs]]ˍ̗&\!PRen6jȤ6D6iaiQ y.ɻhu|'asUJ>^&F TǴx6$s~o nV2aE%cBPe.V- ņt:ᐰF~T:#޷V* fLFdEQ?9tu 8-C9֠JWӈ݋I}3c2rDwqCBN+К)+Zjk~uz/DGӠsc=Ěl+F-Mn!_ӝŅ֦H,Ќ/2>ePM{Xo<*@~9:Z$*F\$ &cY{XN1z|E 1˯R/g68ˤ>2uA` yc hbh~17h>"'L}\S 3s=*tˑ#:([AKͷ5wSM'%.}+XE0TR6)ÉvF.C~* xYV~}=]sMvYSU:O.p)xn,m%3ecwĭf٦sԡ#?t c/@Dxzs*5>NZ1rŌե5?4_Kc2Zm@4zD [Ry%i:tVNc@b`U4Oj(866$? 2t*Z9<@/Y]5$?c`Yؑc )t}a D^G$M"$k4r!@ o3ͽ;iʜzg|!m<[;)[Xqų@Q,bJ򺼕x Ƭn9O&q%x* i%fa}RTi}"}hZw|wX hȩ!_`8 fZj~.,Иk DF];r0\ HE) -yl5߳^\Nb\}`y/LxVo94g8MgqlM:6m˖ KP0"v8tjĘZQ,)OfɗO,48JZ;4 ܼ].˹qzޜWq2lϳȫHD+xw2@H # 8K?1ɯVXܢHO?fKN?!QCƓ Epcv(J4'Bƌ|@w먃{+ y*(ly{5@F[j/VX3,"u{6\%Y ytr^n$k<߶?j E9G򗏺2BA{T+#̫m k vKrvxiU2jB !.H\w[y/ǒeXB XP 铇;?DsQHPtjMQIk\1j8hq6g7}U=G&,V6R\WEZ8ћ> " vHtk8usI43ۧ#$t ֵ燘;aw?7+z= e J`FSf}geŹI(TZCZ2,,dOLnyXϝR<0ʲLϥ"O'uVA +ae/OJ{8딇遼SBzMFÓNU Rga}4)iNB(6y-&ofG7̹[ou߅\a.h։Q\Te$|9aL͋q4P\0hƂr!1C{UU0.>M6? b]dKbZ-?#QOuLܣŰN]Voy[|[ăR_ՔT/*BW ˇ@>K!Wu4h)ϯmF86h;_WAPC=QL$\2 #~ri0abGUܝt8™*w{e4 F&T+9(2K8K3Z_CKmlCREWƯio#=ף@GQ^$ `kwK٭. ҎνIgu!p~N\Ax:V,?isauCSȬ~-̢Рpt+,pZx&ɁZ\'-]4gz[0>,Z3[ 5pɳYE8M;S#%Rd&ePYaN+0SF/|+GI4N&8zo~^YO7S% j[fVlE ѻGmȂV\\ZKvZ|y 8@ViKGS&m aX.,KN(.(5nSHc<9\OK7X_k:C'^u^s`/%* FjӔ+Ng$LV"-qɃP`l&RV_b+&I3rO$_p7ަI)tj:d#||nǁ~xw?7Y P{feiwi hʫNl[Rhl"o2.V@t"oG3n=Ǜ>ư]4St%V-qV$%v}X}}w U>5|[ P/j6*VL!ǀJo IjxIüIB&\zA\lz[2SnȱOTCB咋-0(hn맛Q:- #˗qUҗ/B\TSwLq<*ȃ`nLdor[MF2mj;/@,&z'3GYg2}N}Vh {G bIa1#[,Jy4|5iOGw?S6x'%2XooLa?X L[j,Z8_I*xjYN zd{"Px51Ό2A6:wa.(ĂoW# |(Id==nbr t"%$ǁ~֗ e 3bZ<>6t\sN# 4n4b@4F^6^GXTUrۣ2콋p`!Hfq3 !eR#2;oiԝWvXhށ'#)bzV͎Aī'-F~V?:!P. 1xSrN7qupe!2yXՒw9|%W_LڰRH]1{PAzN~H`EPu?gR"G%$|q9FUl+MM4o=LiT7#^ ”.W12mr67y^њy_jSq>%$Y0 *e=@5F̪.J4YZSA)P1 5jwLcBjhiA4:sNYFv؆dRoJ? pk60* ΄amުU٠T>KWP,Fhm. S;#1Šrs`68#mc=X豴:flt7ϲBM4{; 1ѬfR|ҲMSnP3<Ƥ(@=#?=޴P{ڷ*;Oi?xҏ;߰29ȓSeY5}{THv@pwjNFоq;O`?gH6, -vM/;  7zioX`_#G^qj 7ȁ1$X Y{3.Vma˧*]_M%zDэVcK= ]xZ898_ޏrLGJxtHt!Ŋ" ,4`Vk bx.mԸ*(yhy~ߎ⤊'oG?26ȭZ`$$I>zM!o_e7Ѱ[z̻Eg7,Q .hpVd*Oʙ.wׯgbWy.^Ck[$e6 >x6M}ks5ҺQDG)nin;E.6,- x% M#R9\$~ӁU ?qe|֫I@ Z}[XarMRG6|@wHCC柄±,fIo#ڎ6̕Kt',kA2v=oq;pv.[3|sz!HKxzۺ6{k~nBy 9JjL 9X lZ3T"*2Q,a1TvfNjhިRF6IsA"is)qX])PfOa8QLUHYW /&w\"6=Xs^8|}KKyİ4F Y =] J.Eto8 W|Q^j1IsfsmfÍdY}ݬHW!&k >Y.*@f'bIjMQl#dX('f„NS&kd͒qmRtkS/$]Ŏ[\=fONsrU17 P~}ƻaO% xF-W,-a~"ޥ=SDScLQՕM= jvs]hZs!3l&qk܎~]+[6Su)ʩh«dXSHsQן@t)t[IJcOѵ#s(uRqd;zgMGozr٤Hwb84Qr:~>$&6N|GM|IL&}a%TXO-tO:.& }b*,=lɲ^(G&d)ϜZ}E ] &A4!?CG.o Lu-F*Ҡ"9Fj&xqdq U C3 Sz(_z] TO%I$#PG~a[if /%b;>xu5Ցfc_/ŧ|O+O0() ]9 Xy(]m(w1! Qos .ƅP(2'/+Uj E^R2G7Mi\5ڢ|Yť1=|-CiO_]f_ypjt2j#2vc~+as>17WyGT5ŵn*˃-vrI0(M?dd&~m]86.}fm|I{ UKxA,oKуg>}J̸Je:}Nʾg9LLϺv9t#I_wW{S9B1 !kD`=+(^+1:UjLNeQ//z_)B\jR8̧p/0 Ae³c1BA S A MYødJ#h:3_]ܔr#u_ VauZ/nR»8v~R;aDU6>zy:}{^/'U@ģ_Lk7VƭO-Y7 @Q雚.aA^SĚ\]mFr皈1(cTfT([ ;UsK)A <) ?՛y'G5#Qw{|%*u( 9[si0$4u5JRqڴ;BP0Lx!ڛ|j\IcQʲebs`pßrXM6LmCPWoa@ ϒ- x"AbPi[+rE[P'#wس _ʃh+, ZPƻ*qSn<>C.EsC4p=Ar06 $e%uX@)|GD7[7J; ̀=*0h/ZӸ~Va|xgbҚIUO>~l9U'=7=eɰ$sLOU]2; ~66:< *Oma4c.:eosj[a3Y6w05,\.)ِ( m,nHz@ ҧvaaX_|+nTъuNO>$SwUR['5B0жJ] ebuV݀Xf?HܤQI84@3;ғ+9P~ ,o+懴,@+7Q6cԜ2sug 8n< )Tظ/0י77P%up9@dyx٨g%}ۗY[7Gb1*/mzj?n)R?~;2tЅ9KnZ48/Qpn}~ö&T? 9pֲ/0G= P#&n_0z;b>GPG_쭈׮OPL`UxoiMUaF4/Yq6rOM7:bv ptkizK*˯W4KrQ/PG 0ϧrln˭hAv%otKAQEyFg_%gMHh^y˩bRu̖|R~:/Oa ӵOhf}lOxjZI=7fR HS0?li?3>l0n-يxywTD>ק*٫GjoZu_քx^mQB‰T3D,rkF'sKXfzUVSKO!vF]$hY M[ $Y" VhDNDQ y|^2֑7%BkŭO'"1 Wz50חPv q1)T ;.0!hL{Z*ط{#ARrb|/D/O:|-ꉗ`m%>?p&GM[ ڎT(VFDSlӬn|/ˀ<ļ g_A=s.v0@u-9 { rm+*.ȴTSJDݵ CqWkTDsބ@%Z~hb&F%xM}sTH*#lv# I+\;䤵,=S]\Rg|2?IN$( [ 0ע b?5 W.~̷'c/ uOJ6u^>Zql~\4@3ˑu!EyK݆^Q1(Oup A-8 *}d`zG W>{~E/&fEGoCl nbNű's7sz&JsGquD1lAג_ 30z~aH){3'<$^Ks~c`Dd* A?H.N q;-/v?D{6>q*kژf0Pl(¨>2u[|AQ܁rzV_ZK ;Z]nT]I6`,XzK8HM8An *|Om Qђ䅣i7:Jo4.Fݺ@?x:”V(᧋t$3B_@NrAbF(Q$ORu(r0@xvixc(CIITB->Hِ`k!O@Z"JO87D[,--[7/?r pQIu[=~Y2a8+9(,pHJ,N\ߡ"3!_ kw`(STY_4C!KȆ6rLˎSw 5JH*=6nphڐ)ma'f"D#:/?V Ik_H#OESImcg)9KYJM/PM%Dx:3fVs|@L  jv)S3^oq1w;Fh  #N15 W _oW(0ȇVtE"ZDGOu0 nЌlo@l8U|L*W0gnU8!KQ&BٮVsĮw_{ s+3Ym=T$.,tuďR:95@[ J)P^f9d %{R c&oeFa&I7+ w|V7?iΉj=ᑅd|M:i(uE+wf ЎC]?R* ,\~_oÑKI$ ʔY\e }vCL堄a'U3}욊 ˡO|KGIwWʴx KVP?c#差T_jr#z V)]<. mNmT8ҏu4єD> 4ZQ`$ C/3|%ϙaj,?rקI~rDn_qSw"Xsre!ҊZȭLxy'2lnm H /!.NYdzdҗsdpU$a{ۯ;ٜ ʕZg"MMR >2~gؑ{Np^#"{:6R* saSdZA;flO'|V1uɢ%jU"h뜟i>bBԾ1l؜XOHO;_,O[*i+j'6%XTJX"J>hH{ߠX|* wN"3#X[i-eX]j@#} 4P/$y:齙DM/jYk4=~!m j<{@GY+wewGbQ5.}q sc$0J \>>!hMKQ-g;ڶc P$6#iM{}NR9=~;Vn#^EK:Ѱ3)tGAiTW~f*p0@B§m_*čI1DüCjy*hd{ghB8'P+]Y,pvyq kVv27o'5c1z>|emKaf l?¬85.j!Pc5O|3:ܔ翺RmwQT[:uH~MD )O:9 2UFR%{Lv|G\Zfk~y=/nnu`G1Kb쎉G~|sqB;7yWqw(#,\E"cY|\47 V]BY;Q-$"14(Wف.ʢ~M hX*n,`tVzgL()tL$@}鱁H5tW|WN)[~)'5YϚ1=;2o5@Ě z|bMر~e{xZJAi]MU" ',%g$+,)rYK1 !ڗppx~O].v^diDۥGs%B•ٹ^۟5;Drpp͋3ҫ}V ϟVGh6GVg&\㮨]MR;T&H,Bsl<'&ʨDk#:_3Kݒ XIqZwFh7fJ׌F W`qQ _qm+*a9FaAC2AVѐ} BASw %JE4$?k$iT eA?TU R"z 5Krr_L8,oqG+̈́a.n{# kʮo7fUF,=H*HPHQDȦN~ؖZ?_pNtބ3* : Qb'VRsM㏔l6Ц{敚Y8MO4tR[j`J[dͮE#EX!D֝#%|&߷s3*@?t(8(CJN:D4k+ڤsFP}jvw8֦^7N+qaYcj# =HUY+kA}"'=pn'iKdP Q2  'FH!BAD})ɫ cPcJҋ#Ք*w7@$,<1ՌC_hS_i@pӾB} ET'bq1u@Bw̱>8bE|mV{i淘`׶qbxr%7!J%@2` h^*k^2GY$n"p%BYf T6S[C^ > ӲWhrGLr:}k,Us-|쉚ؘ4NemU)7;)fץ#JGFGӎ.VIŅ,UЁY $edgT5]bRI'{&eП.\J|[3km0jxDތ:%qlH{D4&"hr?%d<0\:2$aeU[GD4g* _`C+<},V]N)k2H ߉* ļzf:~vETkP\JҤr!oX͊|C<-ƾ zd:^GrlҢyop`SHsNRZ`;uporu/4>iT Rb:z U=dƛxKKe_ve)H=yxABZC`9W-?}#kBg3m(nG:TXK/Ի%(!x?x5GIE1 I;3u]c>hշ~H>c 8xx-eg8P lg~N}ȣPi?ޝٕ 5=̴$MjH8V2-n?~isuSg!(oDCZǺx `BX$'Pr5FF~%1 m,xHB.' /~ڑRo1oZZLa`e>i&\.جټebF:h„jƛt:ͯ.'*%Tb2K?G@~RhbTv3?:qdOq3x)*KT8DqJ xݻhA1[lgi/nSM gR #Њ Y$B>{fvDdid:׵/۩T :5)'Z[`ƔLD[3[z5h{" ͱ;*ٽX.: -{QT9G*̸/lx 0Uǘ)gךb GѴ AK䩼'B^R5!/ldƮ'7_:9+|lV |tbRP9NŹ5Bd\u^}O 6W&d#'0\cSҵF~Rxx$^C~BӝEUנ7,@rYD(]=MK( 9d5_?sSd4h5yޅ5 .CիHJ/E* ,ޝt^"MyF=4͞ƐGG7mPۥDLL%"togR>k?8?B,5{+gIg62u]2>ܫf#ІoۊsJ)}:/LI]iqJ7әH?~k5Wޔkm$dPeUgfOt'BZ^{}N{9{ K j42DMM\,5}lv8ԻD"tOdѓyTE= "v;G +p(LW9yWYwM-BO\U/%79Ԫ3ުLe=kG 9[9;B m5W<Ը| L6Լ?%oNFw_j*| : 4 i qk؍#ekU}_^LN'Ӱ~_ЉhTgdK$.\ %I, ]u& d~-h(E|'CEIa1Exu|#Ք6N菜1[|*h[04vޖ7 @wXdՓP-Vtx#tbNɢ"-ra6D^Ngga`h# &:jIzG ?OJ)r rFb7(aq5nƅ;3yFŝ݂{yJ=H%G*'C/]L ml2oajm9BU+ȣ<1=P^ d}PEXgg˲Vdt˞uֹ6b $ĭ 6Pb'I ; .(MIB)jB@#79 5qXL$Wd5qgd&ȝސӦv?Vtm panقv M^iS.Axv;Q|>nbş fS0=MZWxr wZzG*C" )OPfg&\q&hTT6Uj&@π"}4)K0>b),c=m_H`iOc \Q(+mQ0j2$|)v̒Ñ<ݹ؁nٶh/-x A|lPVETB"\ʂ'2l!)W$4Pa N'.({ ԫGЀ!r< ~5ř, hn"mg\ln纩^oSЖԇF.SVc7Z5ޕ9f=;E݄c]N@I=ֺ G2Bu^(XmֶqkN Gl*&#ME;-#n^Olm8j: fha4[e'P9=,vꉱrQGMT+Zk6zչhj$j؁fBam K '5{\8Z*ד^'yx}vGZH ])DU(YA(jyY#d)`FxI,wGBq0Ɵn};Q@$?Pe&onC om[6Fvښ9Tg84{_۱x3ΆE[LRYk ?1x4Mퟑk2m/7vQVqA\,i"VSC%u*Jc-6 ^Y'vs}\P obօ:Tw}!GN"NT]J]O$sQ+#%pv)z䒘+뢫_-’^Zobz:=D ,ǞeЭS5+?.05Bo,'6r&|ăNEdff sPf{#|^(7a#ΎI"1$@Ԉ7@O~-.j}XBزC ctw;2Z'eHt er=\ViGǼtz/$]{J#6f:٦/8Ρs7Kw辶' ު܇M惨 x IlndPj)1Ҳd{T?FY|3@~խ\Ւm:'+nh^&i1 `K$@X OJJ9𸪈0Z_ՙhf)Ƀn~7./BZ.ϑk82H^t| [2lGU 12Iz7j^s=*%PRw_e@ySn\RaAgބ=t70~&0>>IOUMmS;)jO]כ>U;U;9MOM 4qv/*cA OKy| <ش㍈XG)zM.͹:b,KJt))e$š!5/W6OtʃPOBsv)lkV |z`ZU%NHȂUEM#!i1E!|HN> ށʒYm P0C?*S.vWЏ_t((>" 3psT3)׷p'L5ZG#oo/.2's[+u\߲]}?sA`e7`;%]ۄj*f)i+Q7χM>mh%BIPsT PB7\1{)ua֤H(m3dDD:s {ߗ(C0z?]D9fA z5i%=7X$Q<ϐβ6YBI:?e{񘉇Of;wOt.٠.s$>$`P\5rEt$/p}3\:KEXO}`<9HH=ℽĻ_F6d9[qI#.9M3| -zEIk>.%3) ? WEgVSPAo[9~ tȴ<HQP1}=t5~`lZ FUဍhW.! t=FeOȅUZ7;Sn~;T?m;hј ǔ@Wk/J6T!)th N4֟r/J= hX@/8Fڕ`vGɷ~ި:BuM,gl8>l T9qM; i󜫌cŐ L樟Zc.ȿpNUȜ&t_Tj!s)%Hqޑ 07I.9֒;!X7fMcƖRKdWݒt9do[IHő!96~]J,X~&m -xk"٘uu*!$Sn F4PZ?nömN@ DWjV^+ =dHok\}I !j\meln!;/,AM:7[eMåF*L})FV(QdXnb%Kfrt}c㚺fVLm@<da.#d"~)+ޟm O;'}UUv]vFJ/3!ftw#k-M"(&d^%MUф$Ďth]>|f_Z*$}UKO$ -Mxr+M^v{4dnKl!('[TQ8QUcr` j@*dE߆V0ee$n-,:yAcߧp %k|%*UٟK38ےZVA(VgjSk{_F5cE>k}1g; h𛶜*U^/k"i9xf%s"#hH,W͂;JG5gG,G-?x-Z#IX&ecR&>-hehK+Ua(=}G'_(n}l=|=Ғ^1gF,eyE9~ȁW{cZVVC꜁ ܬsWVAga#fxWdoDK?K",31iƈe{ۨi/!7Hsֳ}+Ϲh݆R f`j'^`=ɸ 2OI͝.kTP\o[5m"3%=u 'w)B"1-C"ۨ8ƫG/̦]¥k_d2v,"v2#qERY8kZB =! DA3O1@OJa~B0 _GSV0YR_yT㋀rbWg (t^pGf- ` I,yg\:̔_JiWwRV!Hq8秎8S{k7UqHGVl9(" U /.J]짠驳;R@"Ξӭ]9C+ ;UO]{BI wN)۴,܍՘!AJ"`?16VRf M|U}9 \#Oxj~`:%P~NTg^z)]ҊY(3<&6Ι%FJ(4]w-96[ܫ=/f1"u;qӱ!Dss˅NjY*_K)bBlې0P_%;G`+'L$mB7My} hE \0]HıV_xg^;]>riXwȷe=:A?U,Gw>~IKUpQlc$3CbGȷ: +E;Dst53@1E=\.CFay+kaL?,< |#>T6ms9? ?8zU‡r2;c$xi!".4+WC3ј {ohE/`5h ϻiz(B`r:1ZbL`&HΟKSH,.?([Ǹߨ ٻJ%u{4L\D4Ӏ*̬C2=5KZ좚Gvԗ.0rwwoPtg>#ctdWa}㥡Eͳv"z-N#-1r8oaDF;xGEVr\-`e6R :*w9B[夊4[ ?s%ocA@ vTq@_7r&>1c+ΞϢ$ZkIͧ*#j *~h<>E,"x"'3C,[)4' ͘4j:d/&vIqE C+-=`fMr}Ჱ1Jg]aG,whFr-@9kE#Gv(Gst ;[9 gIAV!%@`e}I|B||ґBYsSś+Ia?%504nk}H/<K0g=<,r|V̰Ŷ'W)5R֮rf@ޕ(`Kɪ\\]۷ueJg4A@NvauD A7/F!.}(hգ4W' w8cSv)0TDby3ə9_^.XIӴ+Uՙ)ј:`*(UFfP5Yҗ/ȔоT?=a\^bv}uƂ`_l ͐xL`E[zg:P&wu-9dxb?0$akyna}Gp+ySv6ɢNñoKDsfL]f6(z.@LAy!g8>QRCs k;'5ң+q_s8|99=55`Du5}C6yAs@vulx#2P\M3J 7b|1aC6,q۞)w󧁉$P'0%IykHҨRv'Cc<]8\Ww/_UNgHU?ȦΑQ5,!#<;EOhݦ*^@jZy?Rْ_64w$^vau.GujKDi1H{ERVm!A=-^?"? ;[c?gnQrCEe>NQ5'̾$6`>Ǭ~#*[GXXדDxkO_.cĮrp6gwi΄Wm-35O1epl 1En9[!2jF%yۿTNkߛZ!&6Q*'G'Q#ɏM|"q PL?$}f43QzM}ڨfuI 4Vr7VTu% RPi;tqow1ir!Д]uzKE&8/&[4r2 9 녽4[M y{LfB[f z|OesuHFSSnqK HK> O [1>m Cwr ء2ZeJ)늦pb6H$OW)ų>6Gh ]=ORPե 0Uf6_ Y yٱ*6JzHOiE D^ 6@ضM/N ?@Š6Du{ObJ.RD2uٸ+DQ)ږwOwBHW<vvg'Ys^Uil84^*ę"?skD7OxǔfIoNl -rz׏ 4Xtv^~{k \mh 0:&L-#@̹??.wcݡi/#DmC@lz炝!US9 ):J96ӫ G9+y̘=S`l31hbKdL̥ZΝ!0VۙOW۹ȝ](XfxT(?|-m,+)&45Vk^~HUɗ*N 0#a}`܁-,@ RH;q ` ZOJYqdbF |iE/45aGJX ܩxoXfr]D?vZxI :HQvpx3"X9GGzXZL̐eOayٜ;0tia9`.toc~ݾ3axdڒz\z{8>MAC3Ul.cSx1bn?:FLCiAkDb|VTy>b0^uF2⼢2ڻO KϐY 2//xIei Vv?J3E2uG/ & !kqҘJp#<Ż3!뭨`ܔ/ y7 Ec0mHfeZԫ25 ލGC0Y~w\^HZ`]=uMj=)DcfWCr= s$*%PzE'T;eTtض&<- .2D]<޽͘ʹpp^f=^j5Psjh%cQζ}ZذLȯfMxIJmIU8乜8{#yb^O /O3n!lՁ;Opq3;),/AVUDs$ze6d55dRn_Phj4J@&nߘ- 9|D UqIg<OScV$OAP2rqE nO'1BNippq,^cOIσaDdZ=C6ѻ+q{KK%x#QٖY5g$c]n:jR( ur= N~A.)&zraztp:0;T0=u8"I`38[UU{rNo{Uw+uT7_vAv.(67O[is&q/誀Yӿ׍1/Lg /6鳅HIqmP={Zf1pqU'7{E>ZezJSS0m>hT6P٢swBrrEʁpZVCKUiUo 41ax. Y bfL0,Eƕ$M| WOnO˫q 1?WSFt~>y%}nxX oUV$qekuXb%RK%'.rjko+/]W@ ?fD,F%HH̴,`sΪop^Xpu6OݚOaG;Rdk5k`X8y]ZIB:.^ ӌO\$viSoX]P{5 A$׊-? )ioy Z? C>Z4EH tޏ3#W>ClͻoGb'[ć$q+ tij_OmZlAƀ^ԤdI[2s"u֓!OP?ϮTs6SΪC x!2sb=UW!,@)i낝uI^i~JoNf51T|R&|}bK mzYk{d{5(yiWB |VsVN ()^1Ř\]d= _ 5x<{]-LSfSUU/-Mj @ ne HE~_dM&ݥw*Õr >רp]|\T\d3"uOJR3TtHz*%;C>Nlf#̝M =-sBV/0tf"s%ͲxBor3YAC@h"މ$B=`W둋)4cL1E$س ţ}cQ[7 NTƩb!N}-UUAh@Zꨠnwoũzx?DzE75A_eςn2E|K{LށJ ru]A؆}k-b{L ;de,[N6O!PG툅~ۢ Qۙ1qJ9H#ɝt?%?pӺ?* ؾfk+cPBGyff&''ˊWfk>8x@(J̽ V)ttvm<9&#_XÕzz9yAP5de)T^=<3(GEsVJ#> 1 Lֺ,PA`ۡ3]aM&#IX߮qwt%qp4Pέ«æV D/XU%]~4!%(%ù0tm1z%|U.Cʈ&ĵ gӷr/u=kN}gc3_ e\0q{xt®d%]cͪlb>[^/|xuHܿ]}V6>g~sK0E}ŭa"iQ-5~I_=;K͘抐\A 'YO4;8H"F$ k] &uq 5TiX햶 Ki^t"ZЧ,T|@v'r Aq &IVoG*:xXDΌ)WnU5ňDux*.>#BQD->LC$ hF Iu$tlb~B2 2=)9!~$)o;fH/l*܁Ey -| 4գ+ŻB1vTz.ΉR̴`2+z;7Jo-ڱ!Kɠ䯋}SJe'jCDeAJƶ 9I̩_.mtUI,gbPd?ZgI\`)I) /#2( S!%L(a⻹ԡ'oےm-:6/D\dr>z <S;l0ܫs75sW1ٷ>ƯF^MuxUKlhDBkIu ..}W_h`7.gEu.qڜYE=h9]-Fq1%1ďe-7~s@iO;/y 2OYf`R+E:nx`UW NV̨rg[)LϹdvz;l]CHWv}Oy iFw"a$@vT2cԵPV )>i2/JsBY TSI~p5]}c=.M7[bңA 1 $eHb!oF^1; ^Kb3ے0"YN)8VKK uOP`ݫ2!_NFa.Rήb3p iWx@,325mx>Sz ܾRhdEI9E L:{P^хw$2A!gWbH0c :ڃ*1MYP"Žcktӡ*áSfOֱ7]}_ETe^㲮hjlqiM_ڻ{& fL1ui# exH|R$ %yb)3Y,WGw:}0ߴPG\Xi!}w@^A{0O/{;!&-ȾYXs5 ȇ ?mmbcÈFQZ"{]HLBzq0`[o"PgYџG51[.Ҏ~Y)q;!̵4Yc|{=#3 6Ut\ ==s>D^?kYD?74'c)h#LK](qJFB[܆*4&WKԫ;?)<]qQ-^]m v~E΍w |nF#xz ёPߧ rN!"Fi" c5|R SS[C%X&9cN aoa\n2!Z_ %eNZ\=^n5Fz!~.kX<:%X fIcKV= $ujK-'çܘ3s겖-F?a +fcNNAΈTQ ixIJG\ԗ]L/SF8Ij]kK.8oO ަkXe[-}5u:1}9:!]zB>l ?'bk)~'jZs&~Z/N{͞rXH9ܜ摙PVV^Ki}%R ir؛:@-v TM͸xx:50UoEOvgA>-~pAf@0*Փ&/Qx낙W@+"Q0K|'-Ϋm_qKRvޫIrvW& X"m3#5 (u<_+&PA>nuWbN:> Iie.L Snx\\ IR>LGzaWX줖rkZlT,P蘼q{o+3f{4P:#GNkɂ*mp9B@Zgզn'sR܈?$?qkCLhHAPpa7ll7z')Tcaӓa[a$rC\@jʙjh3:1y*|@:oKT簶k(K3'ҽș6C*W0{T?aHUPl߂}X ,6 Rg +ɉd :Vg)Z>N+a綠HnȨۂ~7r[GULC&E'k$Z.>qʠFRҲ)ݘ^7xY* 㣗e^ Ea- (G=b12ur(V, T Z< 87("20獵_9xA,@|YB,x8ݖC v_|Oe &!`1@!cn|ɵcl-IhxhD@+YAݾ%2;{ywZ0K HZ]80@r&DiEZXIs~dJzVk ps!8,9 2Mk"6. k_0T2L7Yq13fUpvz.td#dYSգ9OU@tB3҇-ؗ1X^-? &zo,pЭDu _YhiV+!ToΟY878Ĕ5Q F. "t3F'C-%lf/MNjU d@;\;́MCk ).wn]Qw2aB?", j6gVCKb9h%v ŏ`M_u(3*pp҄U-C@jkЯՄ(*=ڟ돫ZxZ4W5*JNͷC#Ġ-NLaL'&J 噙1.YgRg&/w @ u2j-eZClϟSTfsB Ć{k _f7_hUغO !&j)4+8&ڢTȀ-bУSYZGwIui-Ɋ V@cm=TasoG|aӀpm\ae$DpE`,͇K٪@.ۈ~˓ 'U1ŀpF7YD<'D ط)+UiLm/B+6!6I-N_8|MECtcn"RzxVvI`-U.@V5Sbgx鈄'\2CJU_9’Ew00Sx#*xO¹&reD1:P֊-_*ֆ:m*yN=F8A2s ߵ(7q{do,K~FU4NBM$qeů=->%},|l8t9ĈKeiڿ-PX7~wY<ENv3NG*ajC_sE_}'I:r̵}> 2.NA ^1U}R2g⧸#cx0 }!R@znjܝ'dO05s*)ln0,yj+`]Q: ˯=R$F&aqE!SيScEbRꬿ0NOICw2}8wnOȑ$?woZl`JJa-!m/7%P76OL U<a$\QBXf.Z̫<*H-3qЬTlw$=^ӣRWW9"+Ľ%w&rKOr88 -T=?Rl]Kek%AdNuc^lL<_'J%t+4 "]Ősy,Ml[IrԞxv, 0'[/,}|ObA Ի$ݒmLxsnkSwݤDB DS/;}?I!r!݌_r22LI,K/1FazaEX #l0_<c`bP7M滙F3u:ŭܓ5bPN\eƬF6sGna7f>:W1!1S-KW4kܻTi H`foΡeD]]y)`ejhm>U $x>Tj O%㶘Ȕ;_ӟMIr`WpN?)-0~ vIkbvv,V+,8%8`%ዲXٶ(OW1 ]o5GLN 9b,6 s| O_!"JpP?8~>Bv&9.eE%NG 36cE?nW QX=32&ؾn'EGR!|BoNd7|"(u X rF77nʚb2>532*2a @|:>H*$4mp_ީgL~(ԕRݣCl5_A7J`Ɵz5!G"(ً{ mL,s[u+^spy&#I} Θ )nm|RoB"Kg sJ t{~4@*o*/{ks%`=[uRq`=\U %*Q3[UXFm H+3e:sNc}&E+77NxGu[ .J? ~0vjm旛92&V><!CQĀn`3BPnjoJQfy&Jѿxd}7$Ja~!g(渄Smk_yJqb4oI]0-m!ߘ"@Aa[RYK+3=UxD(v'jeƇ bRfIW uR)+yB4tZjО:ٻDM9٢A|X!D5O DI6i~Xo a3*$i*YK#7u뚫3%m9ljk!fr@] u Ћ.s~@f䨌Uبw$ny/Ue&z |x#_(T(}r/U[BsU*u˄u& + ¶PްZԹ9l*>$&􀈻4^u鑷_j"v@D2:o)K4h#kS$Vه[I,&p 0a"uu!Vf>Abڪ&l>ƁiM:P}]kԴ>V)~a"W7H>AM;2l sn!;i9"|ZīP6"_#w#ɳVޘsW=>/3WF?]j5,b]$Z&qwFrS0FSչ v֝ei7Ȉ;RxDE5UNf|W-Oe06^~ kZو4 Ba/w-~jMyeyU8 Md4puL mYR{>;y7>LLcHը1]q# \ bĦPawZpTc|wrߣ&ʥԉhWgn$TGU^(ꁁ nb0Y]i\ia8B$?Bix҈ 7R6{)@G(2O$AlZ2F(r7{ :yrv g~DeʗNSHs%h!AVQ Ӏ[Ys* L5Y-/y,qb" OC^\Lbx&o썝v(*RGBE fn \T) мJ>ԧ26^ 47(bM71dN"(]= _M@.I.N->uՈ.Q〢rUޅ+u(WM;WV'pDr0[>ԡGɄ^%/F9a Ix"Aμȴ? ,QONE)pd촄1wWL7Ve4vٻM'!EF2hmuUm+|`V!pΓ K?q9"iNjׂ>+Y ќ^ٝmea\ԜyCQ(7g_Őty%yt7}[Xtx:1:ۣlbN12rhC*8(?F񧦈O;͵{c@JIU<̀h[ IkiSb&p^3m1Ň1PYzȶOV'k^teUh,Q"4zBcQhڣtxsD׶S8@ISqVE{/jXˇnH4UDoQS55ֺBdٮy-- hpm:.gS'6ߎh8tPn8r}}UATfQ諈!iܾdL*D=b(@|FH\a O1fY+\A%-Y"7o6S㣰C[>?G+V&Kum%B]A1!}' ssxvߖMep:P0G~fؼI@bxi Зq̱u]BDS:,Ej݆%) @w JuBLjyl(t';,f}… Zc/'J|3iFOnP=14USgN ^*8K/h) rɘ-E,Yx_5;8;X~^h~Y[v=s@tf |4cS}nNT`$ =.HG[a޽rLBU쭔QDSFڬ'ЏEҋf^ȞPkd'ד)f( qc NɌf]]REwT<`%)IT2" aj:{w}ċfq^d^|@#%$suHiO|Ҥgk_/<-t S Ǝ D[jy0=6!KLB׭R%yA${hϔEਝD|_T?+%s/mdS] @tcCYÎ!-bT*$rԣ8Ͳgt[iUx['|QN'NEe@>I·0\ Pxfșp6yn:* }mܔCV?&Q؈#kY8>rrtX-Cqw .}baKL{kE$V7ߞY1N)R&iywubv'SAv(VM5eDq k*B֛Ѹ:%*w=?כWc=La |`.<2Poľ9 ^?ZhKŁ*'Z%V ,ޚR~o[4ҏ<&u:Ab#ǩ;3ʠk;Pd[dY1ERmTaLaǣY u㶰0΃Ui뫋=!RZ8OK@帠^t%8o[rHI|Z2~bSBw"o'kXl;:[t!xXsNk@O90P1qSخ Q&/ ~z2zWD*[ Rf( '^he׭y83pʁC'!pui{եCІ/u>W*Ƀ Ľ# y5$ON BAAt@y3aCO*5wd/eEroaCj"=[u2筗{b]umɧsx79xKvuoQ6yD+nyp6vUy28a#f9."?MmiKfBFLNJp@婝a&Rky\oOfGRGٷ7>}聤0O6u}XC&ZZZAYpv܍sVU6{'V[ B3$7/%9^KjdO1OF%b}4q<^=n$k{&S8RfE(rV[w6dݱBEo.A l̴I&䦡=ާHO]Pox!j0Dž(᧧;ѽ SE.4!|;A4zL5jd1FKa8¥ȸBU7dH&9x@g "puȷ*<ܾqtM[$)`|H~;syR2.F IUs\' q/b6}n;LC \UHW ٪GbizYV4\2vH\|!qe(ь,wSN=  MKe>zT ’5@>[2ctFmĂJ?1$jio U|'l(ycWb"u li6,HGPR &@)E]-=@({dV껂rN^4O%V.F|~=Y"m3=Дk>@4bzP = 7&.x^CNpY DX7%+gGVqp^Y\Cof0OlyT;nm YTB=U=ɥzXv!qzkM/1#Vef 481d62qܖp&GtML=M?9sj cЩ,J:>C `=dgnJZ*%Ӌ@)zI8MOi:g6f/KqcqBB7(P8e.bx:~3) 䖲2WErJ#X]UC2LiQ=`Q*YKKG,{<ǣcoYxGצNl!z0y^B,U۱Jw;L@G)z.?hxo-O5̯p`V.s0U3ޖ&dn$E/1 \KIE1O^k"L_AU/@3Gёzf=">Ԅ"M,hJKIeN?S G ɩQ~lE;$x4zzm! +ȓq;yg epIWStlü4| ?{t`:JpėD U@%"4Q{*oqU|_32Q(1ުHLr( :Z1؊hfd^ zK5ZV2#,7lC/4)'Q{zg?7 jgƻOߐy<$$p6c }yn\L\fiߗrBzGB`J/T-3ǗmsR|)!%U;M9KؤLCX uESqe3*_hLQjo 7ȗ,t1[ѿm"%^tLYcem)BDzaV2͏X¤y%#8wA y7US%^ț| z7 Gmԝ~f̛`uJPOpZD{TeQL_ũQ4+<śj6Mo2d&;ծU+lAC X)XX^"-W{VU62܅˅1f9Oxa *Fqdyvo)VW*?T. MѰe<ҧϢ%FJjO7YKE5>JQHU?:7T+ Ť0|FJdSJ1+XiV:s^,e)1zMzDŮ`vX؈r'5"WF&\3{-0E5׈E8 gEō@REL}* zZ/QD8uįSvW05[$VkхY5 Ici+T%|"w)Ԯ0E@Tuڡ.J"Y6ewF~QFA#S ,>هo-39:uWNvH8-eclީl;27߉ůa)Zrf}j{Xv7ߚ=,r]x]LX(tkqbnzLa%ryq@msFt ~1KE)[m񝨧1/@p77!nsPPT*VB/6ɐGN$Jq\gLd&F *FQRTFZ@TW0Ϻ4c>/8f2nn+מב!8AVz:Ss~JfT/Q2J_`]d6dp9;<(A# nRO wxP%iZ ȩ}kǶ3{s9?uƲae=\jºBsVlﰵfPjiعZ3rLRkLZL1`@[o`RxhҾwH1|.fZ %IZ#*dMȀm!:nC^h>Åq]ꆉlYvh9fu7wH# 9X- "+:U_ _H_^IlێLkIqs]Ls1$c9Y|%RlsyV~ G~.vE $fE2EleU!ݨx^; (>9+B T~IU`f۠L oq^|})U1 ;Os" Bt&o_|oĥ93 As*ԁ fjͪRu1*Sw"ڤŜwdٜ(i[ļg6XcFR /QRj/9"Nٱo֙%lE&5.X0WMgDexujL(܀()XEg%V;ga 8RyMsapS|!5CyL LXhjFLd(qk2g'r٣;Eή.JS( "C:0w7Seɴ(AҼ:D}8}hMs$V#Cmg>@?,CãR2vGO|z/) rO{A'_H&A)EtCtY&f6;GuqK7udM!ukD~'˺ޙ&_fm.i|ja~?ѣp`+kS PEZLMkHy s)];<_w@; QRA u%nV ;9'h@]o7(>0|e\ tD +(r^f;Kbnk|/eu| & #T#5VI;@uEv٥ BA ͗&No"PjF:z‰n`:M) +帒<;\5LGq.iRdP%dQEs+HH.2%9ƶcWIy6WrGېD* s[ hkd;.H8!YMHⲭ\Xm0~jj_bnCu|WzCja}h2/,=\Yvi'k#*h m::N5i!Iy*Epe!2tCM<:pMoG6 [Oxx,UXMMPLPIx -s{5ˋi*%SY\nITj +hA Wo /܂bϤ_}{yX`t a1W٧*w57&@5 R_bo @˩gH>[6S\⦔nf^q`*f9nFKʼc|;~y| w(~|ݩ8C3 YG#6'1Q+IIS[W:iYɚ2GIGe+SW Ld5ݻ"ȋ>A`l,CHk(J֘FDI?Czr6zB =~^UiXb}cË>OIF<ؼvZ[+qx|;ħG ?7(7-DթC/=xq$ʒÄiƶ>n%CUگliPG`,,E':0,. Ɵg}ymrx.t)dԶDuaZN{AtvY7J8G^qvfIm Pg9Vbx6 H~c)U+HB\ị' ~CUOUj؝ ^k/6w,Jət =5K{P17—1"qg+jZ/[ הgKꟐ~[/WvC>oT~5w2f|X648-$59ԲR U_0y@QPx }Y[$\E:cBl>P1-&e.8➧C'%m F!`2F5P`e l,EONͪx CkyvcB6SݦqK inʡrJW7;2sƟ/Ƴ .vddZQ"\/ `aO;X!*vG=]YBY=#&~rq{o`pȷY˹%Ԅt"U4e!^Ш+>?_\rV6%RKl|; L!zd$ҧtlխ<.LNL&s84QfH^*/UJd?s͏ߍ\cy"6Ť0u/YfCfH{P1e!Z&MM(JƼnL:{]U` .^NVsuh=O}rtVDޅ"gU}\;nGBr=3B3?0RGCǃv(mg#o%Ph2#&(wR'nH,fUwЕzTH񢎲{ X%Qݙ0jr$N=ܵAɽ[Okgzwh\POyEXQjĀhʋL4 !1WmIz.C9 ͊=tw" ${Fab] :׊ bu^RriQOWi@ ~^# >㑨p_.+JхR5Hħ=DY )\%_ErC;%INdlX7aX-~0Za\PpbtMV @\P* UHi |^*ii`mmOfert^oac)p&] &_bߘeI J''RnGتKI QU=z xT}6$ň5's WįjxR0rtpz7=ŀ,@W؄:ޟWB:%e/'ɗAl28Mӝ q2S+. |l󂃨٢Ivs~GBe}xz #_E0ubrtTzTCSIsѮNue{Ij>dl?־g S[I&@PPʭ{& $ɇLmVXQ"1>uLgT7TI" $għ\6D9v1 M6kd' Ek=J,^&L@<Ӝ~iۯ vdd_Po*I8-T.}h''y)A^0VIuPNq뤗D'Z~P/Gҟ@ܳO p84lgJkSsmߋbeD(H#6y|,KY:J1I-ɼ hz<#c,QMoXz,i >X1,I^}2Qy{qGbWrWAė4ֻ ]mȕFW^ұ D+TBtSD u^yyx`ҞM 䪮Efa3u_&a1w7wu1Q{OY>&XQś^1=8XUOuf|$͹(cSRlq1xWQ'ߩxAc:B7}괍{=0XC]c nm9/&{5E:ߘsNJ9 G_뀅Cn}J4F.h\RU}Ч s/sK /ki/ug-j㹲UY,\^'.eS߼/l93~hJx5g ornnmCiUy> 2BN]m M")aE/fif%x:n ։]9Q9IyK)ӮVxM͡_QALajHTCp̣n-LEY-"T!&R>P|ҸﶋUl4DHڞ i!ѐVϜ{ e%(t&lELzO 腕>녺ھ[fHBcbedj0:Mn~Hz ?a%2FF<=&EpRǘ@TKX\.R-*A"IX3BEzNJrӌy?4ϡy2l6W^ui XYv<6TIqw=qWqwb ̜5"l_+wt4^ r8?o"p_ob<ꬺFo~?H? =\ &C+S*BXZDieYRLEv{Tju|" LHmen!|֙baTtb WHqͭ1Z Dkӑ^MPy fLҒZhBzD/47ۻSu-P&;[I̔Յ%l9yHi$} K>&ōjwVd(2#sHVmldZp8VyeX͹v>kZmx'x$DW<4+Mמ]Do lN4xG,aq{+gS/9 er<@n[zP9왕 `&H[D]!1֬^rXuKH}g;R0kv@S0|BO?:dKrץ>!,2>fS}`'`LϽ(Z*M{r f.-%]bq.*gl)3NXK |[* ?WX{Ty/iێ(;%}Kw`SP1ȧ5zdUZ^>^ZNo M^-ōT6B]d2{یh三82Ԕ}˫"ܝR^r$`h-` vuB _ SN`H-~}^1o}7\qSAzNW>Cg(4cC[ы?5j]F=7P}qp̪m79R: 9񕳙fg {N?outjKKiPc"ȓLRXluOy1Hiݪudk[WHEbxld߈Fk{XVZ:LQ3ic cB&܉O>.;;4$4<21v) {h0+w"4P,w_J->Y)'c?c/+J|2bCv;&Đ2)I{m 8ę~ ]6"R]سBH U #8A9HO؄@r3e1 xp&Pz#89wܥoroT1ލhsߞеKh}t!6gU$zy;N1ᛥ9l(W(e 'eU4bx$2XX ֠Ϊ hPHEKHA%Crhc'@wIZA$Qc_2E;Wch$Kl<JDUMf9tSLC,|^*8BX٥M{3qBV)ʟB@+b c??D>7uW"RO J(Mrڔ.kcws³۹q bɾJ1j3%At~Ht~Jni'Poޭw sl92D2)ITۅm2y<ڹ@ I+ 젍&q U/p%) C"l Sp"\gqUirqzIJBxM#V9qɭUmvs͇c\f4C-Z B%7PU)'O2,mYagptPPzT=֪*˩ARac4v4b%oDyB(o;堏l5ּyJc,jq dSج1ϻJDg#!=:L' "qV _<`q+Ne$Ndn`ReDަPH&zh'Z|ڽI<233VT%Nw BN4!'%YMG ?龑ـl *Yi*M"ȵBa,hP;/w|4,%)Jzǚ9I7v8k,:t;QpZB>JJ]D͋*)n C.. nwPXtG1:X5/$ ).qVXwS8To 5SX C4e5N&.6}7#8=S4r>tק%kD)bijs#,ksXw8¤8h{*g㺺K48)DUOUOJn(ECsmrdXuG1Ƈ~'`BHxoJ/+,1 fd ܂QePn1JCK74w(9?-!xTϗz5Nxki. 287Kc+JɕQe}Pdc.y Fu8 3Wz^yej~8Z:-*DcQ]x?}&v nJ?]-y蝴DIx%TDq z9q$ڲ`7D|X%o*]E81uC?n!;|6| v_~0#x go'&nxz\k-?Jän1AMҕ eB̊<o$ q1}g d-%6zetʭu_RBzOFlKO<)ƥQ=ng/sӵeoۓ#WL#ĔDO ܄?;neQ_\-S}Q[pŮҐM(Ch4uRBin~ɝFsAh/S3 _;AaoG9T/pj@zGo*,2h,dpcq\dkFI j,.6Yǁ/Gtr@{t|DT܍_ C ˖^e}!ck ڕ:͍f5\ko }@݁/>s|L9F}9?Y<ɇ &!ӿ 8 { .U^0-816G`q~/1EMo`d[SZL2?X!H~Vvކw:pKu'?'CCS Kҙ)uQ'7y-`ge#Hotz#)ͣ݋:i I r*x"!ε[iB Sal9+^wP$s*?̺="x괪%}|ph䬋t{} IX1s+hYGRXB&gO9׬3edހX7 R6}5x\NqfWѸfjg8+f0ٕ\jd]>~5t~if,_I9,냙{nClEIahb> Aj_WGZ%Jمy_h3cs42``#s/-fe‘sBL1sLD/"2kPdA7 @Pi613^fERՕ}=Dxͦѝ2+!s\}\TP`-E [M H5$\Rʸ?8.#Åx һI),akԉ:z؆Jr5D{,6_!Y~k#Bͷ"աUHNJΧg|rm 6':#z4])Ao톢4al Q[RwiP/ ق }RHUx}x/if+LP Lr"9!#I=rDw}F]ϷD:p΁>gO<%l|#e[<}CS ̄/.I|I/Jyd(L}| pe lCPA&Z4XDl-E`$.Z{= 2`Z0}6QNA .-ϠYc/*'>[g(_GF!nk ip0$JYy@!Dl^oUX 7=Qe?60nJ>lFj.T`V?ߩ;z/$4M_n*ug?4PT͇'Rxښ;*yr^Q!6k⻶^J2dS%Q+U P^2^2q=rNv$:k~1@w6C f8sNoI*^~vrD|ݜd#/dLN(&Ø r-j͔Z,, iϨ>ɺ1<%D "̎vm Ľҗl2FczC h/%t((.lJMGJjh3 S¼)i\n3 i -!5 >BNQ'uF 䝄ka(AIW jXGܱ,kA GA6JLq=ex:;stܼŖ$J p@L^/sۘ ~Od@}.?`4hĿG_iy Xsc,wD >;뜀 ŕ_ǟPqek6z'c*ߌA2ГgA^o_qyI>Q1b>@=/~K/UVi9B}Quwm3?9*բ|y}E9=o d{h0%zPQa"62 Sg XV1 yx(ZzTvipȯֵ(4fN% 3x [+?h.{ͳ+tȠo'62FaUxE̎9vzjt*HV=9^%^řŊMV q̡n.bo \HJzyRټ #3=Ѡ 9~:J\fCe>!_EɚVŖ\~JZUs[%w ??ZH ?-8-ri^EWx ݄Bp;E2ܛ/.*r[dpLvl)Æcꆙ칐" wBn Ӂ!y"Vf` ͻԦD ".6#5\XX$W_qWV%v sWAW^!)_|l۠$JpHth<ݧ%K \|fT$b(z&;O #sP)8WN7̌:Py9|svN,Ab&7k#ITN`'\6b;{bar43wO |cq^Ţ~VMVo(1"u;a :q:NIJQt'&)PGW ЄcGF"-]lx3k A}b@\n)-.;sVJtu) G m ]s.jA+]҂-Av@ uBvg3 JT9̴0bEwwM?Me9QH;B{#|?;<$ P> p4:ld~Lط53§H}`R"Hf*7Վ8owت vj"Q-^]GȠ6ruX**Qj c&\2UΏ)ijQPއ0KܽÅt e3j)sq|j ڈ+|Dm?.. @']'Ĕ|EE/3X1˂_OމeBqܾf6IL-@n![]Q6us0"lN=Diʉ/ { _Vۋ[D)Wf> $Vלz`i16B gREx(>=btaREedL_Ez1/P+7XǨ/2(_Iᚥ fN>pD\1|&CgОÒi6{:K9 qߤe([v%!LNZObv㷖ֵT91Ied^fm&b#n/p:HOaH3+gW6DjţM>9Ps )E.Hpa=; "KcVv]ְa^[FO؜ŋS@&TlN3{+Ew~\7;j{?Q ӔJ/<}l 2\,xh2xo\9a`uJr_Fy܀ihQ󟩿-\3 vEPQ8@TJ2zÅME_1nsOt)5@ K9p $׽vee:A :CgnН֯ X{M5glG`}_N=8CѼSfB04l%i\?Rʃ}Cp=Z0g7 [𲆚r|Fq߈-.:zvedU5n4ܑPƿ;M +? ݽ+3|OߋBP N( aǭ%}#7"h@bڙ=sO6 6!xדm"i!1T!l v}tWPp#aXDw^HaW< >Pբ˅@@4xv:NaZ Ҧa7D¥^5p˚L˞L~Fnsa ;ImPD[56 . nXwmZL8fVx^,! ))у9B+3H5ag EC59qO %AC1tF5 u4/[.u?jyE6<$BN` tKhM0rʅ?5n'ziM8i%$M Ti\۷mk{!S>ѧ3ċCQQROb.-?n[WzgҼaq)dK&+n hKrR(6 b oғ';{RWYBf7ܘaA;]{ΛF0.}d΄$;\|ژ0ܰkr2x3c!Gj4~B=cQ؎=<Ο󙉁:(0D{dRx78_~Ev}&XxZ6 \g'/hj@G\ˏ ӑ'`ݧțˢVhC.E ]._~ɗY-!}g='Utf@,&ʯUG~!D–T],"k(clņwIyA#?<})#l Vqg&TDŽZr+& 4sMM Xz e»_GZ4vhW49}`T;^:o d ')cE~?1F*dǧ-/ N]uGȽA;L^3 !R]$`J!bEJiҫ~^UMM]/Y۴G0t7ȗBeI1u&Y\Q ގ kƊd* V(R[`vXF9qkTK X z5 ~hNV=8A-] 6r{9gaBQȆɘ((67``+ Glț9,EsSu}W\&|ϢR(hϏI_ĖS%A=}:vYHIMm ,xK j!-1ϒ/Ѥⶱ,Bu9ONF}lh% !7aaz)=G+^z/,-4?S}OͶ9~tV>XwN0ŝt%D.‰A,6bQ$L玬D ^a15SyfqT,[} % 0&JugX+^O5|3ZtOyDu(ؚG1C+tgK bNknWۼ?2^Uխ?:zYpsbONq K瑸Yqo>0ۍpmi|c30\(4D,? :!.̧Kf N#xN4klvU <^@>sܔoqI͸gsCW WE&̯];PdF,KţT3lQ/nWˢd:ɜ%`c$$l{63e 䨋 `s%#߁}5r!FE6U-f !ŭkL9<]^B6eMgR7n7Khr t|52"V= ]m (6?@ڊljn-a s`*`<ځQfgo݀=m,YKp|CzrNc:~3BtQd`ldr WISb !0dU AqzXO2Hk = t2닪`}̥nwaIW1ab'`D^*::ت&VULjR{0 KޏcFG\:1V8a@fdT  b>@F2S")zZ;ÌO=iG戥D'me?Z0^C~s V խj;66p nɽ{ul<*ްI`7&to)ZnV˚۴=O<ʯ̀y->k6GBEaqv;:\H,٤u~_CUdC$/VP"%4xJ(F2F:ͯqsjc; huD/loNe?umiM?x 5<$EG+Hdyr}TJii,sn,hЦu׏T(daEajb{P1]dbw6$3"7 WpO̕Y@Su{~y.o O,pw9=RDT]J~Gxz=*7\l*A[52oӓ\@t]µu^)da-"0 ?:m ci 6xc.URx;co":Ja'MrPa:%746A_No0JkYY/0O[J,cgvmȐq=hPXJIo4*뿂 UAp.9E8 }=F@ SWWHYƦ`5,`őOJE ]ZLb5[Ou"kz+] \HЃ1MB N^* (95F)OkG]/VSh y<}9Qs9"t(J*W"YG+X9t/Fi]#k\q+B\ g#yKs͓Gw ؖC"׮3>늧2HKV26 LT9ž 4$M ^aVNroHޚF4 >Yΰ~R/3Jt!tA/.M8r&U~2)uw\e5(PN]׷jfKJ?3y)GAO9@V7یُt;W0/7<<"Q`V}).V0"X=ᔦA>xR{v |yl+sY( ק;zޢ;r_QRzlk4:'aIʭ9=,O7 0iLoN%tzH(CߘVՇf$%%@2 k:A~!Ke Wwt׀kA|ً /)>F#=1ֶD(TXVAא}LM0Xg?9T qR:g .GkN־|}'Dh-Kw2H<&@wJ:7s`K0{5SפͿmШZuQfh} ݍٱ#Zy~8ET^Iu9X(ww xLw|QHνByZA#<yֿWѹHJNtɴ?hۤ%%1/*&9oكEXִY""E~X a|+CJ )jj2B.iۈ(:0>$=,N]I?yR6Kcά&T&)^@@+ ?7N?{&/퇜mijD$UfDY̭CHQiѳf@_[6?YІo goV!NG WCT&2M&E\$ <~jK=~iJg,JJ*F锜8SR2wN[֫j3:nt' 5Fpt;, \ #)dd 9(7~Z;'1#rmn9'j;RE2#h/eE᠕p~=JOYHޏ6nu .?PB?T_A[n@LM gׁwOuE!VE{SN`Py9Z=/)lbl;.͊ϩO{Bl\Xz#f~5a_6IsLg0]kkP ?[X`3VvWCG81tH-V^I~JRR,|mOF=ǖ(k103P6+j^ŚD,PYztZOp]6Cb:bPwW+ sVx i;`4;0%! HB݉(^w9ˢ BJ 4 2]1@)kxgh Z^{] 0&ЯH7aZ KvZ)$0`/F z":b)!Nj^-yj0~7Oi` ]G3obq\P(=Q}3=9"I3k ii tҰşlW' q1kvDrN0{tRhXǾV6|MUUܢē0w7Y$Z%?ґLn^/ `fQ\ֲQ0ǁ^~~Liϻ1`P9@kB[%ɯ,A*pFY*Z,\^%ժ_P'd#uk0Sϕ`R͋'v` JSIni*!dX,IJ HϿT.=.wHq#˛|U)bC&- ϖ  lt>ɿ.1H~Wt馒լ~};:#ħ&_9m_o` 5H_YR\Ķl,-Er(85oE[Yj~ 73/q9pNeyF(% o-O~slkՈDGYZŮOרTjxs>*(Ym2FAXrT8sh&;Z[$ >J=\Rr8ArPR>mjyoc9^zz?xƊRibfTD,]u' v)HrlOzvy!%]v_Y[cD` e f™oJ.yk7 FŸug+.fP㩐6ׇG )'-Hٌ3lp1 ;!xT0sBM},!MbvAkNyQ3(#vթ7;wm[|x\ʠ̉G>TLd' nS( VsHަ̃_aYN ,z7kjZhk8,(mwet'z[L*R[+Q 1$P7+ 9}H#1!^/fﭟ{)_o Xۓ0)t Y2~{l[?qc9qjQ(zmO|Xu#GO^ti51bb &y51$-\se;"6ά$hJǹ+zlrZs_QoE>sVת9ݽ y,Tu{]2Ɂ=M,P5;zr^UzE8H3vd#kNz=X,75O BCEZKhZ`غO#+_@~`?6l"ӊ0$hɸ`7?כ*FQ`lD_iboة[ۢ7at3 ''9jW'MGrb{SjSDrս*SD2#{Mlآw۽[($,9^ Zk4`;ZFds13=omkf\?3et^76UY{:JLfܟNI-=hCsk?\)pvclOjj Fm~h?31bT)f(NiJ 7YJ{ijτ!ݎJ7h4bI+r[Rʽ^m¸mOQQ3RT g|l,=5~h<Y6S K9%? J|hk(r[K2|B++{scF(OW|g#0W?IOKԽVLO(ڪ)R<ټq&_s*VW$Zo|[KA(0FRk㥓)E.̔zچL>T:EAхa6l>\Fޥ =(#loO];>BÂ9p?IM[)e HL-ml U m{3{>6 WrUEVn|d.dBy۫;tdԺ5Q?1};m }[,R(\KYeOo_}h$ J;Ah"RU3:f>aުH&9_^h.a$` ntT$e*s<4elH KqcgCmj]0-?TcZˋ=fc7O-.5h5*ҿ1t-3&t;J40DgO0zڐm~}>;\VDj4P[i^2iArYQ:_tt$U۩Ǖ/56o62Awg#f: >=efz㝸sZwy~f1vrʑip7#{߲"O~rS7;CM 0<䂎K{w/ϊ׿CNrqe a߼4G͘wiD,~Qy##{1|)V@Ng2 FLܧ ==*ą# %]h5N )Y&Vligtk iwɊwVеw.T\~gďzA`mK{ZT7si:,lUzAz*#D/ e%:O"L§ic }~nUTi3$p=}D I1赾|D)3(,o05f5\2{4l\>uV2Y3Қ7lo}F`ݰFk1Qh(OLhG5wX>Xؓo^GėMz)u釋bz8B0Ivw816E'OBx csp, Ydi %,0K 9c}i`Ќ,E"ԸR=.ʶ- WQq\ ӯȽUY^-TWb6fM9Ubƭ&DQ3G=G,(%'<'~M;QS,JAϭvzC:n (R.Ҹr;,Uխ^a^Lh|+製8ZjU/c pԚQm(pF2l)d%va" M+YҜx'}w\%ZJ   bLU[.g:ԑRDU7ӿ3gLA$p -9'#5p?bJ"1琒*lM~ @Kd *"'vr+k{$FıRmDG# xU*TNdP":3[쀓BTlJee 時+]JXٱZu|;2A'ݛZU2=^pwJ@$RIvg9zےYki6H5JD)3SlL~)/#pP%M 7O+:LmFW3lV DnTl][J .mIȼ̘TG^ȅ,UUYķD1S=_[)Հ\Ljx+>9fyb],ij-[ϩxqb5rCm@9/\kΎl4ԍ;Z|XƼt姈!?IeL( 6oև!dF&6n%&wmA?kX)4I.;Ay`; 1Qb1>J BmvHt F"r5>M"YS-f\ "n#mjxxI 2yC PS&Rj9A5{ddу" l;;nSDBjA'QE=h-4ƬhX z@fN &@\ɑa(kq>)`/~yZMH˚cUj ϰnŐ S5qҹ^&00:qADA OCf"(SFWKPzt:;F}`kBhAե?)Bi|M?1=YgoYԞDLS .C("(b-l؍?ID5FF.&l*d#ܖ&'NTEg)7l;KFs8B~cݣ81^|8g;04i-6RzέxSWbԠI<:I}%i-"05|93G+ruMPAx m˸#ߘ֫k$}rb2z#:Y(nl+% : V6 Α>HmFJ:b)>ɶ n(Y(R1ad%^bL~~SwB&}A^,nqxlo %1R+f4M^ w)\sV':Gρ :H'Hh]b 2B(cKf܆maD SSӃ+۹CG\4w$ jۮhWbxSg%9[-^s jF+n>R–c~,~s4ht?#ߢxR=`0-_MK#̗{0`XPR`76^~6aX0Ԇ(  ޚN}'M@8gu"cD8yaH?OBd(-4g㬚-e!ՖT!@ PTnKwX%83ԶȼK7T,=m+ps%0`[iy;4[CE>Wt4BE nmQIޓȩ3/y@kY,5 aڨ2>  #1' h&GfԶn(*YP0iHYG&_ygV|U]4(sWl6iDDYÞ{?:Lalb;H!v&P6FcCƄO{^ݰR$;2,q8RoYH=5V tʶ;B4&ܢ ^AOb0ܢcw~f* (r1B*Iٛmw#06DK@-1imQ$/d6U^Kb~A.[J/A Ȑ˜DZ^t*'$K\7(mݎ+v #&c˭~.&kZ-l$!n8V#\ P/Y W9n-]Lewϐ'0&I+U!gy $6_].) ⮹8skA7׳1(gw_5$C'[Tm3'3[HѼЧ[\N) t{ij1'5?TȽ~8KQh%!1̼y=?QU Zח"?4Au+;G"ֆXtk}Sv 㞊],HDms8˳& 7FgnZeq䦍zu\Td+AZݶ~_eN礖R$k9 (#089Y8Hu@0JoBZt֬4L.߳Rco6] hcp{+[:*Cp@Α~yWYk (rJq3 Aa#p@v-ru(uk a3cRkhlf$(Ի|Y?v<ԗ@[?06)l.Tҥ}QuUT S%d=X]0*ɣv}A=jSS%K#'o%u"R1IǩU2~J\c毚Ӟ9Ђ¦RMCq샋gw^I9\(`>ܰ ] }uNC]l#džUrh! fM[1{7f {JܘCt)M7))-{zG*pxcD7$ t uC={L m3zJ5tnDGެJh7@QyֻQG[Ν 7CA  ~owr7_PR Jw{"nȂgh0/[Qj>}VvE )sU[hr2?!M0Rr2Cbp2q{Pj,)zUطg+wob%lR y_OJ/)!pytǿBx5)dUT>̷!̀@\k/ztaN&઩*F>՘",2b!SEGLʓdk+(SOͮIx1@ 7^oPWKxF~\ UU0r\ѬT!}׳԰mnȃU>V{gU$v6ِ?c 82B*=SuTJ#xYT#/yXҍM:#-=poקj 2hITac{ Ǫ@Cj[6]BH6ZЍZ\۠DQ! tXJ17D.Gx͵#Uesty~01{V= IXUdPXs?Tx9$CN3$0\1b(:sPq-P@q%zh/VLI۴HpQ3т'kt|޼#%+y;j 'bŶ B'$4Seax1{F94NK\VJ }-+ c(->߼ֹ،Z~ 's sI~DZI=4/_Za+Wc$7w5 J : v=M^;ΊJxd1@ |DF.36H Lڒ/[zYDJeYObk/ukKqC S57]Lw RB> en4a]S(וo uȓL)GCPB^Q؆|ZKAF[:-aÈ,}Ɨ"<%{hoNcq5pD%ΖZ"'GU{1^j7{д 0<ִiȞ1gDj>L}Y##>d-I䘌 z[כ7ծѩi3 bOea [d==lS|U ^3%eI"yAqN{`fYvn!dc`F,e4 ؚЫ[Fa2Gsw~mI5CAT|:qټ,kD(;OzO&c{:!]1W5h1D | a$>h1H3y\GEbqwyTjz5mޝ܄Z(tcyˇ<cD .kl@g^,=I* 5YefXsU9(SN3+t?`:rM[]\' Z[뾻.x*s|A$B3~IES\6|L+&hQH}ng!{R?^,]r|vs !%VISw^*hniTPrl_fi }~=gʹl,K VpSx,wT O8td7_u3؛U;e-ף{qp;^9hsx4b(JQii-Gu"3o̷t BriHC/6twRrW\gi]0,Kny{rrf*w3|-qW3X6ĦiX&^mBIX/>O֫1-zQ!hj[=J)pP MD;Aӓsbw6FQA.j 9ޚ hrv8"HSiOyHӗ'Ro5] @}^drLsHSnbȌn .œlkE# ǑX.%z/{[`К,3RpU$y_ϔZ JtX/0|&Cg K{Pxcp[bYX $I*Vn2~# ^@UYe fT wO1*ڙ^r靛à [WYZy%tTU[vSGFm܋gVMBBW$Gj%ϲlqB ac0 :g7[.]%N)OL!Fʃ{r<0+rH#:7"_{Q ![΍ppG[|GЛ%FKJ ){E߻ͽY|#s5-;b)esMg!.8jM^ب}\ D_j͋xN֗qݰcP #[MDr5B;UFeM|qqh ]p7+r.0ȿ=j[L0*:,ĕ Me3fH;oUYmw&/F9,QO@\1%$y#Z_(L]F9~RCb;zoXiSJCOk\|RrWP39(*vؾXƊ=6G~(эÊ0J$ U ͍ lD&5K?@5D[~Y(MoRлB]mh-.G^|Bg~qI )cnϤ>&W}B8w7yEŀs5J+%\H@ຮJ_CLjX9 PoʄOUyΰjŷKvr GNJ qh(TX4Q/Z_cXmэYxO:%XЇ 6>._1iǙ7@]'ʇz_T6>LûȤ᱆.EYvn >/ni-52- \yUGe "l!^3Cɨ<٠^h4X77<ӑ̓Ə=b1`'+Մ98l&GQZ>#'s\Q _߀YM-OxVtx[!SDYC矛}It8t>aµ0b{}8(؈b*`P!"yO$Q(7ʳ簫-aWZq/nZ{*PpeW0RU4'BU%i){7 ISV׽0|(Je{4ڸ,2~edӄW`1>%N5Qsiy=@FyZTi?KuV(̪=Jh.b,KCgρϖm#4L +1qַsb%I8,t%=hc4ɉjBϕ!vaM6c`<׎g(B7_ QViP:A!T=gժuo"Q5jEmOJ-Q=3w8v;+/ea1ѱ3e6mB1z ۈP|WtX >OtY0MH`k@4='VtYgK`,K%i6qT`OR< S3"F&(fM'uuծ:*E@O> ?$b$(16Dd!nY#+]dI-U?O4[41^^pjܚr$mc4R˫/?!f6 wZzN@QUp}|QlԻH]Qxݦ٪6VeS3W̫NBG_ENrKnuǙza@g(fd[s61mzTuThJ*`j(]~r YG7K  W#&aVg{7ٍ{ミVͅe|SEǔ5+S2^b&|xd!l _ gJ{w+W""T5a^Ɇи>Ҕ%NghcԴ8w |WCl>BPК{;09D#>d!cg ^AJ$,LYWϞg/x8Z2%\D򲗼o}B tI:WfpL[䊇R HaNeʵ;ޟlm ^_Dˑ "p~o-Ot\$Q ,O{?_ /Tv1.7W/<4JgvX 㮀aCL6Mp^GŨ->dbdKbl(;UXP]WԇHdi;tgC\ Y*˩Os'`X!8E'9lig|9~C::NZalmv$tϾY*(@OI,N% n)a 4[R\]{am`%5 g)81Z:/h,r2<,\ۧwo a %,#IKո.Veq1,dMr%19LHLW2ٻo$ҐwK/dmI7ߥ@ os3,T(/u;5PIJO 5`Zwy?ʁeWid7[:SJ (}DU;}+aa{b 1Q2| g.*&ׂ]QoҷDL/@=R'CeH%;n⇽,2ѷe;sKJc:πn"!jLD4< qg4;kمA_Rg; p #rQI [|ڋs)O<898q*c%/ a0!~Ҭa*HꊢAjtä rI3#0_AIU<>|gz[NQ^Ni&v))}O~j.eș]p$) #&23c%4sp#t-5i}RKw&'N| GnSR[ozPKa,<HzFiXs7xIAO.gN[vS^wek,%lBWhtc|4ߟ'zz vg5>I$j2 ZcRG-G;<ժ)'Oak90cXmϗ''5Ww ߣunYjV Wky6v+DyP7oۜ4}$Je4gnHd1HDL%|azI/AӶҍF_W%YM$^|+kAMI *ʻQSb!: A ɘJDYZ %m@(0Z[ݝ%JZyB7p1Z(V2f>4A(l2&Z*>EE [c^VtxċI|Ŵqؐ.q2e)G8TRCPp%NbW쩜PRAYA :l@) \+ߘ`_7.o XB)c rZ$}OfmPq]4|٩QBmE޴Եh${=>(F˙Sߏg3׎I@IfFX65"ƐybO{}'z7+^ ]T^ Y N6%B8<4^ڨ;lҫ+ѓb6"/PϥAoUB-z ~T3w+;ROSՄ :@|FqHC.O;BW#O/l\)gb;&ߥA|R$RWzcA]F%><|q ,Ì};6 {KGEK(szBՇ8Q24w}`cp(J~M<-eērݑzERCIg+Vjz6dHPԫHR &ח'41>`z9{GWdZLfx`d&Jŋd^RAÍ %\iCu/D۝ s.Owt6G6a#q# i  R9f2R@)F&.LN]^Sm m_h%>J7TOWeڻyH ``/jr[mSpzj%n^iFil_tI:Mx:_طH=R˛rfl]cUFb |4դJ1vTҒx Ÿcw6iB>2$"^T#1ŧ1HQ(p!_沍҅>C?G*MDf90]/+_X(,4t97WV0[/z>"*wG]ҿ;G~{"I4($'I'";q}ģd0B‰3Hg5XqiZv,K lėPX^ / (8fMJ@;/N+SK>$RaHQsWʴ.|#p(P)Ҫi6ڠ\bGޖ߀PGaS"pH\EVYIQ!4xcU܂VH xu:)Ly 50@r8cy"E"8KEOPe.o'E_R8^ 91Z9Mo]dw3 Gq6.g|Ƭʹ^q[f[h>roz#iCrvEߘK]BI<˳&64#24i'E3s>c0QWnw=mpy1!eX5ZSCWӲs- _n43iGvbylz<9asEv#MSf[? rׯ*Ek\!pޞCfѝ,zOmž)h="{'c (O7iC2Mh^1BҶm-c "iEvinȞkIE&,oշٌ>0v_7tdI s< CR'G)y5wW6e4:Hwv a(.N',&c/B{V7ߙ&*HC~I;tc5%A95c7ˤ0 =oBCPq旫v^45:1_ks (Å6yvSe> a*g*G8XFzPM&|@"Ce;K^IWvMt0vUI>jXoג4dc6(+C\ @uXcs"4 C[gb^2zCG *' js"ʦ]0Y2+> r|ڮ;%xW;w3* "C$J޹CM-9T̂?[!3PC(U]Ɩ4`D{ץEna4_Fn͝6;ri0-g]/ x@l ΕB~\ӡ k]m.WYL{1Mg:M,/e6I| yQn&#or+.ֹ8G K@9:&#tg, q;]y#xnL)jc%P"P ,7BnP'4/ J=r)fŸ-XtV2[NM^{Lcdf[@ȟcΧA5&Z#~,TM eFdЎBh֥lIRFeLzג"m$NXŅ]KZ!?94M P702*To Ⱦ_ 7!*K[sntosh3s7IG͝+J:v rLS9A,jMQGMqErt0 Lp@'$a*9>^2W9 3>(iˋzink4;zn4A#^޲/Xl5E5&TOx$g]ȇ\ :ð€J vXΈzEfgnR)M {RFsE-BBJU?[T0u;o?[gYy[ԇ nN ثԁWICVBWGK%yyPQlT)~pz2 Du/_kUg }mCqH?k%H@9oP?;1e~\o⸤[;/H0LAim[_{(DYg;L%<7/qXC?9<_Sn^x)f*< U ް|zNopy@[S&@ s  `S@֮شJ4p3ݵ T' *=]x AR_kF>: $sE^ d@ZQɯILLKD:u !zUJ΋W5nM:u.ghlzx;!kl1).WHVeǘ~#\eEt}0f8b9`S;s$9Jۑc,Wy׈LQ?4Һ: uRՊs9%W 62B?(T+ѿ￑\N$|`C /Z^7DYrPtgR%糮0Ƒ}&|o8´ .U7U]B–5DV ĽZƘ_PnAP!kܳe cG V 5*Q^CX2;nq~ZO?n`|ȺӰK[^*yJX{45ٶ%-M?: An:V2K, 1PV,{b|yywq2Sdo6W㉵&殕z\*DIa 7Hk/`m]3P+љxߴm:~uK-#|n.cP( ڔ[ȺRpWPV!W͠C[qe.(4& :+8攙mQX?@jE$JҨVe *ve~e`9I(O)߯;9@N:OfƪE3Ϸp_e=|!_<(D) ݊}oR/wdR\fB֭)VR qR?Z))"l h#Y̠ȹq(:XC!JƟI@z懂i=}x66vRi~w Z/m߃6}ٷALORDy \Nϵb#(98)ݞn=HNzӲ('U: (!.wh07ޕaP FRGZ`:&9GNyw!ʏe1H,jܓIJsDx {'L2)+&xc댆(51¾u ?gЬvԟ vU…? dR]<\L|wm/ DJenވйU"޶or&B:"*RWd`jvı"[T d ;[#] ݇|C])~%.pl`y4ݹQK{)PO?"\LCO6TXy%4x1s޴Fv~Ɛ_k^è }oguLۣ9x<7}n|bW+dzK{ȶ92_U: o( \k+ڨ ,Z$gTEmr%X A#}jOX *) [0iD`"X$vI\wDJ66w!eP{c?Mgvx~%3qQg 1HRUf仃؝Ņj7c# a * _RvקbUEὙ֒kyʳz8}*;ưV\P8 .Qy%@o 18zAn圓l{ B%LN폁 @V*[4;x~qP9olP J jyG)G["'7eWuUI9Vv)(R-o ą@vsjZh3q; -V[9-%)?QX^Z*IPC[4Ql6㨠}ضD*?F'cE4e ><5 ȁQt'K~\oyuJ_䓊}D glAhk$'7a#Zf͟5y>J~x|KHFf1br$A92*n2ͤj@::aGR;~gk~rn}tSis*O[D]kiCL#m 8"䛔zSԽ=/edT cF]l!en'9뿥ac ,%9R#0a<|,Hz˯:7\o=W m 4bXPS:ԒHaRܙ " B#a8j`ϓf"Tjmޞa8" Ҋ\|YxʱAd+Ꮧt4cȣ_]-4/-P]v̌$XE Gw\@Y0|_$^ܨ"QGaX0]:TU'ͭU?X8*3"KJO҆dq~3j>lp4Lp]Zg!-uVUְs\8D{4C.s!TonxP<dD"p̕=!Ro0i\DT:})XjveSȝUvc3-cڄi-+CHƝ,urjqcb-( u;,15yH63ι5+'ަ(NjP`8cnIV:& 16Rր|璬 T)TvrxD9!]tKP BUӀ)ϲ5gS3*gҟ$8d ..te}j$CR!q,9 OUb_swTOY7ai. yw8X~u-_CS} F(utG V>St|AIiwVFQ"2}Dd~G] gL\3&N>z 3MwT[=_ GxM(ܼ݉^y#R2/3A+zG#A1hJ-BӂG4&0}A1ovkfic"<)iyYOX(m n*ȪZT s(3O~Ph9½1243GQ:!ERr|U'_YHdm1bz؛X٢ "dIeJyv)Rԑ (jF" He}]Lb"yM!+ dԱ;EH5pPxa㊍ ]S>NvX9'U=A¥Z Jd 쥅9u=R:B|p/ŽDl*:mj[0Q$~wHGޣW8z<+9㊭a iP\=2z9l%auK;gbE2Sa)jdf)*TڋOR6b+2cByчE}K-n!Y(YϠz8Cld^օ=&U k׬~r،C%뜦*wW,l $'<As B sK~PChgMnN(};eQ#ΨSKiT\"B0G<[Ҡ8˚_S0FdC5DǺÁ}2#_XVM@'_֢p)yNlIwb@s|C-{zQxgUlL6egȩłi_5R_vfŦ 2@@'m!E=4tР4>_- SU0*XjuKk} QP̑8 Xe̯d] 8# ceG$Ǥ)n9 09ryDc%k 4:%4wGy!a WX%:^36_;JsNyLWF:+dQ8gym~Z^G]k7hz^GMN#1;!wL]s+.O߂+kafD!7LBlť-6zH0D ǻk#`tw& |_gu-KEa5M c2e KӭN@tE_r͏O5BpNUD-Fy5|U`Z l.e/AӊVD< x`HQq:s.l+6YὈNHa#A{S'zns|8tVv{atS% YOM[t%*r'si'9ԁS a-0/{יUDmTIj h"ljQh&}MJ9v&w"r$tn=)&-q]+QzܘT>K_:VwjSeH=w>CNpcAxP݁SK:|uO}90> ?b,Ű؜7^j#5US@CkIR-/4XbNX(>@!ڤpzjD$4_Q 1/efm]ڶ0)9tޭ{%0ߵ[; }E#1.!KHԣZ yUBV~V5}2_Yfb!&sWj GiU)P L^ޖK",D&h{':rWISAQ:4xI@=LagNv|#h'gz^4@[U 110{?ѵ-2O.ߩhD=ղј%֢$A2LU"Y QQTȆ5z%2RDtC8i>B{}V1SQj3ŐFZJީbeid6a qԁ{ /Uq=Qˆ(Z7ڙ>׀|:y:vCb-[^) 2ksg@T@[O;3R; Ro|Iaktbqs-D=L_&E_O&*,ؖ \7<35aE`+Hw„w*%}ΧJnhQfXK^VNḶs8okHz<San9G&}هɐxʬ0g{]:JŬ꘾4|APaW"GsQXBG O|So|SX"O4mbR=8RNҼ(oz[khU\&j\mn!܎B9%d~  i@#7h(uJHܽ~(=K> O DvPD+]J5iQ=Daas}u66t@oYx.r}nغR Ma|K }wi\cS^7#ͪ^/Tt-Y'D5 =|nxOAq+.CƶdCYX:ڇ%Vx%5^~q7چUr`O|?fz^H&fmCy% o_"sA0ՋdfF;(SZ;h+ن1EPLY=S-~28tI[!wߘQ1lM?eB';1]/vrT6ֿO<s]*EFʥ5o}puI.:&tg_W*ƊVV cLJ^DQ{|xwU}l=9pz(w! lt@PIRq EQAJb9t(͍@:GDfqIW8 [ 3C:ݳWL azuэt*fn{<؂`4WÞ;wMy艂M,DhC~|NQ#mKt>!(JH/T.ΥzQt|`j_C<Ŵ֖75cDXֳG ̺$;\jcZcLVȃz@կg>]`>y*Aq꿋%Ja>h5\iDwdׅEd^@NQzVbsמXژ$*vmL"3g-PѮbZ,@mo@e(N4;2*}?u !&Lz>>>.ya7m)N.]н[;p3Mc fQ*R5sk h \Qo,l$o Bxh=VČt5MJ#zR?F{5 4qA?,m/K&4+xN!9fzEUnH8/Ԥ.4< 퓯1lZ*"]":7i?w(DRp*NMMM*pP~u}B޴Q `v%SmN)'`ַnߥ엁$aY2۽{uq@SD;)&|slH&S`F83,*X#aDvv==fh6(zOȌN2(sN_oJ;! se]ސbg!pn ==~ZTcy؍,ֵNʶ 6M҉jr܌b`QX{g &C\_`iubjKEHD˼Z$bq tW2f^Rث1AbCrR!#'Ae`u`()=ΪfёJ;g6.iCtBn}lv~PP}u(+y9_Xp*ǐqF3<_},6U/czDzbjֶ;)SRa/$u>z_98FgorHX_@U/bm 3S8=iAjJ-FS;g5~tfΜz鹑rr΀EI_t~^-hLa8l?I L; Z<'V܆7=f?d1;l H~V UJwل 6m*rcLOrƣu̘`em1$ = IURX=`w'"iV'f= ){2:Ѯ5c<cv,OQBDwN,vQG0xMY8RB^ܴf(̇GƇËR+6Kȑ[|@y;Uy`Pl#rzQX׶ c 5CWܤ U,yxs]>'{n *]F057*wW#!+^V(Qh>P+اomF5 K#V[ƥ>/z?26 !nxc$#zB:T[YG2ૂϼݿ%K5V+lR`?/%;U1߈WA^3tp=uFFjhZd'iV"wFTVoIi7 ݏBfMPGW ;ƳW9em@(1c E'3-F:wI)>DRWQ*$cʓCJWmuK;vO1bR1包+W)gʿDQ1nx;u B4<61 lJe|hb-^'vRx 4c΄97WGa`[0bF\:lcUظVCl:ɝ@Hx!ibni183u~a$!`3nҩ! m $Z:9У@9׬1WΏM;.lA~MqzxD%S3E9U ( Y=Ƀ]Hǩ:պa#h'(#1CdIʥHl^qW%eAcMưN Wj>zs.}+"ٚ#Ă]n=`IWFب/CM&Vnawt %2F fOuxy' +R:~^&RmD7ɷUYmc FUkssIQcRAM-Q=/}-Uw~4-bl ?F="ikr_XzM# Uх=Ceq~{u]FU3KH9 $O( !S5C)f%c†t 89)ݮolxA9!vmb=Z y t V g gf$(ҷccBRe,.&@YP4Z qF%QFT1&Im*Noif"ljE7;,ٲ)%΢ -;lg7~YSÉ ,{s#w½ ٳYU^`+C!zLhBm=$R+T&PNPt8 tM.UF\'>hbs:,3is/36b5޶g޶w H"/^kfU,/)~m:?Bit}ldE3Ϩy%Hf9Y<FѱL!'GcWNl< @,mRBj0%>ֲػ*² tK:m?z#Ð#]VtGPĘhE AL_ Ԫ,I.QhA87y Tqc P Ͳ"-C'.,z_ʒt|F/F,fǏo2ן|[+$%s%Q #Yi !#]%FwWfդv;wDa fv%30։BLS*I%/3]Gw[6fL~k'Lp̤øw)vzV (P$TEV)-m-u. T29mm?@kD.*RR'M^HUhJyRE>kO*] *gOgC(ޓdڂeԜuvYQ&7&V9pUpؕE-;+N7%v_&f4rB8OcJ+X ;lmKdG;GX`x:F5ȾR[f5A=VM7 <3iMs/K Pھ ω}+4j/ADzEԎi$ g#gB.:fn9LuTׯSm;ZYׄ{RHA) *c&V[$"]a juϫc[kBODyA-^Dێ,ϊ/.x%E[c '~ɤJTWS,pB[F>}-#LhqO yjTQL&ui3*S`**j ) rtKq}!yS+ZPB"`ToλU\,^@Ft?c/*wnAIuܭ {Pb wʴl 8 maT%~i6 ՋWYQp1?@QeVƞ;5b`r'[cɀzjb $O!A>j"}|a U^z7ޘq}Df'^B1ֹpJdau1c9?hwR5jg^NvY|^IYP`ZA`Vzyom@r=g-Xgdn'n$]ou4Ww ZȒ: 4V]n3DM,7W$ƍ0劘6VyP=f cQ9i g|Eȓd3i_|1@|;P64J02TչJ7M)&/X|V?ZRgU+j 2ƣe&_Ө8ԊO1UEEcðsܕK #?ꦿ *іlnI@-4kVڜ$84kˬM$rUOHa3rk(2QI@@roAjKd/3C (0jl1 (-xC#7H8aJvlFVqws1pC[H %$3GN60NsPdobN> doA[}pD;wO\rWxB?QQ}X8 sʕj&k0wzL]:(ssILuOK匫Ϙ_>[ڦ菍e?Uy̜* .[y+Qm#!0kb:z%VNfD~\t{h`]DCFBiqp p~hLF "@22ˢc0!QFsP$\pn ;sb'W$ly,2ˊ'yN>a$᫊M:-=)qk)]/m1yq7lkuVf8BxRED֨:_FM4V:"Syc{㓯^_*Ǽp.K]o\<-\o֊<wWFfTJn6d[(*M#z+R"HR{D*䁍BI(PÏ9:-SIE|ڀVR0fۅAD9WR bv 9F?nX:W`*ٚ$0* sI57= 9ؖ094bPO5O BN ~a*GVR >74H'tO.YSѵHӵo$|}Cq d0Ҡ@aԄ~W a}uxm^lDp36̞z8/U"H,MvbIT:m3M9XHظ8y孜9 3GĶmt#`W Tƛ8h<a M/P]qk]Y0yd3S起$ Bkő 'j#~:(A;b'. Cد qmzy}07H?-,E׭a*.7 =ZUɘlG[@|CktnƮ]{fXNe[O.T>Ek~,&kd #^mpLL7oK@r2Anߑ:ei돤R'ې7]pq~7 E'Ӑ2 a)ىԘH__p,5o ^}B} n©e8jK=[}Hq+ЕBf=yQX__ djMl2'p8 9Z ;\S*EhrmK4sa+r;mx\ -DPJRZSTo6"p*RCC@L-YrG8 &W24ya*+H\2I.N-]aZJO}p`j,] ֪/p@wbJ FN=<N<Փ t b0e"}^:0ZxkZɠJw;l@vs՟Zߓuo0ʏLAx^qc>lͫ*ޖRJV9 IPmʽ;E"^B+KiV.wND @c\a2=|md!f7QCR,L|6aT<{4 |*F=Pg(oK8lqcIEِy0>9hk +ܠm:ݵ=>B1w &ąbjd8?XgL eTGL,Ku"gJrlF-{~Ͽmn0p H}(1cbRaB޻1t.288WSit':J}O<c>a۹z/ِw?G_-"& u*B#6y/ѕvRLT~SbBP0KU!J=+S4O'YJ$ļk ˧:C27P1n<+co}C:"Z ksL('RS/. "`O&Yx f!]rJxQy~mNQ^Bu q kEPI>s[m 4~WKc (#ES_"c`YCuELW5csв/ Hᆇ_$ޫ~=z|xcCpY]QPKn/7s-CM+12|g0@dI@\ja=+͡$HoJBKJ@chb\޿~F{?<&a~(z?oѮ5dol7D E]vKe]1$H|7>U0Iv&ƛ6 ۫~٭LnѩDg ~YLVY_~ ,3@_~Fh| ?c\׆&C#æF|[m(GBFRX\džٲ~7:>Ņ&&h(!#$9R {KDw$1܏IEv0ZYC lK ̗))2Q&E#/{PRxi݊0wB7@dj.Jt\,G2T\0`˪,-$ 0T * -JS{}i8桔4[M=g ^wQbnQuN@FFѫՑD.8,^`B-SJ9o) WWKv$2p>([anW"ϚBJw lt=Ac Y_[\j *;XШgcYJpu\$r8)@%ԅʩ\ӠN5aCMɷR52Jp^Dz-BQwJV&r s&A~(Q]р*6sS1}Z,G IcJwp~C0@DcXm"8s$59*srPU0,>i݄=^]ǷouF3.n^w919o(?#_8e0DŽ>>:ؼ͟fOE H<} טaͤ1gr*T~ΌR[\k%lCB.(PUpaPwbR}2nXJMا 3! g$TZ7͑\L$QLxqLꆵK.1!w▦M F\x˹?e4Y0V=~/߮,dO'gf Z#U䭆lQFkHZfMofϭft%RPh!sFBƔ(CJ RNAc]E#zU\`iHhX a=N-h.v U1eW27q }s,u9 p8a@}뺖bf5)M 0l+5TdyKxAuGӚy qoQX }(A75ٺ Au%e Sܖ83&ȩΙF'?Lg#.zڂ,aK3z C;u.U?'/(Ok=7_ۢEl[UG`GFN6jIG0@b5-АJHriwN ٌqzѰ(]2!@ovzG`?`MнAʳ$dT8͌&CY&+ $KL|_ ^;+ݺ|#٤-?nk_9*p`M+TР{Og1F̙o^WpuCL(hRh']Ôi1mdX{Keqcy=Kt-0pU 4/1%lW'rujΛ!@0dÊFޟV@N;)mIyT#̋&'եߔ9 h\Vqyt053[+h$GE]Ȍ:\S3k E B8?hRUHH, F `"EX P@V vv1*s\}pFEV!,jگla8:扭C9? ,LS DsQoN3ՈOFE"n4_GŸtv[L1Iv8t@%Equ<> 'TQJ34ޤ(p/o v2E7e2v?^'!0-Y_@dBxsieaQ25 hjH? 8WaxCtqjaK'@n9heL k|Mޓusgjh?-Qrs=ѩf\*µe2\k:渇7"K݉-39U*Wg}K-ksj ˱ןĹ-=kC,v|ɖ@/M9DΌgije E `(LA=^FT[N3Y$|ǛݪŅ 9!p3Na,y߆P%_424G E̗' fpwn 'wwX`Sߊ*0\hݛփ1-Znt3:$@6xOiU[k0tp,Rg8U%rdsgV{H7IC8Q>]9y^aXbm^Y Ӈ.% m !t uݕ$?Ƽ] fSy`| 0zgb8&6l@Ʋ^&n '敹]4HaਾVB<}DGg%tI$33ЛM<:5yD;:H;Su:;%G6ed+ev8\t`{~*Eoxx.Tpa9dpKuBeaoFވ,TScTϐMPڰXyܙnl{,T7|ǃ[ũ9&Lc0iR + uxضzLEcE~*r|>lV{9'P)0H skN 6݉ldšn\nQ+76h6k~u _p"!4UTUBŸqY{Rc@WGa ֪H[,k8W= ,k&E, r)ZxMQ5KNz6mO/Vc`D./8AqءGe.?.'Qd o|`לt^eEgXND2W1ۢJ<wLv^>" c]KٞX/ndt=<#إNn`Pi%^SFjv[ZK LU9@t@Bf N4;i$yЦ3n (q,TdkqiEoDɮp(AكUJ4\Z}^ ;Pb;ơ0ǖ`WλD+*9֜iS۾edsDŞc-oC_8> U!@( C%'GW#;@ZXvl",&D@'+EM)Ϳ8` Q`W}>|P(Fݎ#ĥь\M_Z Y( ĂV`5iz| ak M*^X 鿱)%'>zÖ \ ao7_hIh; ~5V*[ ͊ŏ>]Qz[>vm:u4V{$Y{}a=6;J#1ye>?zuݻMC2dhH,S$uٖ i)g~Qӿa" Tnn1a%n,< ')'JiDQ>HK"UߧmJ*dgoJwT@i8$ܭ'5qw]^D[ޏ$爔 wG?nX١Ap$U7d9;jbmJk>|ӃzTs s2ٜQ:ejo:͊$Y9I2/!IOCf72_iː1*,-2TQX9Mu !Ƹ:dQGP'Utu&&#IR 4dup #bC'4 @t+7N@6nt:U^R3\A N;I<ӛ>:V8? @ r &cQob1"!<:s8O`hibJ9TAtke -yx` ߡ6 5AD!ϣq K@8dH'{`M'9O5rbus'Hls&IC3%|?Z&tz(ZYOV7 -h|Q\$1X]|RGjX&c K(JDD@8T݁GCE {Q uT}%Q⃑$Ufe !Xz(%q3eu(@OzDW2e EIDT%-a:/+˗mVޤtҴ3M2nmǰ_cn*4s$ ΍(1%E*<=On9b b?-dD׆R'߫}φ|(5÷qeϏrYrڵ]S|\Ac=ύ/]q8)w\r0N+31yX !m3coi7HW_Ɉ#}[P;a܂Hi0׆τrm-1j,ק0Z4v;-GNR,٣UxSSlbȊ۫hQV--:f~ (QA~|d>)ˆWXkj8ݨ̪uWmc<}kz#SArv)lR-d&)gY)׮w}fw R>2i_޲ѽxWZB' CG`H+.|CX\vNtQx[ILvZwQWmq+lofZGXHЌ`ϒh=xZt32F*5XR5rFwTaͥO6>*JMiEAjJܐ{ycA@\9ˢ;G5QEWJvr{9BCKzY4`|ʼn kR"\zM)dr>ihӥvAKGz0 Zj.uiun`_n ~I !3EAuAv8Gp8-| #!d>hJ Nu48!Dž- }};v;*>RʞEUXzT36R<̻jJ<[{oόsyHY z#B4)n'ux::܇/( Fk Pu k`?+Rp`>qxJ㩇tǶ/"\hpNG5lViDeL`˘!)V_ZcM`Zp"$3hjB}j˞R쏢9w~ê>\XN{R>[/Ӽi\wX?'Z*JS3fm1x4N"~ *3`̰yH9H?IJh*.n([8,Ò>bd#SZkk,Aס|':_s4\ 's8Aʒ66 Qw Si9Huh+匴 hw}L [δa"1W|L۹xቕ0_࿭vY]λF (`!eFjT?>l t6eemN \6< 9fϐK/eNBLoi7IVdϊǔthnR?y@90J#DW-t{7ǿEyUmy}uv}8X8CFi5m)71:ЄJ=S"a*Tm/|N, Os[njO6ԛ߭XZoKȲM㥱\d-F.AoclD4Uϕ˨%A}R͎T@*"ȨJ9 t+sŸ? %O?G|vډ8wLHʐ˶)-dP&S6J]ױBZ&֭P AM2\h" `h@_<4_Y a*M h~aUXS&US+=_^ UR1_x `el-[.:f ܹ-(їs@&% 'd\@[ӊGp԰YC̢b6*uVY×fBV}*l9~@M-f84ړT{,ϢXd'zhdQhSY~.GJЈ@{oOMI:nݒzt|&&A װ!N/7=]BƮd'0-'-U]C)5\E&PRI`~AdvQrF/?OQ{MS sYBEk zgP2/?C z6:m N)\AL vH|?ﺺÚ_5 X$y;Cg0``AD[UqŠWma$ &3x Z^0f$D 5ʀw,Ӎt½xWjf>w(W6m 5!2ΪpGeItru䭩 C|nu˞( 1Yz)k'hDC Q(3ԜpE@WLF"INߢ[0'9Z`çp 2d^ltkӖ[x} @er+V`9^/ ͞Wwg{&/L-8lLv;_Ѡ 9liS>%z_-rȧ' lX6Ԟfq%W/ Wń49 T2c͙!=Gc`DG ɘgYJb-F1e{1N]%Iz䄰R0GЋ/_|YJ/ok1zѫE/0hDfzx2nPDhBÖKuء`1dIzoqs`m WKmpޢs<ЎW;"Za%O8WJ( vRR !0d8mEɚwg ʢ.%ڼ.4nȡݓ3yz?Cqq Y(*`:G~ h$K#6Jˡ^ѡSnw(lF#4ќ-*4D{pqC,D@$9R .*d  7&ՈI'CM vJ!mkDSra(5(8 CR9?Oc$1mV׬B6@>^J g-;;BW1=";L{ ?6Fo邯fQ7i"nȋepW)OJ2,' *ETl)C{h6}E~d.Peos< 6l#iMcDGXj ܩWЎUŷ 5F˥iKs7jF]~0U~B|[u*w/|^I܈p \>hoLI5חÞYKp\M'v_tjJ糣G9`L TPEN:1tV<>gH8mJDM\c.o35^ޚS 0рsK^L`8[Dm>}s7ތŭә g4 /K+|Gdf1*`Z)+Sm#LמeYi&S߷ջwl(T=^1?\IDG4r8wE*ś`^݁\!P]g 7Ž #j%Y\|9NAV]ц1|2< enlQz,ڮ--~,;i8Dc}t?wFIUc= ǙIXv~Np${X˼De L}Y?/oӎCҰP  K%\(WWB ;r˚|[VBGvok 9C?.k҅iJdp<7Szjޛl(%Seß ,yh8cv-첬iG.&Oӟ 05*qeKAB qDd8k=Kdtx&+8AhB5@Q1["DIe,kgXMg< V)IL{Y}L IoY^J+#v 0"[ҹ&ڳ]ObkM~7KaMbx$}>gCZzC_W|o*wJzx4tGaZj0 ?]TKce|.;aSI =r YKXfz;GЈy[ЪTƸ_pp}Y E1wZwy~Ӆ,(/H!CeyIYЌl".A߉qeciS ?sWhMR~0W>8n DP 1=&L&S'|ŊdH>*P%lla\LGtvDYכT[s@9jc2|(T*ˑ=a\XEw߹`8w`o0~@%9)mG\88Vst?0'- S21z dQyυ.)_2=@AW:gy<]A vyKu#a.XΤODiH`b9[% lh U`!Ȋҡ{%b  m3P6sm; {#Xxܯ36=N])?[ȎE4#@բL쌗~!5T习{݄]<2mBiuk-$c_0 c֜ ]8R;N>MOwfɊ+,h~\PU"~2Q|z۳oOvX 4-l  |O0KuXΎer o9*>m-R@UAD9{v#s41[!]1'(#fy7(ڼ`<&f>Bv9 }Q ]Զ!XqIbHnv5&(]gz_csqcM[*$$O{j PL”_l;KVm7xqjo^wh+e>Cxɶ{:h^N?n8IKbܫaa#XT_;OYB؅B;[d 018rۚYK$ij"Jf&u2_6)u#jJ.} ~4uxc4.q%Kn e]sV 8ye1 ll-vYqѤDt5W//GԬi$j;Ez|U{P.jp&&{%I̸s+X`w9Cso5åq$>cM &،v)cKK<<ܾarhMwB&O2P V߱;8gmn_Sմ`׸JaŠqyOt֗@B@#+OY>Q]ܿ&a=k5r@ƝSWJV{-iA'Z|)>#j?Mi`1 k2&yAK댑{qMl X&#MFx}ck4PT3:X+̆ :N4}G7˘dPiYr&;1~~\Qwmx1!gWG #hJ leH"{!KHfwcPRNΪb:"@!XCߟ]:TRQ,$@BU{niHӇ\ BhJWM6-_px~Pk8ҠŽT"?B% 8WSi3Yۖ{׼'%CW3JϒH9sBKs+.Ҡy^#(ĜbnSla\׈Ze:zz"}dқ3;)`UA8DJ$H]Lv|t ER)1{@/8[k}XBt/yc<%a I_欬2ou 3$;YcUd~1yеBp~&v C2f65/fy*54uC"~~<{* :{̹溸"lmi[ C @{HYb^aR> {ʥ !]*K@r}XrkʷFM29鋟h(K3hۺ1Np!JQ! 1>_& aL L*n8&W; 7o#]O?[5rI@J4=ױ:qpGLF)JNp1eDŽx⫑^N$X9JZfesʗ篯?DrJѾAAL!ER:B;-sFN]gxHcݰUDlmA7(N U~wJGD.p;9նR̕ ϔFڼYL䤏 jxej(g˹Jr~R{$֢BɃEppQ;r&Klnrv4V7"uJ/Q6cG G]LJ?4+Kx?x4W:R[ y<1뭯| dNym|s($**F C. .u8/IβNkXcGAg›R*`KڏcY[%U9 uov܃^5 5ٜFE.ydVOV3`L$c:S*SYF}>PAͮg ; K-*3ԃ; pa'cP b|xΎ$Ct{u|дsnЎ!́*0zbf:i3%P71_ $/g1M"zQ7[Z{کCQ➦{InAXffsej^|ڙK'g1ybuC adQ@­R'c7($O9t4ϩ#ej_܊[^'iZQISbz%Ls84r)Яad͈GCJLu$L:j1SC@œGZsd+7 w͡|?Bۺ%ntj bM"!s@w(53;LJ[堔h0Y+|gzy' l:32ga69Wc-#sԯViuz@).A.ƛ. gyZk⣜~Ig`** a?vlۙs4H "fdYj`ʻaKl2_{E+> *)}ZwdK $ƝVn^_#EUVӇ-!h]9m)6}}xեƿXKĈ1oAk8-\D0\pѥf6όLz HcͅsL[n:;/%&%J~ )0 טi-#bC/s Zjh\1 6.Pejmls~hN.itR `n,t)/2DbwV_$O=R*Y֧-N(H0ާ]WɈ-SypPgU9qektƠr9WWT ®z-~W0t{VA@u(V|?rG٠G 9%VTscii#m(\v΃0 /O.WSU7Y99a xiv@E鏟V xMM<Z#A0gR챽QbKhЋ'Ԝcaꔪe1%5 8%{ l yW֏xCgJZV˃~Q? L(*2<\#]OX,CfxXZa Vx\|Sx.`n`Y1#g\.ܞoZ:z5l^t`\^S6~|-x3yFn5$)&Õ0^TP/6z*=cjd586[&e"F=1!`8=%fcKLke>ЃigWH灓WivvݽQ0軁 'nZ yad(#"Q!4IzMp}`' ( AsJ2wY1铬%?M(ruͳ X Y0:wyei ď |o @pHZ| ^1;3],Ԙ&A|U"VbJ=w&WjwB!ΐ̠Ad$ܱ5u o?C :ρ8||۳RNk7)݂>Ņ.slΰŃ Q{U=\O};lyymGiزN,:-Gz0%Γ'B$ =FEG^WL)\o\Bxys?bVv;Y|W+ ɋ8b9G$gADC`XL#)jg :v]' xxp\ 0>_AZ wkMc| ~%k^-x&ъ%K@CBsB)RXu2pر&ʱGH(ýx JHtLIS^1Rڎx/%IFUG44MZ%[E2,|H}/.bwۥ#Eýl46$*OeB4:D0RvPn'[M\R&SB < \ϫwK\ELr`KG0ڡJf 6$Ƀ?34úUNs/V.M $=39]Ҫ#d#YYjCU^<4lK`m~9;UBL~.,5.RXi!??Ȋ,>,jYV@Ϊު+0٦^FoO20򍤑q[Z2N({Frx5{^ oۇ ӂVS5/tX L NKE 6m8/1ʔɟv qFJVNlRg}9&C5vf5, ixi=FD%4 /EVO^W3Ǿ=GAG/ ?230(=5ˬ\u< ' Ođ9y]#Iz0ny]'n带T2LKlG m= jb!Ott\B. 8;Q@6]L ogA*|M#Eq>f4%i)v,ϷЉ8%BardXDq O v9p봐 8aԅyr2 GSx{ElkwIhZOnBM}LNȧ8B?2q~w0Rv[8 V+ʆ΋-0@RVuialSVK&ɰa,<-̀ȷUvCB6n_Lc\LJ'"V X1e6 bmEo ɥ.6—`xzx.X%a\\3aG=J`~Xәѓ b?Ţnm~BFV=Sl5iꩮJ(}H*X] Mb ֮j}GiXh4amurv_Ww0i$hc(ܻrS)ehzDOt1ѳ;ERg+=%BeH3!:gSoxsvKK^W ŚJF i߾?ca6q8}@豋 ~/Gap*%#%OAb_}ӈ c-%])w8x󰔗DLju@ʚ86cJt+ʌʀ,ԑ4b]1a SRo<9#v1@J9v `!߾$@Γc}zEι[t[ʴ zB6N.5ߪN[Nߺ±yq,[I'i okALJTEP8~yHKJdrDz7 (f2gIedlWv69HI1=jXŨSZA*{@Eq1e(vd)-<֪6@ x@閗 S3̹T7u UCO5wM1]2z9jg/zkN^;+O(Eۑ̙D+0cX Fx!kc~Z@jEZ鉮'<7v jtd6G[-΀{&NCM:e~ȟk`f]N/𫧣w. R뢹E u1@#2kԆ֭xwo @+meSi HM1vx5 ֛OP8 9EzFf% 8(w.<3džb4<.eC^808"mS٠dSy/*K@⫀ElhރՌKeܜ^OH`tc,z2ka֨ ۴.W͔bMƢCo6)83CJeؖ!Fw QS_`?Hs~a|Шwa,GM(Tؔ8E[ȘıҔ9d.y`D54m/9Ew!8"̲a=&{Js;LbI&#_ ,1="Tt\ #6UIx`'3E# .$b.D t񅇛϶-"Ν.t-;˔q EW@7o{O3ET-F;MP22ُR_ Ŝ5fL죕/4A9̚qm}/mj,se۫6ۺ$s~A\OsnПW q4}Sަ?E : UdVSf}+`~gTfڤ<4-1ܸ|BXl+謥^NEWayΆ|/{gF e#WD`\ު,DA#X% j*#U 5&ŚwN~Qŵ҇Uj!*.q|в@ECpw{4!& KѤDZ9GSaUQ#I|>t92|'V>#ntq"L ~ꘆŢhPu~S֪3Ý IBSh@l8iĦeZ{Պ7s᦭믽:>@@r_T&3ߑ 5u+Ǜ |]yML=Ѫ[M j˸Kj6&:`i#nG4XM3h7 *v1~Io #gZھ}ZV] zy؟{[f$+8 6'# S_NR#u8C,Hz$i? ՠ=ԩ3怱9UOVz(ܠL+3EdwWߑiZ~pC}e^YQ(A:SO19;|S-h^wĖ4 o9!@S2hպHE:Cr2;<pԲ?M:gZ ;x % p"}l4SJT@D뷻 `s+HXJӅ=aĜ<13GD7>1OMtg7R/;xMWQzꆙL#jm^okd8"]Bw^QY'ˉ5ֹ*ϡБXpt?ub:HPPx:hO&j&ɋSe{4T7\]ׅJ "\i*e&`?ݢ)(V"O+-bLB tI~wih۳2 -g9q/"96N(f(xYgùhZ\RΤت?gKM{SI|Yu((g}oz-ȵS 2ۙ_: tޤ| 5z{_o Hu&<@p2 М3iƶf7xK hj)b!؜ v6_Ei+8yFr~NY0M/|{!uvډ:L:X)@=V(` >|_(p&7y$mdzzsޛ03<>~R@ >&aӄԊD| Z aCƧ, b֢x Qٖyh"鵳e2 IHKy}Jэf|++Ś\!dtɵ%q y0B=t q!f>buӏPb"d㼰w= \ݹkEa 9>]@?Gq1|DuA Zw,:ϟkwǥ_S-iw9NhfbC[, .b`)ɮF}XGtzHNiG S9[ C^*@RDyrmlG~ob˚A ߀!Gξ+%ڋ/c)&⣥y\~Q([LsUNVƁ$Z~7,8 lEMݺJ5P\[הQQ6-~ct  EXEKg!.&HDPfXFuK y֪fW?[ncZ/?{߽[x*ԝ z " z1㾇aT&d0Yc"ΌI?+"#*,M,ҩ2r厗/(_] (dk$ h3ln͔.KɧpZlVq|mHܸ[P-7k< Vi#q"(RRYw<-BET⁲k?8ExBX;szv5 + }=jzӥ(R,7#$k~ԖXP`c00Vc\:M0q{pn'=%.͉c@a6ҥGb)xkL1=h"*9 `}vHBDh)8kIv/X"6n!*IMZbRhh䍅-c[m%qx|;:ԯ'NL/ `rNͭȍbxlUSXjT2/2J#T)c$쮣aB׬ϘON1 @F/ ֙v7( P[]=~WdxGlp>3Y凒AeRo[h4,&1le&cB', ߤu7M a"Bc N!5P"L[ӂ_z*``4Hͧs(9g![1I1|J%|.uk\p iӁ!։ W:U`^d}ƕ\ !P4~˔񎕚翚-CG&ޮu-n<(-/SLa:H"̉[IT/ǙR(8&O a[ Qy%PbC.2LI5Y;)ܚ*JMduI(-ybԖf ƁIGgeDhdzd񦕙p/8 ܓcD$]0hntJjP xTPmvI οx8iD/? UGw~K`g X!$!ߚhX-ӂ]Mw U v?Aky}9=7ݟ[ sD?a@(tEQxءpJ0ΤېD>fhv&m*[\x+#R-0 ?ޖl_N1[0_ v'nzlּ֛/9Knu`ނ4f@$ܞd^k2!$b;x+{3A>"LJ7&"dq#n4,#u{aW:2EˀԵ,5=o~: <F`ݦf\F1b2F!܃it2%DSGeܗh"9&x@﨧bC 2gĞ:g%/vKpٞ;tFMhG2xJunef!yGOutaIP _w U)ٝWᡐx<ԩҜ/FMP^s[ߘGLEWc9ϝMks_<Y&Pȓ亰="1SsiJo9Z$J(U-hWf6H( FP#@~{#loC](-$_ϬFɶmzhRC%-/=hS`]{3wA ;l .>8*{ LT?h[ma|WI9niDiRToٻMKvF^7h95P3w"Qhī@6L*v&Ƹne\7ּ<3[ugk?0Bι +,dcGg}`׺*{Ůf%)&yÏ,H0pW_#;NKe95PK%$J}iF2M yIkm'P 09w $~^uR\նݺ5Kj;aU`_y?"հfX !11s] %)UupM|gک!$惤wL-f ӈ :!@+|y\}g?9OQcE6ת }be@'Č̌MJ_1sRĨz>/V 0Ж[Vq[yɤ3T4.$d.]W$87S,4i@ ݅*|HGx C]˦(?5|4".2F>tߥZaL7e!gx|P&D1E@vJک2 >S7(]l?F$KNZֲTh0Y QU+):Q堹,Ӗ:.isGړXO)whb(y\?!C~ۿ$A03EbG'9n:,lZݯ ]ʋVҷpBȘYR6Cr#Q!kAƑp&y E@LtN# Aa*/h(Bh{exR(^%yBY"W>r1*B*)AF2GUkeeAlRQ :PAX߽^7ZS KBҲHOG\"xZ"t|L"eϧyvF-:o\*B;{Pq[OCqn苗3"л 8: åg2jdT= #fNe#=>iKpT}ժmРHSCKv$cNϼmO6HX~9<.NY#F/]wfHGvpe_&dlMPѓFsNކX" wci!$}VHKjb_͉ϸCC\Y 1F;-Õ z'+' 8"%z{6E@^s[P=(iNn)L[hpbx=Ә>Ae)X{Z !ji.˱C|nt􀩺}.KUWyv(;X{qQߝ04]*nk]`/uJ,sX^OO~No2 ^eNy XwS/$] $&:4SxjSPTlk֤4l ts&mW 'UU5wcD=ўIjÀ#{.QցP|K84XVOB _ݔƫ=J{nAõs { ӆ*[k FXÇzvMEh+[$"oRQm'x[}~7auVӺ% UOoh\0_M&%%CJK k5Y#N*D6>F@%0| [_kBI~QxCdڿ -띩&x:y\ xHڀm[*(O7fCpl/2es;~݁􌙽MgyAZ|&C&iUmOVkTQ1~ `C`1EذxHaOPmc k'.>`93^_Җ@gҟ<7pDUvP6:3)>{aTA}@&H}ex7c,qj$qH6F~+L 5ٯNQ6H F%sWz',k~m-㣱=&%ocVYJn1U3,xuփ09>&-qPmM~o#ǻ{-Eˬqj_jnJ{ySC_#dA7f`wTN2@\[ q_tLOԃ's 놉X>\s}@.Q ږŒJ=JӶW{ %B;Z5Yơ# *qdTA8P06RWJEs$-|j\y1DhTd2Oȁ'Ҁ!9R4jG`3 Hα*U>nr"4OQy$MK+5?L)]{Y!kiW,I07-KDz(KAA '="ʦT"'e5#@KrF5bqՆ]ڻ%M`A&+V-O(3p u6POpj+r:~Y{# r(:5uJ^.-8LwİLQ#xcUP/,OJB~͉-xL=foA0)$fpL4˚gƈ"|`cB%yH)rS`t[ D'͖V$_o49Jw S~Z4ݫGU1;dLJ{J8$ r'9W݅jqNzʿ2Tۡ0 lt43xgH H]\Uq=!3gHtIKa!T(\O-s1G(uq>=Np*N辚-fzr鋤(M`6Nro!m0k^Ât'O =%SP'`.)1(u=dBUOʾ,ȕ%%̕tD |G)-"ge`. ܜMGga J[m\?L#>T7]hBsX| Hn8e'C΃- pIurm פӫx=gZjO*Cl\auOJ/j>FtijDvL,;(ӗpUAB,ѹNfKɾrFAȴ^]z2Ɯi8K_O(걧Rj~Ր(XV]E|hx@lVHM>H| ͵RD#hFOpWʶ; OM=[{K'sf5H5J][EkAsXw%R}}xK16)T3$Tnl0BѰ̒2%sBI@rdv 90i C#ONLasa$|"jNwKC`39DCcTԹBwry"s>REɛ f f|ԓݎ<9[<wҮ%ЛSB~*)Xk85(o$vPp2*5(-wК$B"-E~$4~-"C$/M4DNdoz*4ʩyVm/QYv1/cx"@=&qdlC`,]t^H'Uڱm9U AZ3J{S-؞H7)(w?!ogx?8 rp$C \Tu0=ǵ9|r#{ e`6)&Ee1,;G QS$Z$ǤK(Ap0jf^ٺsGH=A%SkCIF@E{ۛ-trt?Xu\ \u/^;J , (%qӞqBc*1,PCjCүG4RX17@gazPO*.ăeX/|7ca%*WT{UK9Cqr6 C $D:٨9W!&pz P,q zir5du7g˶n {tXc2*e~>q*y~ZB^P{KVqe~7 7l5y)Vc.cGwQd *ZGOtnC=o-,/pO3S˖>p\ၪ+`kDþl| xYҩK3 229iC*,.jg31mi̚pQo3l9 W T2&F\M8&TrAR/q4DB0mTlnej[7,]Tt^񘐜7٢Bf)<7a*)9XBϾ,Z_*m@74.⣍`(FL.BnJN&RɺY}^D*@h)1WI{ezQ@%楈Iq=y4]<޿32 ۄ[T6@a(ࣱQ!OKt;Ϸvax6lC]6Dqe˜8M\PdzeZģTޖ"{qgFbqFLtnfw>4tg1@Oh,ٹkZ%U2a-CEC&M%'94J<k$g˭A@Tw|\Zb{ ߧ|p")# D#4}~ʘS9uUT)Qұ'&KK*BSia8Gg/5h-bS>sw`]7rv)h,D8M\ ,FbBpۮ{R%/B_߂>V}wr gYkСwH_l#7^)DbNfhXi"CsLʵ+aat;QMPr  ܱĀU>P# bY F=5v͕ؔDOt?SjQ $ c4@2Ǽ֩ЗwO/ a&7' A܆*ݡltLeBW|(ɮr~jX+x3 g@pa$5 orD%1 [.F & "V}FPTtKFu: o~hIuZBr%[I&ՌPFveX܋,{9;( @Ƙv[q=WEpƼoTͪXƂFQg9¥ɢ=Y@p+ͫV~FdX̍<1^O{pD[;+]^JV+``RNp%eek-@a+oہڡ}aH[No$}wM }k 4>MF͘ [vl7kE`lHӺ".&o1rp?w*`yFEZi f@OX74+Q,m/ңB]D%Ÿy?7V˃8C"F1wQ/z.`VO磪!SGX#  bzu| QRF13)o$UI=Vkg^:;Fܿvl,ֱx(Mq棬Jz3}lŵ*xj.E2[U(zfe풉tN'(uI f"4 bꩲnk,=5Sd@2kj$;Oh&9j=p*`vٛmvL=N_lړmg)\ˆݛ#vLUD)%NKQv ˧u'{0cM W<"gx23x46:&`5s=dn] gu~ݝ+D&8Ab( &t^qi0ڄ +qg?<@\os 66lp/aW&#Fyr X ~ı%E)$}{̛)櫤v`A&a"{g6ZU tnY"o!S1 7 u)˝=[.{O^= Wّ^|,Opyr{֤kG,XU>U0jrRtNsQŤ3w;+4DhXǙkL(PaqcBjAʹoOB,B8Nܒ;z[h)|=Y.p!Dڦ]?iW( [ nfJWժ)2'8&RkҩV N~ ofseȌvjiu`-y -J._تp^-ss;k/_`[Ey> z/]UoQta:v0򹸼5P50˖:xwu\w0Aq?c*#7qqCΦ DI杧y:(dqb?$ kn=^M4[Ȳ q~z!^?a*t^JA" +o;$ 5vW҅: 8i y#*R7;!Ȑ !q6]ۇIaܽDGYð㉝DqH煟J& +=sكeq`rW5Z-۬DԵ7a @T+ݝ_kk ^',&0N5L{Yv"XX_\G!dl4;>DGqkUC_#w.v_>`f^CH|ʁd uv.' IQbBEd,Q?ZpA%$9J*_K,^d&gD'g¢I᫘h} # ~6 NtYC_}/ ٰvp->]{9[O}X#-􄈕ظA|(R?Dm57#W|V ̎LJGgS6]EGFTczjR` )L {͜\Ttok6{k̢#טFp;)>OI(%.qMY\vBx=Xyu 8!HTUXZHL~ 7e/%&f`8v1&}S]}W%QSڄ9n(.n GxB$1``VO2U(Df9*3vU RlZ*)`.S(E3ɫK:a*q<>u06$6N>A Fh*hp ݕh>G_# 7R0X՚fýɺƋ<]=u2׻"}%]К7J 'y2+[G(IK/ PT!_6jܕm43ʛXHuh'Њ(#Ф%ePK/oi ~ Ö́BW(&<0\-U%9I23ނi `tBIz! fY@`>g0qQi커MȢo* $bxmťw]q.9Z(͵0Vl=ҕ2|qTEgc{¤K0.z*# {*߱ IbiW%3w__zM[X r-(٣8ՠCoELTxGL^>G6e xEb Үnab] `ZV,F떢g3ϴ&7{Q9XLIYg[7Sg,T{'ct^-^rGvL ,c@bHEqK Ne=FG&VlZul7DX̾ .6=Hhĥ{nuFl%aI?FH ~<א Z[fOA2MoY cMPFX4!(lf+ۆ0 gͦ:QVmRE/X,Ǥ(CAU[XRÛLߏ2{Vbe'[uq.]eۜ";:Btwv5'$0)ɺ 969#͸ ƒb%UsehUy }BЃh-_3M&z˓hߑ*i&ӍFxvrA9)oobu6h4?CNMpҏ'k I9,w*{%5s#,e1}Gi[<#Jb5 -J[sJ@ǿݒZBne-mUj@k #Q icB22,nU' *jߑ z n 8?U hY-zE=hR YӱX2d8*Gx_6w #]m5Q Vt?y1GLT dVC^b\ $>8=B"<MY6}zل7%O+R6 ?1cp?dtqE:>nh7e 5.Nw軛:Sb َQ+S[|tg.9_c RTj,a Bq ؊m(Up+S?7DXk;+8 &cN\jkf_}|ʆ2XGvTxب6.p['J{h xz/?Ŀ0*C4'_ ybNo}0`v!͂'lI^LV~ajnێO+#i:N`U},tu< (z>~mw7:,X/D@O lP!oEU>7 <]S&COvjˋ#3\bm\=?DZ*xgɮ }qG qhdx\[C)n&QIgyY8?,|8ywyAsžwŬmZA.:/NIE:QZ>e;:vCF!b^QS k%Hꅨ0;T7[ZIsGc)uN(sO(NQ0wiT=D/Mj6p n_w&'yr.>YJRkM,$L9Y:\4cH7 žQ5vŜ KKrx mr 6x(&MYS&ڤ{LMӒ2 DnJ:P@4 7ƈ*_uMmiʶ}r4<|YW2$܂݀eڨyElh#gf-W4'ci1Ŀi?ߞ4y;|a ᷯ{Hd4i"kO\ҏ2AgixyoJrU&:0q #mpOH&p5k+VY/ mtKYdn2ALzE8LJ I 6`4& |H޺Pl&A+O`u; Zb _hUϠe'q m1g5ΓtpzW Lhԃ(I@VpfF ݏ@+@_2b2 $oϓ#ZgP6]h7{{9*o?g1Mpu*ysOIB3|@u|tteQt}IXaNH4j!a.&42'AU([mz>qz."_*kWRCfܵ`o& kX-J:U4̕8U,@WZڲ2v,oL@EsYJ?<tsG/<o{rj{ qR|7;0x֥I#vbppeT7eQf1%ׇQ@?lXþ~i}EU84!ѧ!8q%&O2 Ia[B!*'G ([Gt{kԞiQ EgAQ':C^ιND*_;]ˆ>tuM.^gsyۤ`^y: R ]W"UnW貶epv?M`@]7{)dJTFNLUR" *%4N%^݌BC7 ߐ %`]ªapr0x:lY-`H`zcwF@Q;"vj;>?‘)Ncs Y选,qVn*t^> "`V*3B)'3|'e&ᬕ40M~_:R_ۃB(YJNyF#5BVtBnX aM1|>o;P/TaUlX0mǸ Q3B nV@(0mWHW y/+z$Ӏo*mJ5Öt67}i QX,[i?>#D }r!O>?%6!vB?x y jly^yxf!{9,3XE<$qNuyi+nFnp(,cka+^9OSsQ -8YxCRѵ뽥x/DL$Ka{V[Ue^fan/PfŠkhLa^"`p]AD;G tF።Y|Ēo7+]eѻБޱM:9iSD44uCcx@cXx]ͺ(! X7M-b=TQ Es| K>\*NKX5Eza3ı2 H?"sQYzfQ`b$\lׁРM7M>a%wy"VSiq Y!&CxEm~Oyj^/T:gEFe'~14 ;|PVI}VI g)A\wXئFa}Jmɒ[z&Ho w?ڵ9*JYu.xh oc5`޵>03դS(yA d@Uo`Zu:./k: u-=U72? 8rV^Y)/ԾaF׽l.E\aG1E[ΔVܟ%p'4,;Px˜+οTl4Dr0#﷩@$ SzI&…O }k`2 _\[ Jb|oEF ϒEnw}NΜ:Z'ghdm,7: bMjHEP.Tt.S]i^޿2"@B 3ւ eNNxNES3nWm]znsK[<%+7fc/q 婩B8 vsYQ+TAϡ uVb"1O@Ca}+*ƀ>i֯#n@89!vAnJ*&-3Xގ>Ä[ ɧOR.)O4Uq⛪^k*(>Q Aob`5ɶ=HaKV긳>PJe,?!iL!gXƈYMAB'}A]:*rDq$Fbo )!|31H$(W#n߅RTVETXΊL~}6Ij[߆G0o] 6ÚC5aY%5 Ce%hkCG_2~au3s2|FxcbMC\ڌg ~}_m>qa ZOF x5%:sTg!)]T҅J 4X;y?U-?C4hN7tW Ҏ%/1[;ѭuO,IBcDdy?o,7v;t̻ ܷNOV' ݨ< DYR{GPڧ1duvW T:;dBg= ֯ 2=Ԡs68<] HF:Uo1vLf\ }P *q,AMߚ"l_,c &cegKpnv6ͰHLD*6ƿ6UoSIeBzXeDZ.w:ɀr2t߆gLݤ]OU'.[oǏfE]ǜvp7y|@.1>o8iTA1ڈĿ2aճb"vg4r6)ij+[" qͧ!).E9p.VxS^C?N>7aPX$R;#\(=,TU`}x=Yp vÒ?r Ü3.Y3ŵlt#h  ۛ1aÍqi-aBo9]KXFT.jqȼ$F$f4gT*f0DLw6ȗl0g y|nQsv:mp,ZG?w8;z!CUx׻2=i'm`@^`2^I hzFΒd)p22m.G{`3h9fp #>$.Ji7e4:8]O=Tő =$ZT;Un,68(2du-^p{\f d|!9qtA L< P$%815k6h|L>C rݨ3v3Iv1Wa=9tOyo,+.:۱U&]w3 Ѽ!Hi~!A|8vtTcHuL1Pԅm}c:W*+=ie{E=i]RaZ,uxhZˍp(\N}<ѼZ$;®HaD+h'QMrXWdihBIU|ɫɷGfg^%l)4ɹ9 tAM3cZLz@WNAID;h,+;Х!_d)K*P[PjB넥f^V6 JBMxrbb_0ʹBń62N>)ǰe!扨@V 9xwT4Axhi-X!Bk>$M(!- ;\ YZ